spacer
spacer

SAS results for UniProt accession no. P37840

Sequence annotated by structure
>

Key:
Sec. struc: By homology
  Helix Strand  

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

 

FASTA alignment for UniProt accession no. P37840 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P37840 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 28 unique sequences (including 7 consensus sequences) giving 42 sequence matches in all. The 11 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P37840 -----------------------------------------------------------------   Alpha-synuclein OS=Homo sapiens GN=SNCA PE=1 SV=1
1xq8:A*-----------------------------------------------------------------×2 Human micelle-bound alpha-synuclein
3q26:A ----------------kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpq   Cyrstal structure of human alpha-synuclein (10-42) fused to  ...
3q27:A -------------------------------------mkieegklviwingdkgynglaevgkkf   Cyrstal structure of human alpha-synuclein (32-57) fused to  ...
2m55:B -----------------------------------------------------------------   Nmr structure of the complex of an n-terminally acetylated  ...
3q25:A ieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwahdr   Crystal structure of human alpha-synuclein (1-19) fused to  ...
1u28:A*-----------------------------------------------------------------×4 R. Rubrum transhydrogenase asymmetric complex (di.NAD+)2(dii
2oo5:A -----------------------------------------------------------------   Structure of transhydrogenase (di.H2nadh)2(diii.NADP+)1  ...
2jn5:A -----------------------------------------------------------------   Solution structure of a dodecapeptide from alpha-synuclein  ...
2r8x:F*-----------------------------------------------------------------×2 Crystal structure of yrbi phosphatase from escherichia coli
2r8e:A -----------------------------------------------------------------   Crystal structure of yrbi from escherichia coli in complex  ...
3i6b:A -----------------------------------------------------------------   Crystal structure of yrbi lacking the last 8 residues, in  ...
2r8x:A*-----------------------------------------------------------------×4 Crystal structure of yrbi phosphatase from escherichia coli
2clp:A -----------------------------------------------------------------   Crystal structure of human aflatoxin b1 aldehyde reductase  ...
1z0b:A -----------------------------------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
2v3b:B -----------------------------------------------------------------   Crystal structure of the electron transfer complex  ...
4jig:A -----------------------------------------------------------------   Crystal structure of a putative dehydrogenase from  ...
1z0c:A -----------------------------------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
1z0e:A*-----------------------------------------------------------------×4 Crystal structure of a. Fulgidus lon proteolytic domain
3orf:A -----------------------------------------------------------------   Crystal structure of dihydropteridine reductase from  ...
3q28:A -------------------------------------------------------mkieegklvi   Cyrstal structure of human alpha-synuclein (58-79) fused to  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P37840 -----------------------------------------------------------------   Alpha-synuclein OS=Homo sapiens GN=SNCA PE=1 SV=1
1xq8:A*-----------------------------------------------------------------×2 Human micelle-bound alpha-synuclein
3q26:A vaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiaveals   Cyrstal structure of human alpha-synuclein (10-42) fused to  ...
3q27:A ekdtgikvtvehpdkleekfpqvaatgdgpdiifwahdrfggyaqsgllaeitpdkafqdklypf   Cyrstal structure of human alpha-synuclein (32-57) fused to  ...
2m55:B -----------------------------------------------------------------   Nmr structure of the complex of an n-terminally acetylated  ...
3q25:A fggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpnppktwee   Crystal structure of human alpha-synuclein (1-19) fused to  ...
1u28:A*-----------------------------------------------------------------×4 R. Rubrum transhydrogenase asymmetric complex (di.NAD+)2(dii
2oo5:A -----------------------------------------------------------------   Structure of transhydrogenase (di.H2nadh)2(diii.NADP+)1  ...
2jn5:A -----------------------------------------------------------------   Solution structure of a dodecapeptide from alpha-synuclein  ...
2r8x:F*-----------------------------------------------------------------×2 Crystal structure of yrbi phosphatase from escherichia coli
2r8e:A -----------------------------------------------------------------   Crystal structure of yrbi from escherichia coli in complex  ...
3i6b:A -----------------------------------------------------------------   Crystal structure of yrbi lacking the last 8 residues, in  ...
2r8x:A*-----------------------------------------------------------------×4 Crystal structure of yrbi phosphatase from escherichia coli
2clp:A -----------------------------------------------------------------   Crystal structure of human aflatoxin b1 aldehyde reductase  ...
1z0b:A -----------------------------------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
2v3b:B -----------------------------------------------------------------   Crystal structure of the electron transfer complex  ...
4jig:A -----------------------------------------------------------------   Crystal structure of a putative dehydrogenase from  ...
1z0c:A -----------------------------------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
1z0e:A*-----------------------------------------------------------------×4 Crystal structure of a. Fulgidus lon proteolytic domain
3orf:A -----------------------------------------------------------------   Crystal structure of dihydropteridine reductase from  ...
3q28:A wingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwahdrfggyaqsg   Cyrstal structure of human alpha-synuclein (58-79) fused to  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P37840 -----------------------------------------------------------------   Alpha-synuclein OS=Homo sapiens GN=SNCA PE=1 SV=1
1xq8:A*-----------------------------------------------------------------×2 Human micelle-bound alpha-synuclein
3q26:A liynkdllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik   Cyrstal structure of human alpha-synuclein (10-42) fused to  ...
3q27:A twdavryngkliaypiavealsliynkdllpnppktweeipaldkelkakgksalmfnlqepyft   Cyrstal structure of human alpha-synuclein (32-57) fused to  ...
2m55:B -----------------------------------------------------------------   Nmr structure of the complex of an n-terminally acetylated  ...
3q25:A ipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvdnagakagltflv   Crystal structure of human alpha-synuclein (1-19) fused to  ...
1u28:A*-----------------------------------------------------------------×4 R. Rubrum transhydrogenase asymmetric complex (di.NAD+)2(dii
2oo5:A -----------------------------------------------------------------   Structure of transhydrogenase (di.H2nadh)2(diii.NADP+)1  ...
2jn5:A -----------------------------------------------------------------   Solution structure of a dodecapeptide from alpha-synuclein  ...
2r8x:F*-----------------------------------------------------------------×2 Crystal structure of yrbi phosphatase from escherichia coli
2r8e:A -----------------------------------------------------------------   Crystal structure of yrbi from escherichia coli in complex  ...
3i6b:A -----------------------------------------------------------------   Crystal structure of yrbi lacking the last 8 residues, in  ...
2r8x:A*-----------------------------------------------------------------×4 Crystal structure of yrbi phosphatase from escherichia coli
2clp:A -----------------------------------------------------rpatvlgamemg   Crystal structure of human aflatoxin b1 aldehyde reductase  ...
1z0b:A -----------------------------------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
2v3b:B -----------------------------------------------------------------   Crystal structure of the electron transfer complex  ...
4jig:A -----------------------------------------------------------------   Crystal structure of a putative dehydrogenase from  ...
1z0c:A -----------------------------------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
1z0e:A*-----------------------------------------------------------------×4 Crystal structure of a. Fulgidus lon proteolytic domain
3orf:A -----------------------------------------------------------------   Crystal structure of dihydropteridine reductase from  ...
3q28:A llaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpnppktweeipaldkel   Cyrstal structure of human alpha-synuclein (58-79) fused to  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P37840 -----------------------------------------------------------------   Alpha-synuclein OS=Homo sapiens GN=SNCA PE=1 SV=1
1xq8:A*-----------------------------------------------------------------×2 Human micelle-bound alpha-synuclein
3q26:A dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygv   Cyrstal structure of human alpha-synuclein (10-42) fused to  ...
3q27:A wpliaadggyafkyengkydikdvgvdnagakagltflvdliknkhmnadtdysiaeaafnkget   Cyrstal structure of human alpha-synuclein (32-57) fused to  ...
2m55:B -----------------------------------------------------------------   Nmr structure of the complex of an n-terminally acetylated  ...
3q25:A dliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvtvlptfkgqpskpfvgv   Crystal structure of human alpha-synuclein (1-19) fused to  ...
1u28:A*--------------------------mkiaipkerrpgedrvaispevvkklvglgfeviveqga×4 R. Rubrum transhydrogenase asymmetric complex (di.NAD+)2(dii
2oo5:A --------------------------mkiaipkerrpgedrvaispevvkklvglgfeviveqga   Structure of transhydrogenase (di.H2nadh)2(diii.NADP+)1  ...
2jn5:A -----------------------------------------------------------------   Solution structure of a dodecapeptide from alpha-synuclein  ...
2r8x:F*-----------------------------------------------------------------×2 Crystal structure of yrbi phosphatase from escherichia coli
2r8e:A -----------------------------------------------------------------   Crystal structure of yrbi from escherichia coli in complex  ...
3i6b:A -----------------------------------------------------------------   Crystal structure of yrbi lacking the last 8 residues, in  ...
2r8x:A*-----------------------------------------------------------------×4 Crystal structure of yrbi phosphatase from escherichia coli
2clp:A rrmdaptsaavtraflerghteidtafvysegqsetilgglglrlggsdcrvkidtkaiplfgns   Crystal structure of human aflatoxin b1 aldehyde reductase  ...
1z0b:A -----------------------------------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
2v3b:B -----------------------------------------------------------------   Crystal structure of the electron transfer complex  ...
4jig:A -----------------------------------------------------------------   Crystal structure of a putative dehydrogenase from  ...
1z0c:A -----------------------------------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
1z0e:A*-----------------------------------------------------------------×4 Crystal structure of a. Fulgidus lon proteolytic domain
3orf:A -----------------------------------------------------------------   Crystal structure of dihydropteridine reductase from  ...
3q28:A kakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvdnagakagltflvdliknkhm   Cyrstal structure of human alpha-synuclein (58-79) fused to  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P37840 -----------------------------------------------------------------   Alpha-synuclein OS=Homo sapiens GN=SNCA PE=1 SV=1
1xq8:A*-----------------------------------------------------------------×2 Human micelle-bound alpha-synuclein
3q26:A tvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgavalksyee   Cyrstal structure of human alpha-synuclein (10-42) fused to  ...
3q27:A amtingpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltd   Cyrstal structure of human alpha-synuclein (32-57) fused to  ...
2m55:B -----------------------------------------------------------------   Nmr structure of the complex of an n-terminally acetylated  ...
3q25:A lsaginaaspnkelakeflenylltdegleavnkdkplgavalksyeeelakdpriaatmenaqk   Crystal structure of human alpha-synuclein (1-19) fused to  ...
1u28:A*gvgasitddaltaagatiastaaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgalt×4 R. Rubrum transhydrogenase asymmetric complex (di.NAD+)2(dii
2oo5:A gvgasitddaltaagatiastaaqalsqadvvwkvqrpmtaeegtdevalikegavlmchlgalt   Structure of transhydrogenase (di.H2nadh)2(diii.NADP+)1  ...
2jn5:A -----------------------------------------------------------------   Solution structure of a dodecapeptide from alpha-synuclein  ...
2r8x:F*-----------------------------------------------------------------×2 Crystal structure of yrbi phosphatase from escherichia coli
2r8e:A -----------------------------------------------------------------   Crystal structure of yrbi from escherichia coli in complex  ...
3i6b:A -----------------------------------------------------------------   Crystal structure of yrbi lacking the last 8 residues, in  ...
2r8x:A*-----------------------------------------------------------------×4 Crystal structure of yrbi phosphatase from escherichia coli
2clp:A lkpdslrfqletslkrlqcprvdlfylhmpdhstpveetlrachqlhqegkfvelglsnyaawev   Crystal structure of human aflatoxin b1 aldehyde reductase  ...
1z0b:A -----------------------------------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
2v3b:B -----------------------------------------------------------------   Crystal structure of the electron transfer complex  ...
4jig:A -----------------------------------------------------------------   Crystal structure of a putative dehydrogenase from  ...
1z0c:A -----------------------------------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
1z0e:A*-----------------------------------------------------------------×4 Crystal structure of a. Fulgidus lon proteolytic domain
3orf:A ------------------------------------------------------------sknil   Crystal structure of dihydropteridine reductase from  ...
3q28:A nadtdysiaeaafnkgetamtingpwawsnidtskvnygvtvlptfkgqpskpfvgvlsaginaa   Cyrstal structure of human alpha-synuclein (58-79) fused to  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P37840 --------------------------------------------mdvfmkglskakegvvaaaek   Alpha-synuclein OS=Homo sapiens GN=SNCA PE=1 SV=1
1xq8:A*--------------------------------------------mdvfmkglskakegvvaaaek×2 Human micelle-bound alpha-synuclein
3q26:A elakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkdaqtnssskaek   Cyrstal structure of human alpha-synuclein (10-42) fused to  ...
3q27:A egleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaas   Cyrstal structure of human alpha-synuclein (32-57) fused to  ...
2m55:B --------------------------------------------mdvfmkglskakegvvaaa--   Nmr structure of the complex of an n-terminally acetylated  ...
3q25:A geimpnipqmsafwyavrtavinaasgrqtvdealkdaqtnsssmdvfmkglskakegvvaaa--   Crystal structure of human alpha-synuclein (1-19) fused to  ...
1u28:A*nrpvvealtkrkitayamelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagt×4 R. Rubrum transhydrogenase asymmetric complex (di.NAD+)2(dii
2oo5:A nrpvvealtkrkitayamelmprisraqsmdilssqsnlagyravidgayefarafpmmmtaagt   Structure of transhydrogenase (di.H2nadh)2(diii.NADP+)1  ...
2jn5:A --------------------------------------------mdvfmkglskak---------   Solution structure of a dodecapeptide from alpha-synuclein  ...
2r8x:F*-----------------------------------------------latcygpvsadvmakaen×2 Crystal structure of yrbi phosphatase from escherichia coli
2r8e:A -----------------------------------------------latcygpvsadvmakaen   Crystal structure of yrbi from escherichia coli in complex  ...
3i6b:A ----------------------------------------------slatcygpvsadvmakaen   Crystal structure of yrbi lacking the last 8 residues, in  ...
2r8x:A*-----------------------------------------------latcygpvsadvmakaen×4 Crystal structure of yrbi phosphatase from escherichia coli
2clp:A aeictlcksngwilptvyqgmynaitrqvetelfpclrhfglrfyafnplagglltgkykyedkd   Crystal structure of human aflatoxin b1 aldehyde reductase  ...
1z0b:A ---yklfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsai   Crystal structure of a. Fulgidus lon proteolytic domain  ...
2v3b:B -----------------------------------------------------------------   Crystal structure of the electron transfer complex  ...
4jig:A ----------------------------------------------------------ssdrkav   Crystal structure of a putative dehydrogenase from  ...
1z0c:A ---yklfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsai   Crystal structure of a. Fulgidus lon proteolytic domain  ...
1z0e:A*----klfitegyevgrvnglavigesagivlpiiaevtpsmegrviatgrlqeiareavmnvsai×4 Crystal structure of a. Fulgidus lon proteolytic domain
3orf:A vlggsgalgaevvkffkskswntisidfrenpnadhsftikdsgeeeiksviekinsksikvdtf   Crystal structure of dihydropteridine reductase from  ...
3q28:A spnkelakeflenylltdegleavnkdkplgavalksyeeelakdpriaatmenaqkgeimpnip   Cyrstal structure of human alpha-synuclein (58-79) fused to  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P37840 tkqgvaeaa--gktkegvlyvgsktkegvvhgvatvaektk-----------eqvtnvgg--a-v   Alpha-synuclein OS=Homo sapiens GN=SNCA PE=1 SV=1
1xq8:A*tkqgvaeaa--gktkegvlyvgsktkegvvhgvatvaektk-----------eqvtnvgg--a-v×2 Human micelle-bound alpha-synuclein
3q26:A tkqgvaeaa--gktkegvlyvgs------------------------------------------   Cyrstal structure of human alpha-synuclein (10-42) fused to  ...
3q27:A grqtvdealkdaqtnssvlyvgsktkegvvhgvatva----------------------------   Cyrstal structure of human alpha-synuclein (32-57) fused to  ...
2m55:B -----------------------------------------------------------------   Nmr structure of the complex of an n-terminally acetylated  ...
3q25:A -----------------------------------------------------------------   Crystal structure of human alpha-synuclein (1-19) fused to  ...
1u28:A*vpparvlvf--gvgvaglqaiatakrlgavvmatdvraatk-----------eqveslgg--k-f×4 R. Rubrum transhydrogenase asymmetric complex (di.NAD+)2(dii
2oo5:A vpparvlvf--gvgvaglqaiatakrlgavvmatdvraatk-----------eqveslgg--k-f   Structure of transhydrogenase (di.H2nadh)2(diii.NADP+)1  ...
2jn5:A -----------------------------------------------------------------   Solution structure of a dodecapeptide from alpha-synuclein  ...
2r8x:F*irllildvd--gvlsdgliymgnngeelkafnvrdgygirc-----------altsdiev--a-i×2 Crystal structure of yrbi phosphatase from escherichia coli
2r8e:A irllildvd--gvlsdgliymgnngeelkafnvrdgygirc-----------altsdiev--a-i   Crystal structure of yrbi from escherichia coli in complex  ...
3i6b:A irllildvd--gvlsdgliymgnngeelkafnvrdgygirc-----------altsdiev--a-i   Crystal structure of yrbi lacking the last 8 residues, in  ...
2r8x:A*irllildvd--gvlsdgliymgnngeelkafnvrdgygirc-----------altsdiev--a-i×4 Crystal structure of yrbi phosphatase from escherichia coli
2clp:A gkqpvgrff--gntw-aemyrnrywkehhfegialv-ekal-----------qaaygasa--p-s   Crystal structure of human aflatoxin b1 aldehyde reductase  ...
1z0b:A ikkytgrdi--snmdvhiqfvg--tyegvagdsasisiatavisaiegipvdqsvamtgs--l-s   Crystal structure of a. Fulgidus lon proteolytic domain  ...
2v3b:B -----------------------------------------------------------------   Crystal structure of the electron transfer complex  ...
4jig:A litgasrgi--gratavlaaergwdvginyardaaaaelta-----------qavrdaggrac-i   Crystal structure of a putative dehydrogenase from  ...
1z0c:A ikkytgrdi--snmdvhiqfvg--tyegvegasasisiatavisaiegipvdqsvamtgs--l-s   Crystal structure of a. Fulgidus lon proteolytic domain  ...
1z0e:A*ikkytgrdi--snmdvhiqfvg--tyegvegdsasisiatavisaiegipvdqsvamtgs--l-s×4 Crystal structure of a. Fulgidus lon proteolytic domain
3orf:A vcaaggwsg--gnassdeflksvkgmidmnlysafasahig-----------akllnqgg--lfv   Crystal structure of dihydropteridine reductase from  ...
3q28:A qmsafwyav--rtavinaasgrqtvdealkdaqtnsssktk-----------eqvtnvgg--a-v   Cyrstal structure of human alpha-synuclein (58-79) fused to  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P37840 vtg----vt---avaqkt--vegagsiaaatgfvkkdqlgkn---eegapqegiledmpvd----   Alpha-synuclein OS=Homo sapiens GN=SNCA PE=1 SV=1
1xq8:A*vtg----vt---avaqkt--vegagsiaaatgfvkkdqlgkn---eegapqegiledmpvd----×2 Human micelle-bound alpha-synuclein
3q26:A -----------------------------------------------------------------   Cyrstal structure of human alpha-synuclein (10-42) fused to  ...
3q27:A -----------------------------------------------------------------   Cyrstal structure of human alpha-synuclein (32-57) fused to  ...
2m55:B -----------------------------------------------------------------   Nmr structure of the complex of an n-terminally acetylated  ...
3q25:A -----------------------------------------------------------------   Crystal structure of human alpha-synuclein (1-19) fused to  ...
1u28:A*it-----vd---deamkt--aetaggyakemg---eefrkkq---aeavlkelvktdiaittali×4 R. Rubrum transhydrogenase asymmetric complex (di.NAD+)2(dii
2oo5:A it-----vd---deamkt--aetaggyakemg---eefrkkq---aeavlkelvktdiaittali   Structure of transhydrogenase (di.H2nadh)2(diii.NADP+)1  ...
2jn5:A -----------------------------------------------------------------   Solution structure of a dodecapeptide from alpha-synuclein  ...
2r8x:F*itg----rk---a---kl--vedr---catlgithlyq-gqs---nkliafsdlleklaia----×2 Crystal structure of yrbi phosphatase from escherichia coli
2r8e:A itg----rk---a---kl--vedr---catlgithlyq-gqs---nkliafsdlleklaia----   Crystal structure of yrbi from escherichia coli in complex  ...
3i6b:A itg----rk---a---kl--vedr---catlgithlyq-gqs---nkliafsdlleklaia----   Crystal structure of yrbi lacking the last 8 residues, in  ...
2r8x:A*itg----rk---a---kl--vedr---catlgithlyq-gqs---nkliafsdlleklaia----×4 Crystal structure of yrbi phosphatase from escherichia coli
2clp:A mts----atlrwmyhhsq--lqgahgdavilgmssleqleqn---l-aaaeegplepavvd----   Crystal structure of human aflatoxin b1 aldehyde reductase  ...
1z0b:A vkgevlpvg---gvtqk---ieaaiqaglkkviipkdniddv---lldaehegkievipvs----   Crystal structure of a. Fulgidus lon proteolytic domain  ...
2v3b:B ----------------------mrkwqcvvcgfiydealglp---eegipagtrwedipadwvc-   Crystal structure of the electron transfer complex  ...
4jig:A vag----dv---aneadv--vamfdtvaaafg--rldalvnn---agivapsmpladmpvd----   Crystal structure of a putative dehydrogenase from  ...
1z0c:A vkgevlpvg---gvtqk---ieaaiqaglkkviipkdniddv---lldaehegkievipvs----   Crystal structure of a. Fulgidus lon proteolytic domain  ...
1z0e:A*vkgevlpvg---gvtqk---ieaaiqaglkkviipkdniddv---lldaehegkievipvs----×4 Crystal structure of a. Fulgidus lon proteolytic domain
3orf:A ltg----as---aalnrtsgmiaygatkaathhiikdlasengglpagstslgilpvtldt----   Crystal structure of dihydropteridine reductase from  ...
3q28:A vt---------------------------------------------------------------   Cyrstal structure of human alpha-synuclein (58-79) fused to  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P37840 pdneayempseegyqdyepea--------------------------------------------   Alpha-synuclein OS=Homo sapiens GN=SNCA PE=1 SV=1
1xq8:A*pdneayempseegyqdyepea--------------------------------------------×2 Human micelle-bound alpha-synuclein
3q26:A -----------------------------------------------------------------   Cyrstal structure of human alpha-synuclein (10-42) fused to  ...
3q27:A -----------------------------------------------------------------   Cyrstal structure of human alpha-synuclein (32-57) fused to  ...
2m55:B -----------------------------------------------------------------   Nmr structure of the complex of an n-terminally acetylated  ...
3q25:A -----------------------------------------------------------------   Crystal structure of human alpha-synuclein (1-19) fused to  ...
1u28:A*pgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsrvaadas×4 R. Rubrum transhydrogenase asymmetric complex (di.NAD+)2(dii
2oo5:A pgkpapvliteemvtkmkpgsviidlaveaggncplsepgkivvkhgvkivghtnvpsrvaadas   Structure of transhydrogenase (di.H2nadh)2(diii.NADP+)1  ...
2jn5:A -----------------------------------------------------------------   Solution structure of a dodecapeptide from alpha-synuclein  ...
2r8x:F*penvayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgk--×2 Crystal structure of yrbi phosphatase from escherichia coli
2r8e:A penvayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl-   Crystal structure of yrbi from escherichia coli in complex  ...
3i6b:A penvayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgk--   Crystal structure of yrbi lacking the last 8 residues, in  ...
2r8x:A*penvayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkld×4 Crystal structure of yrbi phosphatase from escherichia coli
2clp:A afnqawhlvahecpnyfr-----------------------------------------------   Crystal structure of human aflatoxin b1 aldehyde reductase  ...
1z0b:A rinevlehvledgkkknrlmskfkelelaav----------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
2v3b:B pdcgvgkidfemie---------------------------------------------------   Crystal structure of the electron transfer complex  ...
4jig:A rlrrmfdtnvlgaylcareaarrlstdrggrggaivnvssiasrlgspneyvdyagskgavdslt   Crystal structure of a putative dehydrogenase from  ...
1z0c:A rinevlehvledgkkknrlmskfkelel-------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
1z0e:A*rinevlehvledgkkknrlmskfk-----------------------------------------×4 Crystal structure of a. Fulgidus lon proteolytic domain
3orf:A ptnrkym--sdanfddwtplsevaeklfewstnsdsrptngslvkfetkskvttwtnl-------   Crystal structure of dihydropteridine reductase from  ...
3q28:A -----------------------------------------------------------------   Cyrstal structure of human alpha-synuclein (58-79) fused to  ...

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P37840 -----------------------------------------------------------------   Alpha-synuclein OS=Homo sapiens GN=SNCA PE=1 SV=1
1xq8:A*-----------------------------------------------------------------×2 Human micelle-bound alpha-synuclein
3q26:A -----------------------------------------------------------------   Cyrstal structure of human alpha-synuclein (10-42) fused to  ...
3q27:A -----------------------------------------------------------------   Cyrstal structure of human alpha-synuclein (32-57) fused to  ...
2m55:B -----------------------------------------------------------------   Nmr structure of the complex of an n-terminally acetylated  ...
3q25:A -----------------------------------------------------------------   Crystal structure of human alpha-synuclein (1-19) fused to  ...
1u28:A*plfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhpa-------------------×4 R. Rubrum transhydrogenase asymmetric complex (di.NAD+)2(dii
2oo5:A plfaknllnfltphvdkdtktlvmkledetvsgtcvtrdgaivhpalt-----------------   Structure of transhydrogenase (di.H2nadh)2(diii.NADP+)1  ...
2jn5:A -----------------------------------------------------------------   Solution structure of a dodecapeptide from alpha-synuclein  ...
2r8x:F*-----------------------------------------------------------------×2 Crystal structure of yrbi phosphatase from escherichia coli
2r8e:A -----------------------------------------------------------------   Crystal structure of yrbi from escherichia coli in complex  ...
3i6b:A -----------------------------------------------------------------   Crystal structure of yrbi lacking the last 8 residues, in  ...
2r8x:A*eakgqsi----------------------------------------------------------×4 Crystal structure of yrbi phosphatase from escherichia coli
2clp:A -----------------------------------------------------------------   Crystal structure of human aflatoxin b1 aldehyde reductase  ...
1z0b:A -----------------------------------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
2v3b:B -----------------------------------------------------------------   Crystal structure of the electron transfer complex  ...
4jig:A iglakelgphgvrvnavrpglietrlgaqtplgrageaqevaeaivwllgdtasyttgalldvgg   Crystal structure of a putative dehydrogenase from  ...
1z0c:A -----------------------------------------------------------------   Crystal structure of a. Fulgidus lon proteolytic domain  ...
1z0e:A*-----------------------------------------------------------------×4 Crystal structure of a. Fulgidus lon proteolytic domain
3orf:A -----------------------------------------------------------------   Crystal structure of dihydropteridine reductase from  ...
3q28:A -----------------------------------------------------------------   Cyrstal structure of human alpha-synuclein (58-79) fused to  ...

         
         
       12                                                                  Protein name
       --                                                                  ------------
P37840 --                                                                  Alpha-synuclein OS=Homo sapiens GN=SNCA PE=1 SV=1
1xq8:A*--                                                               ×2 Human micelle-bound alpha-synuclein
3q26:A --                                                                  Cyrstal structure of human alpha-synuclein (10-42) fused to  ...
3q27:A --                                                                  Cyrstal structure of human alpha-synuclein (32-57) fused to  ...
2m55:B --                                                                  Nmr structure of the complex of an n-terminally acetylated  ...
3q25:A --                                                                  Crystal structure of human alpha-synuclein (1-19) fused to  ...
1u28:A*--                                                               ×4 R. Rubrum transhydrogenase asymmetric complex (di.NAD+)2(dii
2oo5:A --                                                                  Structure of transhydrogenase (di.H2nadh)2(diii.NADP+)1  ...
2jn5:A --                                                                  Solution structure of a dodecapeptide from alpha-synuclein  ...
2r8x:F*--                                                               ×2 Crystal structure of yrbi phosphatase from escherichia coli
2r8e:A --                                                                  Crystal structure of yrbi from escherichia coli in complex  ...
3i6b:A --                                                                  Crystal structure of yrbi lacking the last 8 residues, in  ...
2r8x:A*--                                                               ×4 Crystal structure of yrbi phosphatase from escherichia coli
2clp:A --                                                                  Crystal structure of human aflatoxin b1 aldehyde reductase  ...
1z0b:A --                                                                  Crystal structure of a. Fulgidus lon proteolytic domain  ...
2v3b:B --                                                                  Crystal structure of the electron transfer complex  ...
4jig:A gr                                                                  Crystal structure of a putative dehydrogenase from  ...
1z0c:A --                                                                  Crystal structure of a. Fulgidus lon proteolytic domain  ...
1z0e:A*--                                                               ×4 Crystal structure of a. Fulgidus lon proteolytic domain
3orf:A --                                                                  Crystal structure of dihydropteridine reductase from  ...
3q28:A --                                                                  Cyrstal structure of human alpha-synuclein (58-79) fused to  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P37840. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 140 - - P37840 Alpha-synuclein OS=Homo sapiens GN=SNCA PE=1 SV=1
2. 879 100.0% 140 140 1067.8 1.7e-52 1xq8:A * Human micelle-bound alpha-synuclein
3. " " " " " "  = 2kkw:A *
Slas-micelle bound alpha-synuclein
4. 151 70.3% 37 395 186.0 0.0022 3q26:A Cyrstal structure of human alpha-synuclein (10-42) fused to binding protein (mbp)
5. 139 53.7% 54 390 171.7 0.014 3q27:A Cyrstal structure of human alpha-synuclein (32-57) fused to binding protein (mbp)
6. 115 100.0% 19 19 164.0 0.037 2m55:B Nmr structure of the complex of an n-terminally acetylated a synuclein peptide with calmodulin
7. 115 100.0% 19 388 142.9 0.55 3q25:A Crystal structure of human alpha-synuclein (1-19) fused to m binding protein (mbp)
8. 106 28.0% 107 378 132.3 2.2 1u28:A * R. Rubrum transhydrogenase asymmetric complex (di.NAD+)2(dii
9. " " " " " "  = 1u2d:A *
Structre of transhydrogenaes (di.Nadh)2(diii.NADPH)1 asymmet complex
10. " " " " " "  = 1u2g:A *
Transhydrogenase (di.Adpr)2(diii.NADPH)1 asymmetric complex
11. " " " " " "  = 2oor:A *
Structure of transhydrogenase (di.NAD+)2(diii.H2nadph)1 asym complex
12. 106 28.0% 107 380 132.2 2.2 2oo5:A Structure of transhydrogenase (di.H2nadh)2(diii.NADP+)1 asymmetric complex
13. 76 100.0% 12 12 120.8 9.4 2jn5:A Solution structure of a dodecapeptide from alpha-synuclein b synphilin-1
14. 88 24.3% 111 172 116.3 17 2r8x:F * Crystal structure of yrbi phosphatase from escherichia coli
15. " " " " " "  = 2r8y:F *
Crystal structure of yrbi phosphatase from escherichia coli in a complex with ca
16. 88 24.3% 111 173 116.2 17 2r8e:A Crystal structure of yrbi from escherichia coli in complex with mg
17. 88 24.3% 111 173 116.2 17 3i6b:A Crystal structure of yrbi lacking the last 8 residues, in co kdo and inorganic phosphate
18. 88 24.3% 111 181 115.9 18 2r8x:A * Crystal structure of yrbi phosphatase from escherichia coli
19. " " " " " "  = 2r8y:A *
Crystal structure of yrbi phosphatase from escherichia coli in a complex with ca
20. " " " " " "  = 2r8z:A *
Crystal structure of yrbi phosphatase from escherichia coli with a phosphate and a calcium ion
21. " " " " " "  = 3hyc:A *
Crystal structure of e. Coli phosphatase yrbi, with mg, tetr form
22. 91 28.6% 112 323 115.4 19 2clp:A Crystal structure of human aflatoxin b1 aldehyde reductase member 3
23. 89 25.5% 137 203 113.9 23 1z0b:A Crystal structure of a. Fulgidus lon proteolytic domain e506a mutant
24. 79 43.8% 32 53 113.9 23 2v3b:B Crystal structure of the electron transfer complex rubredoxin - rubredoxin reductase from pseudomonas aeruginosa.
25. 87 34.8% 69 237 112.8 26 4jig:A Crystal structure of a putative dehydrogenase from burkholde cenocepacia
26. 87 25.5% 137 200 111.6 31 1z0c:A Crystal structure of a. Fulgidus lon proteolytic domain d508a mutant
27. 86 25.5% 137 195 110.6 35 1z0e:A * Crystal structure of a. Fulgidus lon proteolytic domain
28. " " " " " "  = 1z0g:A *
Crystal structure of a. Fulgidus lon proteolytic domain
29. " " " " " "  = 1z0t:A *
Crystal structure of a. Fulgidus lon proteolytic domain
30. " " " " " "  = 1z0v:A *
Crystal structure of a. Fulgidus lon proteolytic domain
31. 85 30.1% 83 230 110.6 35 3orf:A Crystal structure of dihydropteridine reductase from dictyos discoideum
32. 88 100.0% 15 386 110.5 35 3q28:A Cyrstal structure of human alpha-synuclein (58-79) fused to binding protein (mbp)

Number of sequences: 32

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 86 25.5% 137 203 110.3 36 1z0w:A Crystal structure of a. Fulgidus lon proteolytic domain at 1.2a resolution
2. 87 29.3% 123 346 110.1 37 3l0z:A Crystal structure of a putative nicotinate-nucleotide- dimethylbenzimidazole phosphoribosyltransferase from methanocaldococcus jannaschii dsm 2661
3. 85 31.3% 99 249 110.0 37 3kzv:A The crystal structure of a cytoplasmic protein with unknown from saccharomyces cerevisiae
4. 87 25.2% 107 382 109.4 41 1f8g:A The x-ray structure of nicotinamide nucleotide transhydrogenase from rhodospirillum rubrum complexed with NAD+
5. 88 25.5% 137 496 108.7 44 2c7f:A The structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,5-alpha-l- arabinotriose.
6. 88 25.5% 137 501 108.7 45 2c8n:A The structure of a family 51 arabinofuranosidase, araf51, from clostridium thermocellum in complex with 1,3-linked arabinoside of xylobiose.
7. 85 33.8% 68 311 108.5 46 1z4d:A * Rada recombinase in complex with amp-pnp and high concentration of k+
8. " " " " " "  = 2fpm:A *
Rada recombinase in complex with amp-pnp and high concentration of k+
9. " " " " " "  = 2i1q:A *
Rada recombinase in complex with calcium
10. 84 25.2% 107 281 108.0 49 1s2n:A * Crystal strucure of a cold adapted subtilisin-like serine pr
11. " " " " " "  = 1sh7:A *
Crystal structure of a cold adapted subtilisin-like serine p

Number of sequences: 11

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer