Dbfetch
ID HLA09208; SV 1; standard; DNA; HUM; 270 BP. XX AC HLA09208; XX SV HLA09208.1 XX DT 28-FEB-2013 (Rel. 3.12.0, Created, Version 1) DT 17-APR-2013 (Rel. 3.12.0, Last Updated, Version 1) XX DE HLA-DRB1*15:93, Human MHC Class II sequence (partial) XX KW Human MHC; HLA; Class II; HLA-DRB1; Allele; HLA-DRB1*15:93; XX OS Homo Sapiens (human) OC Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates; OC Catarrhini; Hominidae; Homo. XX CC -------------------------------------------------------------------------- CC IPD-IMGT/HLA Release Version 3.63.0 CC -------------------------------------------------------------------------- CC Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative CC Commons Attribution-NoDerivs License, see; CC http://www.ebi.ac.uk/ipd/imgt/hla/licence/ for further details. CC -------------------------------------------------------------------------- CC The sequence below is the official allele sequence as approved by the CC WHO Nomenclature Committee for Factors of the HLA System. CC Any cross references may differ from the sequence shown below. CC -------------------------------------------------------------------------- XX RN [1] RP 1-270 RA Street J, Johnson J, Cooke E, Darke C; RT "The second example of HLA-DRB1*15:93."; RL International Journal of Immunogenetics 41:435(2014). XX RN [2] RP 1-270 RX PUBMED; 25220445. RA Hernandez-Frederick CJ, Cereb N, Giani AS, Ruppel J, Maraszek A, Pingel J, RA Sauter J, Schmidt AH, Yang SY; RT "Three hundred and seventy-two novel HLA class II alleles identified in RT potential hematopoietic stem cell donors from Germany, the United States, RT and Poland."; RL Tissue Antigens 84:497-502(2014). XX DR EMBL; HG004402; HG004402.1. DR EMBL; KC209778; KC209778.1. XX FH Key Location/Qualifiers FH FT source 1..270 FT /organism="Homo sapiens" FT /mol_type="genomic DNA" FT /db_xref="taxon:9606" FT /ethnic="European, Undefined" FT /cell_line="15510131" FT /cell_line="HG00005406" FT CDS <1..270 FT /codon_start=3 FT /partial FT /gene="HLA-DRB1" FT /allele="HLA-DRB1*15:93" FT /product="MHC Class II HLA-DRB1*15:93 sequence" FT /translation="RFLWQPKRECHFFNGTEWVRFLDRYFYNQEESVRFDSDVGEFRAV FT TELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR" FT exon 1..270 FT /number="2" SQ Sequence 270 BP; 55 A; 65 C; 101 G; 49 T; 0 other; cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagtgggtgc 60 ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg 120 gggagttccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga 180 aggacatcct ggagcaggcg cgggccgcgg tggacaccta ctgcagacac aactacgggg 240 ttgtggagag cttcacagtg cagcggcgag 270 //