spacer
spacer

SAS results for UniProt accession no. Q8DIS7

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. Q8DIS7 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q8DIS7 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 50 unique sequences (including 7 consensus sequences) giving 73 sequence matches in all. The 42 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q8DIS7 --mktlp--ke--rryetfsylpplsdaqiarqiqyaidqgyhpcvef------------netsn   Ribulose bisphosphate carboxylase small subunit  ...
2ybv:B ----tlp--ke--rryetfsylpplsdaqiarqiqyaidqgyhpcvef------------netsn   Structure of rubisco from thermosynechococcus elongatus
3zxw:B -------------------sylpplsdaqiarqiqyaidqgyhpcvef------------netsn   Structure of activated rubisco from thermosynechococcus  ...
1rsc:M -smktlp--ke--rrfetfsylpplsdrqiaaqieymieqgfhplief------------nehsn   Structure of an effector induced inactivated state of  ...
1rbl:M -smktlp--ke--rrfetfsylpplsdrqiaaqieymieqgfhplief------------nehsn   Structure determination and refinement of ribulose 1,5  ...
1uzh:C MMVWTPV--NN--KMFETFSYLPPLTDEQIAAQVDYIVANGWIPCLEF------------AEHSN   A chimeric chlamydomonas, synechococcus rubisco enzyme
1svd:M -EMQDYK--QS--LKYETFSYLPPMNAERIRAQIKYAIAQGWSPGIEH------------VEVKN   The structure of halothiobacillus neapolitanus rubisco
1ir1:S --xkvwp--tqnmkryetlsylpplttdqlarqvdyllnnkwvpclef-------------etdh   Crystal structure of spinach ribulose-1,5-bisphosphate  ...
1aa1:S*mqvwpil--nl--kkyetlsylpplttdqlarqvdyllnnkwvpclef-------------etdh×9 Activated spinach rubisco in complex with the product 3-  ...
1bur:S mqvwpil--gm--kkyetlsylppltteqllaevnyllvnnwipclef-------------evkd   Ribulose 1,5-bisphosphate carboxylase/oxygenase complexed  ...
1bxn:I ---------mr--itqgtfsflpeltdeqitkqleyclnqgwavgley------------tddph   The crystal structure of rubisco from alcaligenes eutrophus  ...
1uzd:C MMVWTPV--NN--KMFETFSYLPPLTDEQIAAQVDYIVANGWIPCLEFATDHGFVYREHHNSPGY   Chlamydomonas,spinach chimeric rubisco
1wdd:S xqvwpie--gi--kkfetlsylppltvedllkqieyllrskwvpclefskvgfvyre---nhrsp   Crystal structure of activated rice rubisco complexed with  ...
3axm:S -xmqvwp--iegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyre---nhrsp   Structure of rice rubisco in complex with 6pg
3axk:S -xmqvwp--iegikkfetlsylppltvedllkqieyllrskwvpclefskvgfvyre---nhrsp   Structure of rice rubisco in complex with NADP(h)
1ej7:S*--mqvwppink--kkyetlsylpdlsqeqllseveyllkngwvpclef-------------eteh×4 Crystal structure of unactivated tobacco rubisco with bound  ...
8rub:S mqvwpil--gl--kkfetlsylppltteqllaevnyllvkgwipclef-------------evkd   Lyase(carbon-carbon)
4rub:S --mqvwppink--kkyetlsylpdlsqeqllseveyllkngwvpclef-------------eteh   A crystal form of ribulose-1,5-bisphosphate  ...
1bwv:S ---------vr--itqgtfsflpdltdeqikkqidymiskklaigiey------------tndih   Activated ribulose 1,5-bisphosphate carboxylase/oxygenase  ...
1iwa:B ---------mr--itqgtfsflpdltdeqikkqidymiskklaigiey------------tndih   Rubisco from galdieria partita
1ir2:I xmvwtpv--nn--kmfetfsylpplsdeqiaaqvdyivangwipclef------------aesdk   Crystal structure of activated ribulose-1,5-bisphosphate  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q8DIS7 a--ei------------------rywtmwklplfnctnaqdvlnevqqcrseypncfirvvafdn   Ribulose bisphosphate carboxylase small subunit  ...
2ybv:B a--ei------------------rywtmwklplfnctnaqdvlnevqqcrseypncfirvvafdn   Structure of rubisco from thermosynechococcus elongatus
3zxw:B a--ei------------------rywtmwklplfnctnaqdvlnevqqcrseypncfirvvafdn   Structure of activated rubisco from thermosynechococcus  ...
1rsc:M p--ee------------------fywtmwklplfdckspqqvldevrecrseygdcyirvagfdn   Structure of an effector induced inactivated state of  ...
1rbl:M p--ee------------------fywtmwklplfacaapqqvldevrecrseygdcyirvagfdn   Structure determination and refinement of ribulose 1,5  ...
1uzh:C P--EE------------------FYWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDN   A chimeric chlamydomonas, synechococcus rubisco enzyme
1svd:M S--MN------------------QYWYMWKLPFFGEQNVDNVLAEIEACRSAYPTHQVKLVAYDN   The structure of halothiobacillus neapolitanus rubisco
1ir1:S g--fvyrehhnspgyydg-----rywtmwklpmfgctdpaqvlneleeckkeypnafiriigfds   Crystal structure of spinach ribulose-1,5-bisphosphate  ...
1aa1:S*g--fvyrehhnspgyydg-----rywtmwklpmfgctdpaqvlneleeckkeypnafiriigfds×9 Activated spinach rubisco in complex with the product 3-  ...
1bur:S g--fvyrehlkspgyydg-----rywtmwklpmfgctdpaqvlneleeckkaypdafiriigfdn   Ribulose 1,5-bisphosphate carboxylase/oxygenase complexed  ...
1bxn:I p--rn------------------tywemfglpmfdlrdaagilmeinnarntfpnhyirvtafds   The crystal structure of rubisco from alcaligenes eutrophus  ...
1uzd:C Y--DG------------------RYWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDN   Chlamydomonas,spinach chimeric rubisco
1wdd:S gyydg------------------rywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdn   Crystal structure of activated rice rubisco complexed with  ...
3axm:S gyydg------------------rywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdn   Structure of rice rubisco in complex with 6pg
3axk:S gyydg------------------rywtmwklpmfgctdatqvlkeleeakkaypdafvriigfdn   Structure of rice rubisco in complex with NADP(h)
1ej7:S*g--fvyrennkspgyydg-----rywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdn×4 Crystal structure of unactivated tobacco rubisco with bound  ...
8rub:S g--fvyrehdkspgyydg-----rywtmwklpmfgctdpaqvvneveevkkaypdafvriigfdn   Lyase(carbon-carbon)
4rub:S g--fvyrennkspgyydg-----rywtmwklpmfgctdatqvlaevgeakkaypqawiriigfdn   A crystal form of ribulose-1,5-bisphosphate  ...
1bwv:S p--rn------------------ayweiwglplfdvtdpaavlfeinacrkarsnfyikvvgfss   Activated ribulose 1,5-bisphosphate carboxylase/oxygenase  ...
1iwa:B p--rn------------------ayweiwglplfdvtdpaavlfeinacrkarsnfyikvvgfss   Rubisco from galdieria partita
1ir2:I a--yvsnesairfgsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdn   Crystal structure of activated ribulose-1,5-bisphosphate  ...

                1         1         1         1         1    
                4         5         6         7         8    
       123456789012345678901234567890123456789012345678901234              Protein name
       ---------+---------+---------+---------+---------+----              ------------
Q8DIS7 ik--qcq--vmsfivykpnqansgysgyry------------------------              Ribulose bisphosphate carboxylase small subunit  ...
2ybv:B ik--qcq--vmsfivykp------------------------------------              Structure of rubisco from thermosynechococcus elongatus
3zxw:B ik--qcq--vmsfivykp------------------------------------              Structure of activated rubisco from thermosynechococcus  ...
1rsc:M ik--ecq--tvsfivhrpgr----------------------------------              Structure of an effector induced inactivated state of  ...
1rbl:M ik--ecq--tssfivhrpgr----------------------------------              Structure determination and refinement of ribulose 1,5  ...
1uzh:C QK--QVQ--IMGFLVQRPKTARDFQPANKRSV----------------------              A chimeric chlamydomonas, synechococcus rubisco enzyme
1svd:M YA--QSL--GLAFVVYRGN-----------------------------------              The structure of halothiobacillus neapolitanus rubisco
1ir1:S nr--qvq--cvsfiaykpag----------------------------------              Crystal structure of spinach ribulose-1,5-bisphosphate  ...
1aa1:S*nr--evq--cisfiaykpagy---------------------------------           ×9 Activated spinach rubisco in complex with the product 3-  ...
1bur:S kr--qvq--cisfiaykpagy---------------------------------              Ribulose 1,5-bisphosphate carboxylase/oxygenase complexed  ...
1bxn:I th--tvesvvmsfivnrpadepgfrlvrqeepgrtlrysiesya----------              The crystal structure of rubisco from alcaligenes eutrophus  ...
1uzd:C QK--QVQ--IMGFLVQRPKQPANKRSV---------------------------              Chlamydomonas,spinach chimeric rubisco
1wdd:S vr--qvq--lisfiaykppg----------------------------------              Crystal structure of activated rice rubisco complexed with  ...
3axm:S vr--qvq--lisfiaykppg----------------------------------              Structure of rice rubisco in complex with 6pg
3axk:S vr--qvq--cisfiaykp------------------------------------              Structure of rice rubisco in complex with NADP(h)
1ej7:S*vr--qvq--cisfiaykpegy---------------------------------           ×4 Crystal structure of unactivated tobacco rubisco with bound  ...
8rub:S kr--qvq--cisfiaykpagy---------------------------------              Lyase(carbon-carbon)
4rub:S vr--qvq--cisfiaykpegy---------------------------------              A crystal form of ribulose-1,5-bisphosphate  ...
1bwv:S vrgiest--iisfivnrpkh-epgfnlmrqedksrsikytihsyesykpedery              Activated ribulose 1,5-bisphosphate carboxylase/oxygenase  ...
1iwa:B vrgiest--iisfivnrpkh-epgfnlmrqedksrsikytihsyesykpedery              Rubisco from galdieria partita
1ir2:I qk--qvq--imgflvqrpksardwqpankrs-----------------------              Crystal structure of activated ribulose-1,5-bisphosphate  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q8DIS7. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 118 - - Q8DIS7 Ribulose bisphosphate carboxylase small subunit OS=Thermosynechococcus elongatus (strain BP-1) GN=rbcS PE=1 SV=1
2. 733 100.0% 104 104 1002.2 7.5e-49 2ybv:B Structure of rubisco from thermosynechococcus elongatus
3. 660 100.0% 93 93 904.2 2.1e-43 3zxw:B Structure of activated rubisco from thermosynechococcus elon complexed with 2-carboxyarabinitol-1,5-diphosphate
4. 555 69.4% 108 109 761.3 2e-35 1rsc:M Structure of an effector induced inactivated state of ribulo bisphosphate carboxylase(slash)oxygenase: the binary comple enzyme and xylulose bisphosphate
5. 548 69.4% 108 109 751.8 6.6e-35 1rbl:M Structure determination and refinement of ribulose 1,5 bisph carboxylase(slash)oxygenase from synechococcus pcc6301
6. 411 52.0% 102 122 565.9 1.5e-24 1uzh:C A chimeric chlamydomonas, synechococcus rubisco enzyme
7. 349 44.9% 107 108 482.9 6.3e-20 1svd:M The structure of halothiobacillus neapolitanus rubisco
8. 395 47.5% 120 122 405.0 1.4e-15 1ir1:S Crystal structure of spinach ribulose-1,5-bisphosphate carboxylase/oxygenase (rubisco) complexed with co2, mg2+ an carboxyarabinitol-1,5-bisphosphate
9. 386 47.3% 112 123 399.6 2.7e-15 1aa1:S * Activated spinach rubisco in complex with the product 3- phosphoglycerate
10. " " " " " "  = 1aus:S *
Activated unliganded spinach rubisco
11. " " " " " "  = 1rbo:S *
Spinach rubisco in complex with the inhibitor 2-carboxyarabi diphosphate
12. " " " " " "  = 1rco:S *
Spinach rubisco in complex with the inhibitor d-xylulose-2, 2-diol-1,5-bisphosphate
13. " " " " " "  = 1rcx:S *
Non-activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate
14. " " " " " "  = 1rxo:S *
Activated spinach rubisco in complex with its substrate ribu bisphosphate and calcium
15. " " " " " "  = 1upm:C *
Activated spinach rubisco complexed with 2-carboxyarabinitol 2 bisphosphat and ca2+.
16. " " " " " "  = 1upp:I *
Spinach rubisco in complex with 2-carboxyarabinitol 2 bisphosphate and calcium.
17. " " " " " "  = 8ruc:I *
Activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate
18. 357 43.8% 112 123 384.7 1.8e-14 1bur:S Ribulose 1,5-bisphosphate carboxylase/oxygenase complexed with carbon dioxide, mg==2+== and 2-carboxyarabinitol-1,5-bisphosphate
19. 276 40.2% 97 129 383.1 2.3e-14 1bxn:I The crystal structure of rubisco from alcaligenes eutrophus angstroms.
20. 374 43.7% 119 129 376.3 5.4e-14 1uzd:C Chlamydomonas,spinach chimeric rubisco
21. 353 43.6% 110 121 373.9 7.3e-14 1wdd:S Crystal structure of activated rice rubisco complexed with 2 carboxyarabinitol-1,5-bisphosphate
22. 359 42.9% 119 122 373.9 7.4e-14 3axm:S Structure of rice rubisco in complex with 6pg
23. 357 42.9% 119 120 371.3 1e-13 3axk:S Structure of rice rubisco in complex with NADP(h)
24. 357 43.0% 121 123 364.4 2.5e-13 1ej7:S * Crystal structure of unactivated tobacco rubisco with bound ions
25. " " " " " "  = 1rlc:S *
Crystal structure of the unactivated ribulose 1, 5-bisphosph carboxylase(slash)oxygenase complexed with a transition sta 2-carboxy-d-arabinitol 1,5-bisphosphate
26. " " " " " "  = 1rld:S *
Solid-state phase transition in the crystal structure of rib biphosphate carboxylase(slash)oxygenase
27. " " " " " "  = 3rub:S *
Crystal structure of the unactivated form of ribulose-1,5-bi carboxylase(slash)oxygenase from tobacco refined at 2.0-ang resolution
28. 348 42.0% 112 123 363.1 3e-13 8rub:S Lyase(carbon-carbon)
29. 353 43.0% 121 123 359.0 5e-13 4rub:S A crystal form of ribulose-1,5-bisphosphate carboxylase(slas oxygenase from nicotiana tabacum in the activated state
30. 258 36.1% 108 138 358.3 5.5e-13 1bwv:S Activated ribulose 1,5-bisphosphate carboxylase/oxygenase (r complexed with the reaction intermediate analogue 2-carboxy 1,5-bisphosphate
31. 258 36.1% 108 138 358.3 5.5e-13 1iwa:B Rubisco from galdieria partita
32. 377 44.2% 120 139 350.1 1.6e-12 1ir2:I Crystal structure of activated ribulose-1,5-bisphosphate carboxylase/oxygenase (rubisco) from green alga, chlamydomo reinhardtii complexed with 2-carboxyarabinitol-1,5-bisphosp cabp)

Number of sequences: 32

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 372 43.3% 120 140 350.1 1.6e-12 1uw9:C * L290f-a222t chlamydomonas rubisco mutant
2. " " " " " "  = 1uwa:C *
L290f mutant rubisco from chlamydomonas
3. 371 43.3% 120 139 348.7 1.9e-12 2v63:I * Crystal structure of rubisco from chlamydomonas reinhardtii with a large-subunit v331a mutation
4. " " " " " "  = 2v67:I *
Crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit supressor mutation t342i
5. " " " " " "  = 2v68:I *
Crystal structure of chlamydomonas reinhardtii rubisco with large-subunit mutations v331a, t342i
6. " " " " " "  = 2v69:I *
Crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit mutation d473e
7. " " " " " "  = 2v6a:I *
Crystal structure of chlamydomonas reinhardtii rubisco with large-subunit mutations v331a, g344s
8. " " " " " "  = 2vdh:I *
Crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit c172s mutation
9. " " " " " "  = 2vdi:I *
Crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit c192s mutation
10. 249 36.1% 108 138 346.1 2.6e-12 4f0h:B * Unactivated rubisco with oxygen bound
11. " " " " " "  = 4f0k:B *
Unactivated rubisco with magnesium and carbon dioxide bound
12. " " " " " "  = 4f0m:B *
Unactivated rubisco with magnesium and a water molecule boun
13. 367 43.6% 117 125 344.0 3.4e-12 1gk8:I Rubisco from chlamydomonas reinhardtii
14. 333 38.3% 120 123 329.3 2.3e-11 4mkv:S Structure of pisum sativum rubisco with aba
15. 328 38.3% 120 123 322.5 5.4e-11 4hhh:S Structure of pisum sativum rubisco
16. 89 21.6% 102 126 130.4 2.7 4fla:A Crystal structure of human rprd1b, carboxy-terminal domain
17. 89 21.6% 102 133 130.1 2.8 4nad:B Crystal structure of thE C-terminal domain of crept
18. 89 30.4% 46 606 120.5 9.7 3sqv:A Crystal structure of e. Coli o157:h7 e3 ubiquitin ligase, nl human e2, ubch7
19. 89 30.4% 46 607 120.4 9.7 3naw:A Crystal structure of e. Coli o157:h7 effector protein nlel
20. 89 30.4% 46 612 120.4 9.7 3nb2:A Crystal structure of e. Coli o157:h7 effector protein nlel
21. 84 31.2% 48 502 114.9 20 2wzg:A Legionella glucosyltransferase (lgt1) crystal structure
22. 84 31.2% 48 505 114.9 20 3jt1:A Legionella pneumophila glucosyltransferase lgt1, udp-bound f
23. 84 31.2% 48 515 114.7 20 2wzf:A Legionella pneumophila glucosyltransferase crystal structure
24. 84 31.2% 48 520 114.7 20 3jsz:A Legionella pneumophila glucosyltransferase lgt1 n293a with u
25. 85 23.3% 90 640 114.7 20 3ua4:A Crystal structure of protein arginine methyltransferase prmt
26. 85 23.3% 90 662 114.5 21 3ua3:A Crystal structure of protein arginine methyltransferase prmt complex with sah
27. 85 28.8% 66 734 113.8 23 4l79:A Crystal structure of nucleotide-free myosin 1b residues 1-72 bound calmodulin
28. 73 25.6% 39 75 112.1 28 2ofs:A Crystal structure of human cd59
29. 77 28.4% 81 266 109.5 40 3ctp:A Crystal structure of periplasmic binding protein/laci transc regulator from alkaliphilus metalliredigens qymf complexed xylulofuranose
30. 78 31.2% 64 335 109.4 40 2r8q:A Structure of lmjpdeb1 in complex with ibmx
31. 78 29.4% 51 333 109.4 40 4i15:A Crystal structure of tbrpdeb1
32. 77 35.1% 37 279 109.2 41 4c8b:A Structure of the kinase domain of human ripk2 in complex with ponatinib
33. 73 22.0% 50 122 109.0 42 1mc2:A * Monomeric lys-49 phospholipase a2 homologue purified from ag
34. " " " " " "  = 1mg6:A *
The crystal structure of a k49 pla2 from the snake venom of agkistrodon acutus
35. 78 36.4% 44 358 108.9 42 3d1c:A Crystal structure of flavin-containing putative monooxygenas (np_373108.1) from staphylococcus aureus mu50 at 2.40 a res
36. 72 27.2% 81 106 108.6 44 2j5a:A Folding of s6 structures with divergent amino-acid composition: pathway flexibility within partly overlapping foldons
37. 75 39.5% 38 208 108.3 46 4mi0:A Human enhancer of zeste (drosophila) homolog 2(ezh2)
38. 75 39.5% 38 208 108.3 46 4mi5:A Crystal structure of the ezh2 set domain
39. 75 39.5% 38 226 107.8 49 2c6v:A Model of ezh2 set domain
40. 72 22.2% 72 121 107.7 50 1s8g:A * Crystal structure of lys49-phospholipase a2 from agkistrodon contortrix laticinctus, fatty acid bound form
41. " " " " " "  = 1s8h:A *
Crystal structure of lys49-phospholipase a2 from agkistrodon contortrix laticinctus, first fatty acid free form
42. " " " " " "  = 1s8i:A *
Crystal structure of lys49-phospholipase a2 from agkistrodon contortrix laticinctus, second fatty acid free form

Number of sequences: 42

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer