Dbfetch

ID   X04769; SV 1; linear; genomic DNA; STD; MUS; 788 BP.
XX
AC   X04769;
XX
DT   19-SEP-1987 (Rel. 13, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Murine Ig-related lambda(50) gene (exon 1) transcribed selectively in pre-B
DE   lymphocytes
XX
KW   lambda(5) gene; signal peptide; unidentified reading frame.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-788
RX   PUBMED; 3107979.
RA   Kudo A., Sakaguchi N., Melchers F.;
RT   "Organization of the murine Ig-related lambda 5 gene transcribed
RT   selectively in pre-B lymphocytes";
RL   EMBO J. 6(1):103-107(1987).
XX
DR   MD5; cefa25e87624ab853c6bc4b35435535d.
DR   IMGT/LIGM; X04769.
XX
CC   for continuation see X04748 (exon 2) and X04770 (exon 3)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..788
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="genomic in EMBL-3"
FT                   /clone="7pB12"
FT                   /cell_line="murine pre-B lymphoma 70Z/3"
FT                   /db_xref="taxon:10090"
FT   precursor_RNA   268..>788
FT                   /note="put. primary transcript"
FT   mRNA            268..>600
FT                   /note="exon 1"
FT   exon            268..600
FT                   /number=1
FT   misc_feature    278..278
FT                   /note="pot. altern. transcription start site"
FT   CDS             407..>600
FT                   /note="lambda(5) precursor; 600 is 2nd base in codon"
FT                   /protein_id="CAA28462.1"
FT                   /translation="MKLRVGQTLGTIPRQCEVLLLLLLLGLVDGVHHILSPSSAERSRA
FT                   VGPGASVGSNRPSLWALPG"
FT   misc_feature    488..496
FT                   /note="pot. signal peptide cleavage site"
FT   misc_feature    506..514
FT                   /note="pot. signal peptide cleavage site"
XX
SQ   Sequence 788 BP; 181 A; 184 C; 251 G; 172 T; 0 other;
     ctgcagagac tcttgttcca tggggcaggt gttcagttgc tctctacggc ccctctaagc        60
     cctggggacc tgctccacag acccaggggc cctcagggac tggatatcag tcaggcagag       120
     ctgcccagag ctctagggat gggttaagac aggcagctgt gagtgaaaac agttaggctt       180
     gcatcccaac cacaaccggg tagtcctttg ggagagaact ccacagatgg tgaccatggg       240
     cactggggtg tgcctgctgg tggtggaaac tagagacagc ctggggtttg gctacacaga       300
     tccacctgca ctggaatagc ttttggccac cagaggagga acaatccttt tgccgggaga       360
     tctacactgc aagtgaggct agagttgact ttggacttga gggtcaatga agctcagagt       420
     aggacagact ctgggcacta tccccaggca gtgtgaagtt ctcctcctgc tgctgctgtt       480
     gggtctagtg gatggtgtcc accacatact ttccccaagc tcagcagaaa ggagcagagc       540
     tgtgggccct ggagcttcag tgggaagcaa caggcctagc ctatgggccc ttcccggcag       600
     gtaagagact tgctttttgg ggaaggtacg cgtgtaggtc cacggactag aggctagaat       660
     gagtgactgg gaaggaaggt ggctattgag gccatgggtg tgagaaggaa ggatctgcct       720
     aagaggaggg ggctgtgcaa atgctagctt aaacttggta cctcgatcaa ttgcaaggcc       780
     agtgttct                                                                788
//