spacer
spacer

SAS results for UniProt accession no. Q72I22

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. Q72I22 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q72I22 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 17 unique sequences (including 7 consensus sequences) giving 261 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q72I22 -----------------------------------------------------------------    50S ribosomal protein L30 OS=Thermus thermophilus (strain  ...
1bxy:A*-----------------------------------------------------------------×65 Crystal structure of ribosomal protein l30 from thermus  ...
2xqe:3*-----------------------------------------------------------------×32 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
2hgj:2*-----------------------------------------------------------------×33 Crystal structure of the 70s thermus thermophilus ribosome  ...
4dhc:3 -----------------------------------------------------------------    Crystal structure of yaej bound to the 70s ribosome
1twv:O -----------------------------------------------------------------    Model structure of the t. Thermophilus 70s ribosome,50s  ...
1kc9:X*-----------------------------------------------------------------×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y -----------------------------------------------------------------    Atomic model of the immature 50s subunit from bacillus  ...
1p85:X*-----------------------------------------------------------------×4  Real space refined coordinates of the 50s subunit fitted  ...
1vs6:Y*-----------------------------------------------------------------×90 Crystal structure of the bacterial ribosome from  ...
4ce4:3 -----------------------------------------------------------------    39s large subunit of the porcine mitochondrial ribosome
2lky:A -----------------------------------------------------------------    Solution structure of msmeg_1053, the second duf3349  ...
3j21:Y*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2vro:A hmtellknhvagqwiagtgagitltdpvtgvalvrvssegldlarafsfaredggaalraltyaq    Crystal structure of aldehyde dehydrogenase from  ...
2y52:A hmtellknhvagqwiagtgagitltdpvtgvalvrvssegldlarafsfaredggaalraltyaq    Crystal structure of e496a mutant of the box pathway  ...
2y5d:A hmtellknhvagqwiagtgagitltdpvtgvalvrvssegldlarafsfaredggaalraltyaq    Crystal structure of c296a mutant of the box pathway  ...
2y51:A hmtellknhvagqwiagtgagitltdpvtgvalvrvssegldlarafsfaredggaalraltyaq    Crystal structure of e167a mutant of the box pathway  ...
2y53:A hmtellknhvagqwiagtgagitltdpvtgvalvrvssegldlarafsfaredggaalraltyaq    Crystal structure of e257q mutant of the box pathway  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q72I22 -----------------------------------------------------------------    50S ribosomal protein L30 OS=Thermus thermophilus (strain  ...
1bxy:A*-----------------------------------------------------------------×65 Crystal structure of ribosomal protein l30 from thermus  ...
2xqe:3*-----------------------------------------------------------------×32 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
2hgj:2*-----------------------------------------------------------------×33 Crystal structure of the 70s thermus thermophilus ribosome  ...
4dhc:3 -----------------------------------------------------------------    Crystal structure of yaej bound to the 70s ribosome
1twv:O -----------------------------------------------------------------    Model structure of the t. Thermophilus 70s ribosome,50s  ...
1kc9:X*-----------------------------------------------------------------×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y -----------------------------------------------------------------    Atomic model of the immature 50s subunit from bacillus  ...
1p85:X*-----------------------------------------------------------------×4  Real space refined coordinates of the 50s subunit fitted  ...
1vs6:Y*-----------------------------------------------------------------×90 Crystal structure of the bacterial ribosome from  ...
4ce4:3 -----------------------------------------------------------------    39s large subunit of the porcine mitochondrial ribosome
2lky:A -----------------------------------------------------------------    Solution structure of msmeg_1053, the second duf3349  ...
3j21:Y*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2vro:A raarladivkllqakrgdyyaiatansgttrndsavdidggiftlsyyaklgaslgevhalrdgs    Crystal structure of aldehyde dehydrogenase from  ...
2y52:A raarladivkllqakrgdyyaiatansgttrndsavdidggiftlsyyaklgaslgevhalrdgs    Crystal structure of e496a mutant of the box pathway  ...
2y5d:A raarladivkllqakrgdyyaiatansgttrndsavdidggiftlsyyaklgaslgevhalrdgs    Crystal structure of c296a mutant of the box pathway  ...
2y51:A raarladivkllqakrgdyyaiatansgttrndsavdidggiftlsyyaklgaslgevhalrdgs    Crystal structure of e167a mutant of the box pathway  ...
2y53:A raarladivkllqakrgdyyaiatansgttrndsavdidggiftlsyyaklgaslgevhalrdgs    Crystal structure of e257q mutant of the box pathway  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q72I22 -----------------------------------------------------------------    50S ribosomal protein L30 OS=Thermus thermophilus (strain  ...
1bxy:A*-----------------------------------------------------------------×65 Crystal structure of ribosomal protein l30 from thermus  ...
2xqe:3*-----------------------------------------------------------------×32 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
2hgj:2*-----------------------------------------------------------------×33 Crystal structure of the 70s thermus thermophilus ribosome  ...
4dhc:3 -----------------------------------------------------------------    Crystal structure of yaej bound to the 70s ribosome
1twv:O -----------------------------------------------------------------    Model structure of the t. Thermophilus 70s ribosome,50s  ...
1kc9:X*-----------------------------------------------------------------×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y -----------------------------------------------------------------    Atomic model of the immature 50s subunit from bacillus  ...
1p85:X*-----------------------------------------------------------------×4  Real space refined coordinates of the 50s subunit fitted  ...
1vs6:Y*-----------------------------------------------------------------×90 Crystal structure of the bacterial ribosome from  ...
4ce4:3 -----------------------------------------------------------------    39s large subunit of the porcine mitochondrial ribosome
2lky:A -----------------------------------------------------------------    Solution structure of msmeg_1053, the second duf3349  ...
3j21:Y*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2vro:A aeslskdrsfsaqhvlsptrgvalfinafnfpswglwekaapallsgvpvivkpatatawltqrm    Crystal structure of aldehyde dehydrogenase from  ...
2y52:A aeslskdrsfsaqhvlsptrgvalfinafnfpswglwekaapallsgvpvivkpatatawltqrm    Crystal structure of e496a mutant of the box pathway  ...
2y5d:A aeslskdrsfsaqhvlsptrgvalfinafnfpswglwekaapallsgvpvivkpatatawltqrm    Crystal structure of c296a mutant of the box pathway  ...
2y51:A aeslskdrsfsaqhvlsptrgvalfinafnfpswglwakaapallsgvpvivkpatatawltqrm    Crystal structure of e167a mutant of the box pathway  ...
2y53:A aeslskdrsfsaqhvlsptrgvalfinafnfpswglwekaapallsgvpvivkpatatawltqrm    Crystal structure of e257q mutant of the box pathway  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q72I22 -----------------------------------------------------------------    50S ribosomal protein L30 OS=Thermus thermophilus (strain  ...
1bxy:A*-----------------------------------------------------------------×65 Crystal structure of ribosomal protein l30 from thermus  ...
2xqe:3*-----------------------------------------------------------------×32 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
2hgj:2*-----------------------------------------------------------------×33 Crystal structure of the 70s thermus thermophilus ribosome  ...
4dhc:3 -----------------------------------------------------------------    Crystal structure of yaej bound to the 70s ribosome
1twv:O -----------------------------------------------------------------    Model structure of the t. Thermophilus 70s ribosome,50s  ...
1kc9:X*-----------------------------------------------------------------×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y -----------------------------------------------------------------    Atomic model of the immature 50s subunit from bacillus  ...
1p85:X*-----------------------------------------------------------------×4  Real space refined coordinates of the 50s subunit fitted  ...
1vs6:Y*-----------------------------------------------------------------×90 Crystal structure of the bacterial ribosome from  ...
4ce4:3 -----------------------------------------------------------------    39s large subunit of the porcine mitochondrial ribosome
2lky:A -----------------------------------------------------------------    Solution structure of msmeg_1053, the second duf3349  ...
3j21:Y*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2vro:A vadvvdagilppgalsiicgssaglldqirsfdvvsftgsadtaatlrahpafvqrgarlnvead    Crystal structure of aldehyde dehydrogenase from  ...
2y52:A vadvvdagilppgalsiicgssaglldqirsfdvvsftgsadtaatlrahpafvqrgarlnvead    Crystal structure of e496a mutant of the box pathway  ...
2y5d:A vadvvdagilppgalsiicgssaglldqirsfdvvsftgsadtaatlrahpafvqrgarlnvead    Crystal structure of c296a mutant of the box pathway  ...
2y51:A vadvvdagilppgalsiicgssaglldqirsfdvvsftgsadtaatlrahpafvqrgarlnvead    Crystal structure of e167a mutant of the box pathway  ...
2y53:A vadvvdagilppgalsiicgssaglldqirsfdvvsftgsadtaatlrahpafvqrgarlnvqad    Crystal structure of e257q mutant of the box pathway  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q72I22 -----------------------------------------------------mprlkvklvksp    50S ribosomal protein L30 OS=Thermus thermophilus (strain  ...
1bxy:A*-----------------------------------------------------mprlkvklvksp×65 Crystal structure of ribosomal protein l30 from thermus  ...
2xqe:3*-----------------------------------------------------mprlkvklvksp×32 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
2hgj:2*------------------------------------------------------prlkvklvksp×33 Crystal structure of the 70s thermus thermophilus ribosome  ...
4dhc:3 ------------------------------------------------------prlkvklvksp    Crystal structure of yaej bound to the 70s ribosome
1twv:O ----------------------------------------------------------vklvksp    Model structure of the t. Thermophilus 70s ribosome,50s  ...
1kc9:X*--------------------------------------------------------mkiklvrsv×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y -------------------------------------------------------kleitlkrsv    Atomic model of the immature 50s subunit from bacillus  ...
1p85:X*-------------------------------------------------------tikitqtrsa×4  Real space refined coordinates of the 50s subunit fitted  ...
1vs6:Y*-----------------------------------------------------aktikitqtrsa×90 Crystal structure of the bacterial ribosome from  ...
4ce4:3 ------------------------------------------------------klhivtrikst    39s large subunit of the porcine mitochondrial ribosome
2lky:A -------------------------------------------gpgsmvnaflakiaawlnagyp    Solution structure of msmeg_1053, the second duf3349  ...
3j21:Y*-----------------------------------------------------maklavirirgr×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2vro:A slnsailcadatpdtpafdlfikevvremtvksgqkctairrafvpeaalepvlealkaklakit    Crystal structure of aldehyde dehydrogenase from  ...
2y52:A slnsailcadatpdtpafdlfikevvremtvksgqkctairrafvpeaalepvlealkaklakit    Crystal structure of e496a mutant of the box pathway  ...
2y5d:A slnsailcadatpdtpafdlfikevvremtvksgqkatairrafvpeaalepvlealkaklakit    Crystal structure of c296a mutant of the box pathway  ...
2y51:A slnsailcadatpdtpafdlfikevvremtvksgqkctairrafvpeaalepvlealkaklakit    Crystal structure of e167a mutant of the box pathway  ...
2y53:A slnsailcadatpdtpafdlfikevvremtvksgqkctairrafvpeaalepvlealkaklakit    Crystal structure of e257q mutant of the box pathway  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q72I22 igypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve-----------------    50S ribosomal protein L30 OS=Thermus thermophilus (strain  ...
1bxy:A*igypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve-----------------×65 Crystal structure of ribosomal protein l30 from thermus  ...
2xqe:3*igypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevv------------------×32 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
2hgj:2*igypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve-----------------×33 Crystal structure of the 70s thermus thermophilus ribosome  ...
4dhc:3 igypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevv------------------    Crystal structure of yaej bound to the 70s ribosome
1twv:O igypkdqkaalkalglrrlqqervledtpairgnvekvahlvrv---------------------    Model structure of the t. Thermophilus 70s ribosome,50s  ...
1kc9:X*igrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe-------------------×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y igrpedqrvtvrtlglkktnqtvvhednaairgminkvshlvsvke-------------------    Atomic model of the immature 50s subunit from bacillus  ...
1p85:X*igrlpkhkatllglglrrightveredtpairgminavsfmvkvee-------------------×4  Real space refined coordinates of the 50s subunit fitted  ...
1vs6:Y*igrlpkhkatllglglrrightveredtpairgminavsfmvkvee-------------------×90 Crystal structure of the bacterial ribosome from  ...
4ce4:3 krrpywekdiikmlglekahtpqvhknipsvnaklkvvkhlirikplk-----------------    39s large subunit of the porcine mitochondrial ribosome
2lky:A egvpgpdrvpllalltrrltndei----kaiaedlekrahfdhidigvlitqmtdempreedier    Solution structure of msmeg_1053, the second duf3349  ...
3j21:Y*vnvkrpvrdtlamlrlhrvnhcvivddtpsylgmlqkakdyitwgeinaetlaklirkrgrlign×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2vro:A vgnprndavrmgsl-vsreqyenvlagiaalreeavlaydssavplidadaniaacvaphlfvvn    Crystal structure of aldehyde dehydrogenase from  ...
2y52:A vgnprndavrmgsl-vsreqyenvlagiaalreeavlaydssavplidadaniaacvaphlfvvn    Crystal structure of e496a mutant of the box pathway  ...
2y5d:A vgnprndavrmgsl-vsreqyenvlagiaalreeavlaydssavplidadaniaacvaphlfvvn    Crystal structure of c296a mutant of the box pathway  ...
2y51:A vgnprndavrmgsl-vsreqyenvlagiaalreeavlaydssavplidadaniaacvaphlfvvn    Crystal structure of e167a mutant of the box pathway  ...
2y53:A vgnprndavrmgsl-vsreqyenvlagiaalreeavlaydssavplidadaniaacvaphlfvvn    Crystal structure of e257q mutant of the box pathway  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q72I22 -----------------------------------------------------------------    50S ribosomal protein L30 OS=Thermus thermophilus (strain  ...
1bxy:A*-----------------------------------------------------------------×65 Crystal structure of ribosomal protein l30 from thermus  ...
2xqe:3*-----------------------------------------------------------------×32 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
2hgj:2*-----------------------------------------------------------------×33 Crystal structure of the 70s thermus thermophilus ribosome  ...
4dhc:3 -----------------------------------------------------------------    Crystal structure of yaej bound to the 70s ribosome
1twv:O -----------------------------------------------------------------    Model structure of the t. Thermophilus 70s ribosome,50s  ...
1kc9:X*-----------------------------------------------------------------×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y -----------------------------------------------------------------    Atomic model of the immature 50s subunit from bacillus  ...
1p85:X*-----------------------------------------------------------------×4  Real space refined coordinates of the 50s subunit fitted  ...
1vs6:Y*-----------------------------------------------------------------×90 Crystal structure of the bacterial ribosome from  ...
4ce4:3 -----------------------------------------------------------------    39s large subunit of the porcine mitochondrial ribosome
2lky:A vrrhlalqgwplddprdgeepdgesggpr------------------------------------    Solution structure of msmeg_1053, the second duf3349  ...
3j21:Y*kpvtdeyvkeklgmtieefaqkvvngemslkdlpnlkpvfrlhpprggfrgskkrsfkeggalgy×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2vro:A dpdnatllhdvevfgpvasvapyrvttdtlpeahavalarrgqgslvasiysnddahlgrlalel    Crystal structure of aldehyde dehydrogenase from  ...
2y52:A dpdnatllhdvevfgpvasvapyrvttdtlpeahavalarrgqgslvasiysnddahlgrlalel    Crystal structure of e496a mutant of the box pathway  ...
2y5d:A dpdnatllhdvevfgpvasvapyrvttdtlpeahavalarrgqgslvasiysnddahlgrlalel    Crystal structure of c296a mutant of the box pathway  ...
2y51:A dpdnatllhdvevfgpvasvapyrvttdtnalpeahavalarrgqgslvasiysnddahlgrlal    Crystal structure of e167a mutant of the box pathway  ...
2y53:A dpdnatllhdvevfgpvasvapyrvttdlpeahavalarrgqgslvasiysnddahlgrlalela    Crystal structure of e257q mutant of the box pathway  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q72I22 -----------------------------------------------------------------    50S ribosomal protein L30 OS=Thermus thermophilus (strain  ...
1bxy:A*-----------------------------------------------------------------×65 Crystal structure of ribosomal protein l30 from thermus  ...
2xqe:3*-----------------------------------------------------------------×32 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
2hgj:2*-----------------------------------------------------------------×33 Crystal structure of the 70s thermus thermophilus ribosome  ...
4dhc:3 -----------------------------------------------------------------    Crystal structure of yaej bound to the 70s ribosome
1twv:O -----------------------------------------------------------------    Model structure of the t. Thermophilus 70s ribosome,50s  ...
1kc9:X*-----------------------------------------------------------------×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y -----------------------------------------------------------------    Atomic model of the immature 50s subunit from bacillus  ...
1p85:X*-----------------------------------------------------------------×4  Real space refined coordinates of the 50s subunit fitted  ...
1vs6:Y*-----------------------------------------------------------------×90 Crystal structure of the bacterial ribosome from  ...
4ce4:3 -----------------------------------------------------------------    39s large subunit of the porcine mitochondrial ribosome
2lky:A -----------------------------------------------------------------    Solution structure of msmeg_1053, the second duf3349  ...
3j21:Y*rgekinelierml----------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2vro:A adshgrvhaispsvqhsqtghgnvmpmslhggpgragggeelgglralafyhrrsaiqaasaaig    Crystal structure of aldehyde dehydrogenase from  ...
2y52:A adshgrvhaispsvqhsqtghgnvmpmslhggpgragggealgglralafyhrrsaiqaasaaig    Crystal structure of e496a mutant of the box pathway  ...
2y5d:A adshgrvhaispsvqhsqtghgnvmpmslhggpgragggeelgglralafyhrrsaiqaasaaig    Crystal structure of c296a mutant of the box pathway  ...
2y51:A eladshgrvhaispsvqhsqtghgnvmpmslhggpgragggeelgglralafyhrrsaiqaasaa    Crystal structure of e167a mutant of the box pathway  ...
2y53:A dshgrvhaispsvqhsqtghgnvmpmslhggpgragggeelgglralafyhrrsaiqaasaaigt    Crystal structure of e257q mutant of the box pathway  ...

                5
                3
       1234567890                                                           Protein name
       ---------+                                                           ------------
Q72I22 ----------                                                           50S ribosomal protein L30 OS=Thermus thermophilus (strain  ...
1bxy:A*----------                                                       ×65 Crystal structure of ribosomal protein l30 from thermus  ...
2xqe:3*----------                                                       ×32 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
2hgj:2*----------                                                       ×33 Crystal structure of the 70s thermus thermophilus ribosome  ...
4dhc:3 ----------                                                           Crystal structure of yaej bound to the 70s ribosome
1twv:O ----------                                                           Model structure of the t. Thermophilus 70s ribosome,50s  ...
1kc9:X*----------                                                       ×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y ----------                                                           Atomic model of the immature 50s subunit from bacillus  ...
1p85:X*----------                                                       ×4  Real space refined coordinates of the 50s subunit fitted  ...
1vs6:Y*----------                                                       ×90 Crystal structure of the bacterial ribosome from  ...
4ce4:3 ----------                                                           39s large subunit of the porcine mitochondrial ribosome
2lky:A ----------                                                           Solution structure of msmeg_1053, the second duf3349  ...
3j21:Y*----------                                                       ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2vro:A tl--------                                                           Crystal structure of aldehyde dehydrogenase from  ...
2y52:A ----------                                                           Crystal structure of e496a mutant of the box pathway  ...
2y5d:A tl--------                                                           Crystal structure of c296a mutant of the box pathway  ...
2y51:A igtltqathw                                                           Crystal structure of e167a mutant of the box pathway  ...
2y53:A ltqathwpaa                                                           Crystal structure of e257q mutant of the box pathway  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q72I22. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 60 - - Q72I22 50S ribosomal protein L30 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpmD PE=1 SV=1
2. 377 100.0% 60 60 536.9 6.1e-23 1bxy:A * Crystal structure of ribosomal protein l30 from thermus thermophilus at 1.9 a resolution: conformational flexibility of the molecule.
3. " " " " " "  = 1giy:X *
Crystal structure of the ribosome at 5.5 a resolution. This file, 1giy, contains the 50s ribosome subunit. The 30s ribosome subunit, three tRNA, and mRNA molecules are in the file 1gix
4. " " " " " "  = 1ml5:x *
Structure of the e. Coli ribosomal termination complex with factor 2
5. " " " " " "  = 1vs9:X *
Crystal structure of a 70s ribosome-tRNA complex reveals functional interactions and rearrangements. This file, 1vs9, contains the 50s ribosome subunit. 30s ribosome subunit is in the file 2i1c
6. " " " " " "  = 1vsa:X *
Crystal structure of a 70s ribosome-tRNA complex reveals fun interactions and rearrangements. This file, 1vsa, contains ribosome subunit. 30s ribosome subunit is in the file 2ow8
7. " " " " " "  = 1vsp:X *
Interactions and dynamics of the shine-dalgarno helix in the ribosome. This file, 1vsp, contains the 50s ribosome subuni ribosome subunit is in the file 2qnh
8. " " " " " "  = 1yl3:X *
Crystal structure of 70s ribosome with thrs operator and trn subunit. The coordinates for the small subunit are in the p 1yl4.
9. " " " " " "  = 2b66:3 *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400
10. " " " " " "  = 2b9n:3 *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400.
11. " " " " " "  = 2b9p:3 *
50s ribosomal subunit from a crystal structure of the riboso complex with trnas and mRNA with a stop codon in the a-site file contains the 50s subunit from a crystal structure of t ribosome in complex with trnas and mRNA with a stop codon i site and is described in remark 400.
12. " " " " " "  = 2j01:3 *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 2 of 4). This file contains the 50s subunit from molecule i.
13. " " " " " "  = 2j03:3 *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50s subunit from molecule ii.
14. " " " " " "  = 2jl6:3 *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 2 of 4). This file contains the 50s subunit.
15. " " " " " "  = 2jl8:3 *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 4 of 4). This file contains the 50s subunit.
16. " " " " " "  = 2v47:3 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 2 of 4). This file contains the 50s subunit for molecule 1.
17. " " " " " "  = 2v49:3 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 4 of 4). This file contains the 50s subunit of molecule 2.
18. " " " " " "  = 2wdi:3 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule i.
19. " " " " " "  = 2wdj:3 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule ii.
20. " " " " " "  = 2wdl:3 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule i.
21. " " " " " "  = 2wdn:3 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule ii.
22. " " " " " "  = 2wh2:3 *
Insights into translational termination from the structure of rf2 bound to the ribosome
23. " " " " " "  = 2wh4:3 *
Insights into translational termination from the structure of rf2 bound to the ribosome
24. " " " " " "  = 2wrj:3 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state (part 2 of 4).
25. " " " " " "  = 2wrl:3 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state. (Part 4 of 4).
26. " " " " " "  = 2wro:3 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 2 of 4).
27. " " " " " "  = 2wrr:3 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 4 of 4).
28. " " " " " "  = 2x9s:3 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
29. " " " " " "  = 2x9u:3 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
30. " " " " " "  = 2xg0:3 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 2 of 4)
31. " " " " " "  = 2xg2:3 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 4 of 4)
32. " " " " " "  = 3fin:3 *
T. Thermophilus 70s ribosome in complex with mRNA, trnas and tu.Gdp.Kirromycin ternary complex, fitted to a 6.4 a cryo-e this file contains the 50s subunit.
33. " " " " " "  = 3huz:3 *
Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule ii.
34. " " " " " "  = 3kni:3 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule i
35. " " " " " "  = 3knk:3 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule ii.
36. " " " " " "  = 3knm:3 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule i.
37. " " " " " "  = 3kno:3 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule ii
38. " " " " " "  = 3oh5:3 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
39. " " " " " "  = 3oh7:3 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
40. " " " " " "  = 3ohj:3 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
41. " " " " " "  = 3ohk:3 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
42. " " " " " "  = 3ohz:3 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
43. " " " " " "  = 3oi1:3 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
44. " " " " " "  = 3oi3:3 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
45. " " " " " "  = 3oi5:3 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
46. " " " " " "  = 3v6w:3 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit
47. " " " " " "  = 3v6x:3 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit
48. " " " " " "  = 3zn9:3 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
49. " " " " " "  = 3zne:3 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
50. " " " " " "  = 3zvp:3 *
Crystal structure of the hybrid state of ribosome in complex the guanosine triphosphatase release factor 3
51. " " " " " "  = 4abs:3 *
Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin w 70s ribosome
52. " " " " " "  = 4b8g:3 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
53. " " " " " "  = 4b8i:3 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
54. " " " " " "  = 4btd:3 *
Thermus thermophilus ribosome
55. " " " " " "  = 4byc:3 *
Structure of thermus thermophilus 50s ribosome
56. " " " " " "  = 4bye:3 *
Structure of thermus thermophilus 50s ribosome
57. " " " " " "  = 4ejb:3 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit.
58. " " " " " "  = 4ejc:3 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit.
59. " " " " " "  = 4kbu:3 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit a. The full asymmetric unit contains PDB entries 4kbt (30s subunit a), 4kbv (30s subuni 4kbw (50s subunit b).
60. " " " " " "  = 4kbw:3 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit b. The full asymmetric unit contains PDB entries 4kbv (30s subunit b), 4kbt (30s subuni 4kbu (50s subunit a).
61. " " " " " "  = 4kcz:3 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state.T contains the 50s ribosomal subunit a. The 30s subunit a can in 4kcy. Molecule b in the same asymmetric unit is deposite (30s) and 4kd2 (50s).G1 50s ribosomal subunit i
62. " " " " " "  = 4kd2:3 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains the 50s ribosomal subunit b. The 30s subunit b can in 4kd0. Molecule a in the same asymmetric unit is deposite (30s) and 4kcz (50s).
63. " " " " " "  = 4kd9:3 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kd8. Molecule b in the same asymmetric uni deposited as 4kda (30s) and 4kdb (50s).
64. " " " " " "  = 4kdb:3 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kda. Molecule a in the same asymmetric uni deposited as 4kd8 (30s) and 4kd9 (50s).
65. " " " " " "  = 4kdh:3 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kdg. Molecule b in the same asymmetric uni deposited as 4kdj (30s) and 4kdk (50s).
66. " " " " " "  = 4kdk:3 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kdj. Molecule a in the same asymmetric uni deposited as 4kdg (30s) and 4kdh (50s).
67. 371 100.0% 59 59 528.7 1.8e-22 2xqe:3 * The structure of ef-tu and aminoacyl-tRNA bound to the 70s ribosome with a gtp analog
68. " " " " " "  = 2xtg:3 *
tRNA tranlocation on the 70s ribosome: the pre- translocational translocation intermediate ti(pre)
69. " " " " " "  = 2xux:3 *
tRNA translocation on the 70s ribosome: the post- translocational translocation intermediate ti(post)
70. " " " " " "  = 2y0v:3 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
71. " " " " " "  = 2y0x:3 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
72. " " " " " "  = 2y0z:3 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
73. " " " " " "  = 2y11:3 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
74. " " " " " "  = 2y13:3 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
75. " " " " " "  = 2y15:3 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a cognate codon on the 70s ribosome.
76. " " " " " "  = 2y17:3 *
Ef-tu complex 3
77. " " " " " "  = 2y19:3 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
78. " " " " " "  = 3d5b:3 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of one 70s ribosome. The enti structure contains two 70s ribosomes as described in remark
79. " " " " " "  = 3d5d:3 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of the second 70s ribosome. T crystal structure contains two 70s ribosomes as described i 400.
80. " " " " " "  = 3f1f:3 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of o ribosome. The entire crystal structure contains two 70s rib described in remark 400.
81. " " " " " "  = 3f1h:3 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of t 70s ribosome. The entire crystal structure contains two 70s as described in remark 400.
82. " " " " " "  = 3kir:3 *
Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 2 of 4)
83. " " " " " "  = 3kit:3 *
Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 4 of 4)
84. " " " " " "  = 3kiw:3 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 2 of 4)
85. " " " " " "  = 3kiy:3 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 4 of 4)
86. " " " " " "  = 3mrz:Z *
Recognition of the amber stop codon by release factor rf1. T 3mrz contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3ms0. Molecule a in the same asymmetric deposited as 3mr8 (50s) and 3ms1 (30s).
87. " " " " " "  = 3ms1:Z *
Recognition of the amber stop codon by release factor rf1. T 3ms1 contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3mr8. Molecule b in the same asymmetric deposited as 3mrz (50s) and 3ms0 (30s).
88. " " " " " "  = 3pyo:Z *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the first 70s ribosome.
89. " " " " " "  = 3pyr:Z *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the second 70s ribosome.
90. " " " " " "  = 3pyt:Z *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the first 70s ribosome.
91. " " " " " "  = 3pyv:Z *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the second 70s ribosome.
92. " " " " " "  = 4jux:3 *
Crystal structure of the ribosome bound to elongation factor guanosine triphosphatase state (this file contains the 50s
93. " " " " " "  = 4k0m:3 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
94. " " " " " "  = 4k0q:3 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
95. " " " " " "  = 4kfi:3 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the a subunit
96. " " " " " "  = 4kfl:3 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the b subunit
97. " " " " " "  = 4l6j:Z *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the first 70s ribosome.
98. " " " " " "  = 4l6l:Z *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the second 70s ribosome
99. 370 100.0% 59 59 527.4 2.1e-22 2hgj:2 * Crystal structure of the 70s thermus thermophilus ribosome s the 16s 3'-end mimicks mRNA e and p codons. This entry 2hgj 50s ribosomal subunit. The 30s ribosomal subunit can be fou entry 2hgi.
100. " " " " " "  = 2hgq:2 *
Crystal structure of the 70s thermus thermophilus ribosome w translocated and rotated shine-dalgarno duplex. This entry contains 50s ribosomal subunit. The 30s ribosomal subunit c found in PDB entry 2hgp.
101. " " " " " "  = 2hgu:2 *
70s t.Th. Ribosome functional complex with mRNA and e- and p trnas at 4.5a. This entry 2hgu contains 50s ribosomal subun 30s ribosomal subunit can be found in PDB entry 2hgr.
102. " " " " " "  = 3hux:3 *
Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule i.
103. " " " " " "  = 3i8f:X *
Elongation complex of the 70s ribosome with three trnas and entry 3i8f contains 50s ribosomal subunit. The 30s ribosoma can be found in PDB entry 3i8g. Molecule b in the same asym unit is deposited as 3i8g (30s) and 3i8f (50s).
104. " " " " " "  = 3i8i:X *
Elongation complex of the 70s ribosome with three trnas and entry 3i8i contains 50s ribosomal subnit. The 30s ribosomal can be found in PDB entry 3i8h. Molecule a in the same asym unit is deposited as 3i8f (50s) and 3i8g (30s).
105. " " " " " "  = 3i9c:X *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9c contains 50s ribosomal subunit of molecule b. The 30s subunit can be found in PDB entry 3i9b. Molecule a in the s asymmetric unit is deposited as 3i9d (30s) and 3i9e (50s)
106. " " " " " "  = 3i9e:X *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9e contains 50s ribosomal subunit of molecule a. The 30s subunit can be found in PDB entry 3i9d. Molecule b in the s asymmetric unit is deposited as 3i9b (30s) and 3i9c (50s)
107. " " " " " "  = 3tve:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-leu complex
108. " " " " " "  = 3tvh:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-leu complex
109. " " " " " "  = 3uxq:3 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
110. " " " " " "  = 3uxr:3 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
111. " " " " " "  = 3uye:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
112. " " " " " "  = 3uyg:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
113. " " " " " "  = 3uz1:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex with paromomycin
114. " " " " " "  = 3uz2:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-leu complex with paromomycin.
115. " " " " " "  = 3uz8:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-tyr complex.
116. " " " " " "  = 3uz9:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-tyr complex.
117. " " " " " "  = 3uzf:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex
118. " " " " " "  = 3uzh:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex.
119. " " " " " "  = 3uzk:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex with paromomycin
120. " " " " " "  = 3uzn:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex with paromomycin
121. " " " " " "  = 3v23:3 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
122. " " " " " "  = 3v25:3 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 2nd ribosom asu
123. " " " " " "  = 3v27:3 *
Crystal structure of hpf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
124. " " " " " "  = 3v29:3 *
Crystal structure of hpf bound to the 70s ribosome. This ent contains the 50s subunit of the 2nd molecule in the asu.
125. " " " " " "  = 3v2d:3 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 1st ribosom asu
126. " " " " " "  = 3v2f:3 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 2nd ribosom asu
127. " " " " " "  = 4dha:3 *
Crystal structure of yaej bound to the 70s ribosome
128. " " " " " "  = 4g5l:X *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule a.
129. " " " " " "  = 4g5n:X *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule b.
130. " " " " " "  = 4g5u:X *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule a.
131. " " " " " "  = 4g5w:X *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule b.
132. 364 100.0% 58 58 519.2 6e-22 4dhc:3 Crystal structure of yaej bound to the 70s ribosome
133. 320 100.0% 51 51 459.2 1.3e-18 1twv:O Model structure of the t. Thermophilus 70s ribosome,50s subunit of 70s ribosome. This file, 1twv, contains only molecules of the 50s ribosomal subunit. The 30s subunit is in the PDB file 1twt.
134. 175 48.1% 54 55 258.7 1.9e-07 1kc9:X * Crystal structure of the large ribosomal subunit from deinococcus radiodurans
135. " " " " " "  = 1kpj:X *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
136. " " " " " "  = 1lnr:X *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
137. " " " " " "  = 1nkw:X *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
138. " " " " " "  = 1nwx:X *
Complex of the large ribosomal subunit from deinococcus radiodurans with abt-773
139. " " " " " "  = 1nwy:X *
Complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin
140. " " " " " "  = 1pnu:X *
Crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. This file, 1pnu, contains only molecules of the 50s ribosomal subunit. The 30s subunit, mRNA, p-site tRNA, and a-site tRNA are in the PDB file 1pns.
141. " " " " " "  = 1pny:X *
Crystal structure of the wild type ribosome from e. Coli, 50s subunit of 70s ribosome. This file, 1pny, contains only molecules of the 50s ribosomal subunit. The 30s subunit is in the PDB file 1pnx.
142. " " " " " "  = 1sm1:X *
Complex of the large ribosomal subunit from deinococcus radi with quinupristin and dalfopristin
143. " " " " " "  = 1vor:Z *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
144. " " " " " "  = 1vou:Z *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
145. " " " " " "  = 1vow:Z *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
146. " " " " " "  = 1voy:Z *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
147. " " " " " "  = 1vp0:Z *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
148. " " " " " "  = 1xbp:X *
Inhibition of peptide bond formation by pleuromutilins: the structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with tiamulin
149. " " " " " "  = 2zjp:W *
Thiopeptide antibiotic nosiheptide bound to the large riboso subunit of deinococcus radiodurans
150. " " " " " "  = 2zjq:W *
Interaction of l7 with l11 induced by microccocin binding to deinococcus radiodurans 50s subunit
151. " " " " " "  = 2zjr:W *
Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
152. " " " " " "  = 3cf5:W *
Thiopeptide antibiotic thiostrepton bound to the large ribos subunit of deinococcus radiodurans
153. " " " " " "  = 3dll:W *
The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
154. " " " " " "  = 3pio:W *
Crystal structure of the synergistic antibiotic pair lankamy lankacidin in complex with the large ribosomal subunit
155. " " " " " "  = 3pip:W *
Crystal structure of the synergistic antibiotic pair lankamy lankacidin in complex with the large ribosomal subunit
156. " " " " " "  = 4io9:W *
Crystal structure of compound 4d bound to large ribosomal su (50s) from deinococcus radiodurans
157. " " " " " "  = 4ioa:W *
Crystal structure of compound 4e bound to large ribosomal su (50s) from deinococcus radiodurans
158. " " " " " "  = 4ioc:W *
Crystal structure of compound 4f bound to large ribosomal su (50s) from deinococcus radiodurans
159. 169 45.5% 55 56 250.3 5.7e-07 3j3v:Y Atomic model of the immature 50s subunit from bacillus subti i-a)
160. 141 44.4% 54 56 211.7 8e-05 1p85:X * Real space refined coordinates of the 50s subunit fitted int resolution cryo-em map of the ef-g.Gtp state of e. Coli 70s
161. " " " " " "  = 1p86:X *
Real space refined coordinates of the 50s subunit fitted int resolution cryo-em map of the initiation-like state of e. C ribosome
162. " " " " " "  = 2gya:X *
Structure of the 50s subunit of a pre-translocational e. Coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-em map emd-1056
163. " " " " " "  = 2gyc:X *
Structure of the 50s subunit of a secm-stalled e. Coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-em map emd-1143
164. 141 44.4% 54 58 211.5 8.2e-05 1vs6:Y * Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
165. " " " " " "  = 1vs8:Y *
Crystal structure of the bacterial ribosome from escherichia complex with the antibiotic kasugamyin at 3.5a resolution. Contains the 50s subunit of one 70s ribosome. The entire cr structure contains two 70s ribosomes and is described in re
166. " " " " " "  = 1vt2:Z *
Crystal structure of the e. Coli ribosome bound to cem-101. Contains the 50s subunit of the second 70s ribosome.
167. " " " " " "  = 2aw4:Y *
Crystal structure of the bacterial ribosome from escherichia 3.5 a resolution. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib is described in remark 400.
168. " " " " " "  = 2awb:Y *
Crystal structure of the bacterial ribosome from escherichia 3.5 a resolution. This file contains the 50s subunit of the 70s ribosome. The entire crystal structure contains two 70s and is described in remark 400.
169. " " " " " "  = 2i2t:Z *
Crystal structure of ribosome with messenger RNA and the anticodon stem-loop of p-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
170. " " " " " "  = 2i2v:Z *
Crystal structure of ribosome with messenger RNA and the anticodon stem-loop of p-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
171. " " " " " "  = 2j28:Y *
Model of e. Coli srp bound to 70s rncs
172. " " " " " "  = 2qam:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with neomycin. This file contains the 50s subunit of the first 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
173. " " " " " "  = 2qao:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with neomycin. This file contains the 50s subunit of the second 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
174. " " " " " "  = 2qba:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin. This file contains the 50s subunit of the first 70s ribosome, with gentamicin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
175. " " " " " "  = 2qbc:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin. This file contains the 50s subunit of the second 70s ribosome, with gentamicin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
176. " " " " " "  = 2qbe:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
177. " " " " " "  = 2qbg:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
178. " " " " " "  = 2qbi:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin and ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with gentamicin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
179. " " " " " "  = 2qbk:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin and ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with gentamicin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
180. " " " " " "  = 2qov:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin. This file contains the 50s subunit of the first 70s ribosome. The entire crystal structure contains two 70s ribosomes.
181. " " " " " "  = 2qox:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin. This file contains the 50s subunit of the second 70s ribosome. The entire crystal structure contains two 70s ribosomes.
182. " " " " " "  = 2qoz:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin and neomycin. This file contains the 50s subunit of the first 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes.
183. " " " " " "  = 2qp1:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin and neomycin. This file contains the 50s subunit of the second 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes.
184. " " " " " "  = 2rdo:Y *
50s subunit with ef-g(gdpnp) and rrf bound
185. " " " " " "  = 2vhm:Y *
Structure of pdf binding helix in complex with the ribosome (part 1 of 4)
186. " " " " " "  = 2vhn:Y *
Structure of pdf binding helix in complex with the ribosome. (Part 2 of 4)
187. " " " " " "  = 2wwq:2 *
E.Coli 70s ribosome stalled during translation of tnac leader peptide. This file contains the 50s, the p-site tRNA and the tnac leader peptide (part 2 of 2).
188. " " " " " "  = 2z4l:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with paromomycin and ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with paromomycin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
189. " " " " " "  = 2z4n:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with paromomycin and ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with paromomycin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
190. " " " " " "  = 3bbx:Y *
The hsp15 protein fitted into the low resolution cryo-em map 50s.Nc-tRNA.Hsp15 complex
191. " " " " " "  = 3df2:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with hygromycin b. This file contains the 50s subunit of the first 70s ribosome. The entire crystal structure contains two 70s ribosomes.
192. " " " " " "  = 3df4:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with hygromycin b. This file contains the 50s subunit of the second 70s ribosome. The entire crystal structure contains two 70s ribosomes.
193. " " " " " "  = 3e1b:R *
Structure of the 50s subunit of e. Coli ribosome in pre-acco state
194. " " " " " "  = 3e1d:R *
Structure of the 50s subunit of e. Coli ribosome in post-acc state
195. " " " " " "  = 3fik:Z *
Ternary complex-bound e.Coli 70s ribosome. This entry consis 50s subunit.
196. " " " " " "  = 3i1n:Z *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
197. " " " " " "  = 3i1p:Z *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
198. " " " " " "  = 3i1r:Z *
Crystal structure of the e. Coli 70s ribosome in an intermed of ratcheting
199. " " " " " "  = 3i1t:Z *
Crystal structure of the e. Coli 70s ribosome in an intermed of ratcheting
200. " " " " " "  = 3i20:Z *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
201. " " " " " "  = 3i22:Z *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
202. " " " " " "  = 3iy9:Y *
Leishmania tarentolae mitochondrial large ribosomal subunit model
203. " " " " " "  = 3izt:a *
Structural insights into cognate vs. Near-cognate discrimina during decoding. This entry contains the large subunit of a programmed with a near-cognate codon.
204. " " " " " "  = 3izu:a *
Structural insights into cognate vs. Near-cognate discrimina during decoding. This entry contains the large subunit of a programmed with a cognate codon
205. " " " " " "  = 3j01:Z *
Structure of the ribosome-secye complex in the membrane envi
206. " " " " " "  = 3j0t:1 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class2 of the six classes)
207. " " " " " "  = 3j0w:1 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 4a of the six classes)
208. " " " " " "  = 3j0y:1 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 4b of the six classes)
209. " " " " " "  = 3j11:1 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 3 of the six classes)
210. " " " " " "  = 3j12:1 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 5 of the six classes)
211. " " " " " "  = 3j14:1 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 6 of the six classes)
212. " " " " " "  = 3j19:Z *
Structure of the bacterial ribosome complexed by tmrna-smpb during translocation and mld-loading (50s subunit)
213. " " " " " "  = 3j37:3 *
Tetracycline resistance protein tet(o) bound to the ribosome
214. " " " " " "  = 3j4x:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic pre- translocation state (pre1b, 50s subunit)
215. " " " " " "  = 3j50:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (pre2, 50s subunit)
216. " " " " " "  = 3j51:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (pre3, 50s subunit)
217. " " " " " "  = 3j52:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic pre- translocation state (pre1a, 50s subunit)
218. " " " " " "  = 3j54:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre4, 50s subunit)
219. " " " " " "  = 3j56:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre5a, 50s subunit)
220. " " " " " "  = 3j58:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre5b, 50s subunit)
221. " " " " " "  = 3j5a:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic post translocation state (post1, 50s subunit)
222. " " " " " "  = 3j5c:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post2a, 50s subunit)
223. " " " " " "  = 3j5e:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post2b, 50s subunit)
224. " " " " " "  = 3j5g:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post3a, 50s subunit)
225. " " " " " "  = 3j5i:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post3b, 50s subunit)
226. " " " " " "  = 3j5k:Z *
E. Coli 70s-fmetval-trnaval post-translocation complex (post subunit)
227. " " " " " "  = 3j5o:Z *
Visualization of two trnas trapped in transit during ef-g-me translocation (50s subunit)
228. " " " " " "  = 3j5u:2 *
Structure of the ribosome with elongation factor g trapped i translocation state (pre-translocation 70s tRNA structure, subunit)
229. " " " " " "  = 3j5w:3 *
Structure of the ribosome with elongation factor g trapped i translocation state (pre-translocation 70s tRNA Ef-g struct subunit)
230. " " " " " "  = 3kcr:Z *
Ribosome-secy complex. This entry 3kcr contains 50s ribosomal subnit. The 30s ribosomal subunit can be found in PDB entry 3kc4
231. " " " " " "  = 3oas:Z *
Crystal structure of the e. Coli ribosome bound to telithrom file contains the 50s subunit of the second 70s ribosome.
232. " " " " " "  = 3oat:Z *
Crystal structure of the e. Coli ribosome bound to telithrom file contains the 50s subunit of the first 70s ribosome wit telithromycin bound.
233. " " " " " "  = 3ofc:Z *
Crystal structure of the e. Coli ribosome bound to chloramph this file contains the 50s subunit of the first 70s ribosom chloramphenicol bound.
234. " " " " " "  = 3ofd:Z *
Crystal structure of the e. Coli ribosome bound to chloramph this file contains the 50s subunit of the second 70s riboso
235. " " " " " "  = 3ofq:Z *
Crystal structure of the e. Coli ribosome bound to erythromy file contains the 50s subunit of the second 70s ribosome.
236. " " " " " "  = 3ofr:Z *
Crystal structure of the e. Coli ribosome bound to erythromy file contains the 50s subunit of the first 70s ribosome wit erthromycin bound.
237. " " " " " "  = 3ofz:Z *
Crystal structure of the e. Coli ribosome bound to clindamyc file contains the 50s subunit of the first 70s ribosome bou clindamycin.
238. " " " " " "  = 3og0:Z *
Crystal structure of the e. Coli ribosome bound to clindamyc file contains the 50s subunit of the second 70s ribosome.
239. " " " " " "  = 3orb:Z *
Crystal structure of the e. Coli ribosome bound to cem-101. Contains the 50s subunit of the first 70s ribosome bound to
240. " " " " " "  = 3r8s:Z *
Structures of the bacterial ribosome in classical and hybrid tRNA binding
241. " " " " " "  = 3r8t:Z *
Structures of the bacterial ribosome in classical and hybrid tRNA binding
242. " " " " " "  = 3sgf:3 *
Crystal structure of release factor rf3 trapped in the gtp s rotated conformation of the ribosome
243. " " " " " "  = 3uos:3 *
Crystal structure of release factor rf3 trapped in the gtp s rotated conformation of the ribosome (without viomycin)
244. " " " " " "  = 4gar:Z *
Allosteric control of the ribosome by small-molecule antibio
245. " " " " " "  = 4gau:Z *
Allosteric control of the ribosome by small-molecule antibio
246. " " " " " "  = 4kix:Z *
Control of ribosomal subunit rotation by elongation factor g
247. " " " " " "  = 4kiz:Z *
Control of ribosomal subunit rotation by elongation factor g
248. " " " " " "  = 4kj1:Z *
Control of ribosomal subunit rotation by elongation factor g
249. " " " " " "  = 4kj3:Z *
Control of ribosomal subunit rotation by elongation factor g
250. " " " " " "  = 4kj5:Z *
Control of ribosomal subunit rotation by elongation factor g
251. " " " " " "  = 4kj7:Z *
Control of ribosomal subunit rotation by elongation factor g
252. " " " " " "  = 4kj9:Z *
Control of ribosomal subunit rotation by elongation factor g
253. " " " " " "  = 4kjb:Z *
Control of ribosomal subunit rotation by elongation factor g
254. 94 28.8% 52 59 146.5 0.34 4ce4:3 39s large subunit of the porcine mitochondrial ribosome
255. 73 31.9% 47 112 114.0 22 2lky:A Solution structure of msmeg_1053, the second duf3349 annotat in the genome of mycobacterium smegmatis, seattle structura center for infectious disease target mysma.17112.B
256. 74 22.2% 54 155 113.5 23 3j21:Y * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
257. " " " " " "  = 3j44:Y *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
258. 76 36.6% 41 521 109.5 39 2vro:A Crystal structure of aldehyde dehydrogenase from burkholderia xenovorans lb400
259. 76 36.6% 41 519 109.5 39 2y52:A Crystal structure of e496a mutant of the box pathway encoded aldh from burkholderia xenovorans lb400
260. 76 36.6% 41 521 109.5 39 2y5d:A Crystal structure of c296a mutant of the box pathway encoded aldh from burkholderia xenovorans lb400
261. 76 36.6% 41 529 109.4 40 2y51:A Crystal structure of e167a mutant of the box pathway encoded aldh from burkholderia xenovorans lb400
262. 76 36.6% 41 529 109.4 40 2y53:A Crystal structure of e257q mutant of the box pathway encoded aldh from burkholderia xenovorans lb400

Number of sequences: 262

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer