spacer
spacer

SAS results for UniProt accession no. Q72L77

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. Q72L77 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q72L77 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 27 unique sequences (including 9 consensus sequences) giving 301 sequence matches in all. The 7 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345     Protein name
       ---------+---------+---------+---------+---------+---------+-----     ------------
Q72L77 -----------------------------------------------------------------     50S ribosomal protein L35 OS=Thermus thermophilus (strain  ...
2hgj:7*-----------------------------------------------------------------×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
1vvm:8*-----------------------------------------------------------------×94  Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1vsa:a*-----------------------------------------------------------------×35  Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3huz:8 -----------------------------------------------------------------     Structure of ef-p bound to the 70s ribosome; this file  ...
3tve:8*-----------------------------------------------------------------×10  Crystal structure analysis of ribosomal decoding. This  ...
3uz8:8*-----------------------------------------------------------------×6   Crystal structure analysis of ribosomal decoding. This  ...
1kc9:3*-----------------------------------------------------------------×28  Crystal structure of the large ribosomal subunit from  ...
3pio:3*-----------------------------------------------------------------×2   Crystal structure of the synergistic antibiotic pair  ...
3bbo:5 -----------------------------------------------------------------     Homology model for the spinach chloroplast 50s subunit  ...
1vs6:3*-----------------------------------------------------------------×103 Crystal structure of the bacterial ribosome from  ...
2mdh:B gspqirvlvtgaaqlgftllysigdgsvfgknqpilvnsmdqrpkagankgvqmelqncaalpnl     Oxidoreductase(NAD(a)-choh(d))
1pd6:A -----------------------------------------------------------------     The nmr structure of domain c2 of human cardiac myosin  ...
2yxm:A -----------------------------------------------------------------     Crystal structure of i-set domain of human myosin binding  ...
2yuv:A -----------------------------------------------------------------     Solution structure of 2nd immunoglobulin domain of slow  ...
4f3p:A -------------kelvvgtdtsfmpfefkqgdkyvgfdldlwaeiakgagwtykiqpmdfagli     Crystal structure of a glutamine-binding periplasmic  ...
2ra8:A -----------------------------------------------------------------     Crystal structure of the q64v53_bacfr protein from  ...
2zkr:6 -----------------------------------------------------------------     Structure of a mammalian ribosomal 60s subunit within an  ...
4dok:A -----------------------------------------------------------------     Crystal structure of arabidopsis thaliana  ...
2z2i:A -----------------------------------------------------------------     Crystal structure of peptidyl-tRNA hydrolase from  ...
2z2j:A*-----------------------------------------------------------------×2   Crystal structure of peptidyl-tRNA hydrolase from  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890     Protein name
       ----+---------+---------+---------+---------+---------+---------+     ------------
Q72L77 -----------------------------------mpkmkthkgakkrvkitasgkvvamktgkr     50S ribosomal protein L35 OS=Thermus thermophilus (strain  ...
2hgj:7*-----------------------------------mpkmkthkgakkrvkitasgkvvamktgkr×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
1vvm:8*------------------------------------pkmkthkgakkrvkitasgkvvamktgkr×94  Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1vsa:a*------------------------------------pkmkthkgakkrvkitasgkvvamktgkr×35  Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3huz:8 ------------------------------------pkmkthkgakkrvkitasgkvvamktgkr     Structure of ef-p bound to the 70s ribosome; this file  ...
3tve:8*------------------------------------pkmkthkgakkrvkitasgkvvamktgkr×10  Crystal structure analysis of ribosomal decoding. This  ...
3uz8:8*------------------------------------pkmkthkgakkrvkitasgkvvamktgkr×6   Crystal structure analysis of ribosomal decoding. This  ...
1kc9:3*------------------------------------pkmkthkmakrrikitgtgkvmafksgkr×28  Crystal structure of the large ribosomal subunit from  ...
3pio:3*----------------------------------------thkmakrrikitgtgkvmafksgkr×2   Crystal structure of the synergistic antibiotic pair  ...
3bbo:5 -------------------------------------kmkthkasakrfrvtgkgkivrrragkq     Homology model for the spinach chloroplast 50s subunit  ...
1vs6:3*------------------------------------pkiktvrgaakrfkktgkggfkhkhanlr×103 Crystal structure of the bacterial ribosome from  ...
2mdh:B lksqgtkstgngyknnnigvlvageaaaaaaatanavkkfkkkgaakakk--akakvavikkgka     Oxidoreductase(NAD(a)-choh(d))
1pd6:A -----------------------dekkstafqkklepayqvskghkirltveladhdaevk----     The nmr structure of domain c2 of human cardiac myosin  ...
2yxm:A -----------------------sgssgaafakildpayqvdkggrvrf-------vveladpkl     Crystal structure of i-set domain of human myosin binding  ...
2yuv:A ---------------------gssgssgaafakildpayqvdkggrvrf-------vveladpkl     Solution structure of 2nd immunoglobulin domain of slow  ...
4f3p:A palqtqnidvalsgmtikeerrkaidfsdpyydsglaamvqannttiksiddlngkviaaktgta     Crystal structure of a glutamine-binding periplasmic  ...
2ra8:A -mkrvfvfqdfksqkfwsidvrgtdvivnygklgtdgqtqvknfssageaekaagkliaektkkg     Crystal structure of the q64v53_bacfr protein from  ...
2zkr:6 ---------------------------------------vaakktkkslesinsrlqlvmksgky     Structure of a mammalian ribosomal 60s subunit within an  ...
4dok:A ----------stgmvmvhevpfppqiitskplsllgqgitdieihflqvkftaigvyldpsdvkt     Crystal structure of arabidopsis thaliana  ...
2z2i:A --------------------------maepllvvglgnpganyartrhnlgfvvadllaarlgak     Crystal structure of peptidyl-tRNA hydrolase from  ...
2z2j:A*--------------------------maepllvvglgnpganyartrhnlgfvvadllaarlgak×2   Crystal structure of peptidyl-tRNA hydrolase from  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345     Protein name
       ---------+---------+---------+---------+---------+---------+-----     ------------
Q72L77 hl-n-wq-k---sg---kei---rqkgrkf-vlakpeaeriklllpye-----------------     50S ribosomal protein L35 OS=Thermus thermophilus (strain  ...
2hgj:7*hl-n-wq-k---sg---kei---rqkgrkf-vlakpeaeriklllpy------------------×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
1vvm:8*hl-n-wq-k---sg---kei---rqkgrkf-vlakpeaeriklllpye-----------------×94  Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1vsa:a*hl-n-wq-k---sg---kei---rqkgrkf-vlakpeaeriklllpy------------------×35  Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3huz:8 hl-n-wq-k---sg---kei---rqkgrkf-vlakpeaeriklllp-------------------     Structure of ef-p bound to the 70s ribosome; this file  ...
3tve:8*hl-n-wq-k---sg---kei---rqkgrkf-vlakpeaeriklll--------------------×10  Crystal structure analysis of ribosomal decoding. This  ...
3uz8:8*hl-n-wq-k---sg---kei---rqkgrkf-vlakpeaerikll---------------------×6   Crystal structure analysis of ribosomal decoding. This  ...
1kc9:3*hq-n-tg-k---sg---dei---rgkgkgf-vlakaewarmklmlpr------------------×28  Crystal structure of the large ribosomal subunit from  ...
3pio:3*hq-n-tg-k---sg---dei---rgkgkgf-vlakaewarmklmlpr------------------×2   Crystal structure of the synergistic antibiotic pair  ...
3bbo:5 hl-l-ak-k---nt---krk---nrlskli-qvdrsdydnvigalpy------------------     Homology model for the spinach chloroplast 50s subunit  ...
1vs6:3*hi-l-tk-k---at---krk---rhlrpka-mvskgdlglviaclpya-----------------×103 Crystal structure of the bacterial ribosome from  ...
2mdh:B ak-k-kk-kkasag---kka---kakarkv-vvvrkdkkrakaliaakkgkakkkvkkivkwgkh     Oxidoreductase(NAD(a)-choh(d))
1pd6:A -----wl-k---ng---qei---qmsgsky-ifesigakrtltisqcsladdaayqcvvggekcs     The nmr structure of domain c2 of human cardiac myosin  ...
2yxm:A ev-k-wy-k---ng---qei---rps-tky-ifehkgcqrilfinncqmtddseyyvtagdekcs     Crystal structure of i-set domain of human myosin binding  ...
2yuv:A ev-k-wy-k---ng---qei---rps-tky-ifehkgcqrilfinncqmtddseyyvtagdekcs     Solution structure of 2nd immunoglobulin domain of slow  ...
4f3p:A ti-d-wi-k---ahlkpkei---rqfpnid-qaylaleagrvdaamhdtpnvlffvnnegkgrvk     Crystal structure of a glutamine-binding periplasmic  ...
2ra8:A yv-etle-e---va---kem---kveakky-alsydeaeegvnlmdkilkdkklpslkqitigxw     Crystal structure of the q64v53_bacfr protein from  ...
2zkr:6 vl-g-yk-q---tl---kmi---rqgkakl-vilanncpalrkseieyyamlaktgvhhysgnni     Structure of a mammalian ribosomal 60s subunit within an  ...
4dok:A hldn-wkgk---tg---kel---agdddffdalasaemekvirvvvikeikgaqygvqlentvrd     Crystal structure of arabidopsis thaliana  ...
2z2i:A fk-a-hk-r---sg---aevatgrsagrsl-vlakprcymnesgrqigplakfysvapaniivih     Crystal structure of peptidyl-tRNA hydrolase from  ...
2z2j:A*fk-a-hk-r---sg---aevatgrsagrsl-vlakprcymnesgrqigplakfysvapaniivih×2   Crystal structure of peptidyl-tRNA hydrolase from  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890     Protein name
       ----+---------+---------+---------+---------+---------+---------+     ------------
Q72L77 -----------------------------------------------------------------     50S ribosomal protein L35 OS=Thermus thermophilus (strain  ...
2hgj:7*-----------------------------------------------------------------×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
1vvm:8*-----------------------------------------------------------------×94  Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1vsa:a*-----------------------------------------------------------------×35  Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3huz:8 -----------------------------------------------------------------     Structure of ef-p bound to the 70s ribosome; this file  ...
3tve:8*-----------------------------------------------------------------×10  Crystal structure analysis of ribosomal decoding. This  ...
3uz8:8*-----------------------------------------------------------------×6   Crystal structure analysis of ribosomal decoding. This  ...
1kc9:3*-----------------------------------------------------------------×28  Crystal structure of the large ribosomal subunit from  ...
3pio:3*-----------------------------------------------------------------×2   Crystal structure of the synergistic antibiotic pair  ...
3bbo:5 -----------------------------------------------------------------     Homology model for the spinach chloroplast 50s subunit  ...
1vs6:3*-----------------------------------------------------------------×103 Crystal structure of the bacterial ribosome from  ...
2mdh:B grakgvkvvkgkaaaaaakkkkakkkiawkagakkkaaakkakaaaaaaaakakkaakavckhik     Oxidoreductase(NAD(a)-choh(d))
1pd6:A telfvke----------------------------------------------------------     The nmr structure of domain c2 of human cardiac myosin  ...
2yxm:A telfvr-----------------------------------------------------------     Crystal structure of i-set domain of human myosin binding  ...
2yuv:A telfvrsgpssg-----------------------------------------------------     Solution structure of 2nd immunoglobulin domain of slow  ...
4f3p:A vagapvsgdkygigfpkgsplvakvnaelarmkadgryakiykkwfgsepq--------------     Crystal structure of a glutamine-binding periplasmic  ...
2ra8:A gyegedcsdiadgivenkekfahfeglfwgdidfeeqeiswieqvdlspvldampllnnlkikgt     Crystal structure of the q64v53_bacfr protein from  ...
2zkr:6 elgtacgkyyrvctlaiidpgdsdiirsmpeqtge------------------------------     Structure of a mammalian ribosomal 60s subunit within an  ...
4dok:A rlaeedkyeeeeetelekvvgffqskyfkansvityhfsakdgiceigfetegkeeeklkvenan     Crystal structure of arabidopsis thaliana  ...
2z2i:A ddldlefgrirlkigggegghnglrsvvaalgtkdfqrvrigigrppgrkdpaafvlenftpaer     Crystal structure of peptidyl-tRNA hydrolase from  ...
2z2j:A*ddldlefgrirlkigggegghnglrsvvaalgtkdfqrvrigigrppgrkdpaafvlenftpaer×2   Crystal structure of peptidyl-tRNA hydrolase from  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345     Protein name
       ---------+---------+---------+---------+---------+---------+-----     ------------
Q72L77 -----------------------------------------------------------------     50S ribosomal protein L35 OS=Thermus thermophilus (strain  ...
2hgj:7*-----------------------------------------------------------------×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
1vvm:8*-----------------------------------------------------------------×94  Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1vsa:a*-----------------------------------------------------------------×35  Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3huz:8 -----------------------------------------------------------------     Structure of ef-p bound to the 70s ribosome; this file  ...
3tve:8*-----------------------------------------------------------------×10  Crystal structure analysis of ribosomal decoding. This  ...
3uz8:8*-----------------------------------------------------------------×6   Crystal structure analysis of ribosomal decoding. This  ...
1kc9:3*-----------------------------------------------------------------×28  Crystal structure of the large ribosomal subunit from  ...
3pio:3*-----------------------------------------------------------------×2   Crystal structure of the synergistic antibiotic pair  ...
3bbo:5 -----------------------------------------------------------------     Homology model for the spinach chloroplast 50s subunit  ...
1vs6:3*-----------------------------------------------------------------×103 Crystal structure of the bacterial ribosome from  ...
2mdh:B kifkaakavhaakakkakaaakwkakkaafkkaakikakawkivkglkikafkkakkkvkaakka     Oxidoreductase(NAD(a)-choh(d))
1pd6:A -----------------------------------------------------------------     The nmr structure of domain c2 of human cardiac myosin  ...
2yxm:A -----------------------------------------------------------------     Crystal structure of i-set domain of human myosin binding  ...
2yuv:A -----------------------------------------------------------------     Solution structure of 2nd immunoglobulin domain of slow  ...
4f3p:A -----------------------------------------------------------------     Crystal structure of a glutamine-binding periplasmic  ...
2ra8:A nnlsigkkprpnlksleiisgglpdsvvedilgsdlpnleklvlyvgvedygfdgdmnvfrplfs     Crystal structure of the q64v53_bacfr protein from  ...
2zkr:6 -----------------------------------------------------------------     Structure of a mammalian ribosomal 60s subunit within an  ...
4dok:A vvgmmqrwylsgsrgvspstivsiadsisavlt--------------------------------     Crystal structure of arabidopsis thaliana  ...
2z2i:A aevpticeqaadatellieq---------------------------------------------     Crystal structure of peptidyl-tRNA hydrolase from  ...
2z2j:A*aevpticeqaadatellieqg--------------------------------------------×2   Crystal structure of peptidyl-tRNA hydrolase from  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890     Protein name
       ----+---------+---------+---------+---------+---------+---------+     ------------
Q72L77 -----------------------------------------------------------------     50S ribosomal protein L35 OS=Thermus thermophilus (strain  ...
2hgj:7*-----------------------------------------------------------------×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
1vvm:8*-----------------------------------------------------------------×94  Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1vsa:a*-----------------------------------------------------------------×35  Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3huz:8 -----------------------------------------------------------------     Structure of ef-p bound to the 70s ribosome; this file  ...
3tve:8*-----------------------------------------------------------------×10  Crystal structure analysis of ribosomal decoding. This  ...
3uz8:8*-----------------------------------------------------------------×6   Crystal structure analysis of ribosomal decoding. This  ...
1kc9:3*-----------------------------------------------------------------×28  Crystal structure of the large ribosomal subunit from  ...
3pio:3*-----------------------------------------------------------------×2   Crystal structure of the synergistic antibiotic pair  ...
3bbo:5 -----------------------------------------------------------------     Homology model for the spinach chloroplast 50s subunit  ...
1vs6:3*-----------------------------------------------------------------×103 Crystal structure of the bacterial ribosome from  ...
2mdh:B agkkkgkflaaa-----------------------------------------------------     Oxidoreductase(NAD(a)-choh(d))
1pd6:A -----------------------------------------------------------------     The nmr structure of domain c2 of human cardiac myosin  ...
2yxm:A -----------------------------------------------------------------     Crystal structure of i-set domain of human myosin binding  ...
2yuv:A -----------------------------------------------------------------     Solution structure of 2nd immunoglobulin domain of slow  ...
4f3p:A -----------------------------------------------------------------     Crystal structure of a glutamine-binding periplasmic  ...
2ra8:A kdrfpnlkwlgivdaeeqnvvvemflesdilpqletmdisagvltdegarllldhvdkikhlkfi     Crystal structure of the q64v53_bacfr protein from  ...
2zkr:6 -----------------------------------------------------------------     Structure of a mammalian ribosomal 60s subunit within an  ...
4dok:A -----------------------------------------------------------------     Crystal structure of arabidopsis thaliana  ...
2z2i:A -----------------------------------------------------------------     Crystal structure of peptidyl-tRNA hydrolase from  ...
2z2j:A*-----------------------------------------------------------------×2   Crystal structure of peptidyl-tRNA hydrolase from  ...

                4         4         4        
                0         1         2        
       12345678901234567890123456789012345678                                Protein name
       ---------+---------+---------+--------                                ------------
Q72L77 --------------------------------------                                50S ribosomal protein L35 OS=Thermus thermophilus (strain  ...
2hgj:7*--------------------------------------                           ×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
1vvm:8*--------------------------------------                           ×94  Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1vsa:a*--------------------------------------                           ×35  Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3huz:8 --------------------------------------                                Structure of ef-p bound to the 70s ribosome; this file  ...
3tve:8*--------------------------------------                           ×10  Crystal structure analysis of ribosomal decoding. This  ...
3uz8:8*--------------------------------------                           ×6   Crystal structure analysis of ribosomal decoding. This  ...
1kc9:3*--------------------------------------                           ×28  Crystal structure of the large ribosomal subunit from  ...
3pio:3*--------------------------------------                           ×2   Crystal structure of the synergistic antibiotic pair  ...
3bbo:5 --------------------------------------                                Homology model for the spinach chloroplast 50s subunit  ...
1vs6:3*--------------------------------------                           ×103 Crystal structure of the bacterial ribosome from  ...
2mdh:B --------------------------------------                                Oxidoreductase(NAD(a)-choh(d))
1pd6:A --------------------------------------                                The nmr structure of domain c2 of human cardiac myosin  ...
2yxm:A --------------------------------------                                Crystal structure of i-set domain of human myosin binding  ...
2yuv:A --------------------------------------                                Solution structure of 2nd immunoglobulin domain of slow  ...
4f3p:A --------------------------------------                                Crystal structure of a glutamine-binding periplasmic  ...
2ra8:A nmkynylsdemkkelqkslpmkidvsdsqeypmitele                                Crystal structure of the q64v53_bacfr protein from  ...
2zkr:6 --------------------------------------                                Structure of a mammalian ribosomal 60s subunit within an  ...
4dok:A --------------------------------------                                Crystal structure of arabidopsis thaliana  ...
2z2i:A --------------------------------------                                Crystal structure of peptidyl-tRNA hydrolase from  ...
2z2j:A*--------------------------------------                           ×2   Crystal structure of peptidyl-tRNA hydrolase from  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q72L77. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 65 - - Q72L77 50S ribosomal protein L35 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpmI PE=1 SV=3
2. 416 100.0% 64 64 571.3 7.6e-25 2hgj:7 * Crystal structure of the 70s thermus thermophilus ribosome s the 16s 3'-end mimicks mRNA e and p codons. This entry 2hgj 50s ribosomal subunit. The 30s ribosomal subunit can be fou entry 2hgi.
3. " " " " " "  = 2hgq:7 *
Crystal structure of the 70s thermus thermophilus ribosome w translocated and rotated shine-dalgarno duplex. This entry contains 50s ribosomal subunit. The 30s ribosomal subunit c found in PDB entry 2hgp.
4. " " " " " "  = 2hgu:7 *
70s t.Th. Ribosome functional complex with mRNA and e- and p trnas at 4.5a. This entry 2hgu contains 50s ribosomal subun 30s ribosomal subunit can be found in PDB entry 2hgr.
5. 415 100.0% 64 64 570.0 9e-25 1vvm:8 * Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u on the ribosome
6. " " " " " "  = 1vvo:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u on the ribosome
7. " " " " " "  = 1vvq:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-a on the ribosome
8. " " " " " "  = 1vvs:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-a on the ribosome
9. " " " " " "  = 1vvu:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccg-g on the ribosome
10. " " " " " "  = 1vvw:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccg-g on the ribosome
11. " " " " " "  = 1vvy:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u in the absence of paromomycin
12. " " " " " "  = 1vw0:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u in the absence of paromomycin
13. " " " " " "  = 1vx9:8 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-u ribosome
14. " " " " " "  = 1vxj:8 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-u ribosome
15. " " " " " "  = 1vxl:8 *
Crystal structure of tRNA proline (cgg) bound to codon ccg-g ribosome
16. " " " " " "  = 1vxn:8 *
Crystal structure of tRNA proline (cgg) bound to codon ccg-g ribosome
17. " " " " " "  = 1vxq:8 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-g ribosome
18. " " " " " "  = 1vxt:8 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-g ribosome
19. " " " " " "  = 1vy1:8 *
Crystal structure of unmodified tRNA proline (cgg) bound to on the ribosome
20. " " " " " "  = 1vy3:8 *
Crystal structure of unmodified tRNA proline (cgg) bound to on the ribosome
21. " " " " " "  = 2j01:8 *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 2 of 4). This file contains the 50s subunit from molecule i.
22. " " " " " "  = 2j03:8 *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50s subunit from molecule ii.
23. " " " " " "  = 2jl6:8 *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 2 of 4). This file contains the 50s subunit.
24. " " " " " "  = 2jl8:8 *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 4 of 4). This file contains the 50s subunit.
25. " " " " " "  = 2v47:8 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 2 of 4). This file contains the 50s subunit for molecule 1.
26. " " " " " "  = 2v49:8 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 4 of 4). This file contains the 50s subunit of molecule 2.
27. " " " " " "  = 2wdi:8 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule i.
28. " " " " " "  = 2wdj:8 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule ii.
29. " " " " " "  = 2wdl:8 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule i.
30. " " " " " "  = 2wdn:8 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule ii.
31. " " " " " "  = 2wh2:8 *
Insights into translational termination from the structure of rf2 bound to the ribosome
32. " " " " " "  = 2wh4:8 *
Insights into translational termination from the structure of rf2 bound to the ribosome
33. " " " " " "  = 2wrj:8 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state (part 2 of 4).
34. " " " " " "  = 2wrl:8 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state. (Part 4 of 4).
35. " " " " " "  = 2wro:8 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 2 of 4).
36. " " " " " "  = 2wrr:8 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 4 of 4).
37. " " " " " "  = 2x9s:8 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
38. " " " " " "  = 2x9u:8 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
39. " " " " " "  = 2xg0:8 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 2 of 4)
40. " " " " " "  = 2xg2:8 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 4 of 4)
41. " " " " " "  = 3fin:8 *
T. Thermophilus 70s ribosome in complex with mRNA, trnas and tu.Gdp.Kirromycin ternary complex, fitted to a 6.4 a cryo-e this file contains the 50s subunit.
42. " " " " " "  = 3i8f:8 *
Elongation complex of the 70s ribosome with three trnas and entry 3i8f contains 50s ribosomal subunit. The 30s ribosoma can be found in PDB entry 3i8g. Molecule b in the same asym unit is deposited as 3i8g (30s) and 3i8f (50s).
43. " " " " " "  = 3i8i:8 *
Elongation complex of the 70s ribosome with three trnas and entry 3i8i contains 50s ribosomal subnit. The 30s ribosomal can be found in PDB entry 3i8h. Molecule a in the same asym unit is deposited as 3i8f (50s) and 3i8g (30s).
44. " " " " " "  = 3i9c:8 *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9c contains 50s ribosomal subunit of molecule b. The 30s subunit can be found in PDB entry 3i9b. Molecule a in the s asymmetric unit is deposited as 3i9d (30s) and 3i9e (50s)
45. " " " " " "  = 3i9e:8 *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9e contains 50s ribosomal subunit of molecule a. The 30s subunit can be found in PDB entry 3i9d. Molecule b in the s asymmetric unit is deposited as 3i9b (30s) and 3i9c (50s)
46. " " " " " "  = 3kni:8 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule i
47. " " " " " "  = 3knk:8 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule ii.
48. " " " " " "  = 3knm:8 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule i.
49. " " " " " "  = 3kno:8 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule ii
50. " " " " " "  = 3oh5:8 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
51. " " " " " "  = 3oh7:8 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
52. " " " " " "  = 3ohj:8 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
53. " " " " " "  = 3ohk:8 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
54. " " " " " "  = 3ohz:8 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
55. " " " " " "  = 3oi1:8 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
56. " " " " " "  = 3oi3:8 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
57. " " " " " "  = 3oi5:8 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
58. " " " " " "  = 3uxq:8 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
59. " " " " " "  = 3uxr:8 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
60. " " " " " "  = 3v23:8 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
61. " " " " " "  = 3v25:8 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 2nd ribosom asu
62. " " " " " "  = 3v27:8 *
Crystal structure of hpf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
63. " " " " " "  = 3v29:8 *
Crystal structure of hpf bound to the 70s ribosome. This ent contains the 50s subunit of the 2nd molecule in the asu.
64. " " " " " "  = 3v2d:8 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 1st ribosom asu
65. " " " " " "  = 3v2f:8 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 2nd ribosom asu
66. " " " " " "  = 3v6w:8 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit
67. " " " " " "  = 3v6x:8 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit
68. " " " " " "  = 3zn9:8 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
69. " " " " " "  = 3zne:8 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
70. " " " " " "  = 3zvp:8 *
Crystal structure of the hybrid state of ribosome in complex the guanosine triphosphatase release factor 3
71. " " " " " "  = 4abs:8 *
Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin w 70s ribosome
72. " " " " " "  = 4b8g:8 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
73. " " " " " "  = 4b8i:8 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
74. " " " " " "  = 4btd:8 *
Thermus thermophilus ribosome
75. " " " " " "  = 4byc:8 *
Structure of thermus thermophilus 50s ribosome
76. " " " " " "  = 4bye:8 *
Structure of thermus thermophilus 50s ribosome
77. " " " " " "  = 4dha:8 *
Crystal structure of yaej bound to the 70s ribosome
78. " " " " " "  = 4dhc:8 *
Crystal structure of yaej bound to the 70s ribosome
79. " " " " " "  = 4ejb:8 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit.
80. " " " " " "  = 4ejc:8 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit.
81. " " " " " "  = 4kbu:8 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit a. The full asymmetric unit contains PDB entries 4kbt (30s subunit a), 4kbv (30s subuni 4kbw (50s subunit b).
82. " " " " " "  = 4kbw:8 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit b. The full asymmetric unit contains PDB entries 4kbv (30s subunit b), 4kbt (30s subuni 4kbu (50s subunit a).
83. " " " " " "  = 4kcz:8 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state.T contains the 50s ribosomal subunit a. The 30s subunit a can in 4kcy. Molecule b in the same asymmetric unit is deposite (30s) and 4kd2 (50s).G1 50s ribosomal subunit i
84. " " " " " "  = 4kd2:8 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains the 50s ribosomal subunit b. The 30s subunit b can in 4kd0. Molecule a in the same asymmetric unit is deposite (30s) and 4kcz (50s).
85. " " " " " "  = 4kd9:8 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kd8. Molecule b in the same asymmetric uni deposited as 4kda (30s) and 4kdb (50s).
86. " " " " " "  = 4kdb:8 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kda. Molecule a in the same asymmetric uni deposited as 4kd8 (30s) and 4kd9 (50s).
87. " " " " " "  = 4kdh:8 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kdg. Molecule b in the same asymmetric uni deposited as 4kdj (30s) and 4kdk (50s).
88. " " " " " "  = 4kdk:8 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kdj. Molecule a in the same asymmetric uni deposited as 4kdg (30s) and 4kdh (50s).
89. " " " " " "  = 4kx0:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-g on the ribosome
90. " " " " " "  = 4kx2:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-g on the ribosome
91. " " " " " "  = 4qcn:8 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing acylated substrates in the a and p sites. This entry contains the 50 of the first 70s ribosome in the asu.
92. " " " " " "  = 4qcp:8 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing acylated substrates in the a and p sites. This entry contains the 50 of the second 70s ribosome in the asu.
93. " " " " " "  = 4qcr:8 *
Crystal structure of the thermus thermophilus 70s ribosome i post-catalysis state of peptide bond formation containing d tRNA in the a site and deacylated tRNA in the p site. This contains the 50s subunit of the first 70s ribosome in the a
94. " " " " " "  = 4qct:8 *
Crystal structure of the thermus thermophilus 70s ribosome i post-catalysis state of peptide bond formation containing d tRNA in the a site and deacylated tRNA in the p site. This contains the 50s subunit of the second 70s ribosome in the
95. " " " " " "  = 4qcv:8 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-puromycin in the a site and acylated tRNA in site. This entry contains the 50s subunit of the first 70s in the asu.
96. " " " " " "  = 4qcx:8 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-puromycin in the a site and acylated tRNA in site. This entry contains the 50s subunit of the second 70s in the asu.
97. " " " " " "  = 4qcz:8 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-cytidine-puromycin in the a site and acylate the p site. This entry contains the 50s subunit of the firs ribosome in the asu.
98. " " " " " "  = 4qd1:8 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-cytidine-puromycin in the a site and acylate the p site. This entry contains the 50s subunit of the seco ribosome in the asu.
99. 409 100.0% 63 63 562.1 2.5e-24 1vsa:a * Crystal structure of a 70s ribosome-tRNA complex reveals fun interactions and rearrangements. This file, 1vsa, contains ribosome subunit. 30s ribosome subunit is in the file 2ow8
100. " " " " " "  = 1vsp:a *
Interactions and dynamics of the shine-dalgarno helix in the ribosome. This file, 1vsp, contains the 50s ribosome subuni ribosome subunit is in the file 2qnh
101. " " " " " "  = 2xqe:8 *
The structure of ef-tu and aminoacyl-tRNA bound to the 70s ribosome with a gtp analog
102. " " " " " "  = 2xtg:8 *
tRNA tranlocation on the 70s ribosome: the pre- translocational translocation intermediate ti(pre)
103. " " " " " "  = 2xux:8 *
tRNA translocation on the 70s ribosome: the post- translocational translocation intermediate ti(post)
104. " " " " " "  = 2y0v:8 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
105. " " " " " "  = 2y0x:8 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
106. " " " " " "  = 2y0z:8 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
107. " " " " " "  = 2y11:8 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
108. " " " " " "  = 2y13:8 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
109. " " " " " "  = 2y15:8 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a cognate codon on the 70s ribosome.
110. " " " " " "  = 2y17:8 *
Ef-tu complex 3
111. " " " " " "  = 2y19:8 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
112. " " " " " "  = 3d5b:8 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of one 70s ribosome. The enti structure contains two 70s ribosomes as described in remark
113. " " " " " "  = 3d5d:8 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of the second 70s ribosome. T crystal structure contains two 70s ribosomes as described i 400.
114. " " " " " "  = 3f1f:8 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of o ribosome. The entire crystal structure contains two 70s rib described in remark 400.
115. " " " " " "  = 3f1h:8 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of t 70s ribosome. The entire crystal structure contains two 70s as described in remark 400.
116. " " " " " "  = 3hux:8 *
Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule i.
117. " " " " " "  = 3kir:8 *
Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 2 of 4)
118. " " " " " "  = 3kit:8 *
Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 4 of 4)
119. " " " " " "  = 3kiw:8 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 2 of 4)
120. " " " " " "  = 3kiy:8 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 4 of 4)
121. " " " " " "  = 3mrz:5 *
Recognition of the amber stop codon by release factor rf1. T 3mrz contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3ms0. Molecule a in the same asymmetric deposited as 3mr8 (50s) and 3ms1 (30s).
122. " " " " " "  = 3ms1:5 *
Recognition of the amber stop codon by release factor rf1. T 3ms1 contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3mr8. Molecule b in the same asymmetric deposited as 3mrz (50s) and 3ms0 (30s).
123. " " " " " "  = 3pyo:5 *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the first 70s ribosome.
124. " " " " " "  = 3pyr:5 *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the second 70s ribosome.
125. " " " " " "  = 3pyt:5 *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the first 70s ribosome.
126. " " " " " "  = 3pyv:5 *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the second 70s ribosome.
127. " " " " " "  = 4jux:8 *
Crystal structure of the ribosome bound to elongation factor guanosine triphosphatase state (this file contains the 50s
128. " " " " " "  = 4k0m:8 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
129. " " " " " "  = 4k0q:8 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
130. " " " " " "  = 4kfi:8 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the a subunit
131. " " " " " "  = 4kfl:8 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the b subunit
132. " " " " " "  = 4l6j:5 *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the first 70s ribosome.
133. " " " " " "  = 4l6l:5 *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the second 70s ribosome
134. 401 100.0% 62 62 551.5 9.6e-24 3huz:8 Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule ii.
135. 391 100.0% 61 61 538.3 5.3e-23 3tve:8 * Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-leu complex
136. " " " " " "  = 3tvh:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-leu complex
137. " " " " " "  = 3uye:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
138. " " " " " "  = 3uyg:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
139. " " " " " "  = 3uz1:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex with paromomycin
140. " " " " " "  = 3uz2:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-leu complex with paromomycin.
141. " " " " " "  = 4g5l:8 *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule a.
142. " " " " " "  = 4g5n:8 *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule b.
143. " " " " " "  = 4g5u:8 *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule a.
144. " " " " " "  = 4g5w:8 *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule b.
145. 386 100.0% 60 60 531.7 1.2e-22 3uz8:8 * Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-tyr complex.
146. " " " " " "  = 3uz9:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-tyr complex.
147. " " " " " "  = 3uzf:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex
148. " " " " " "  = 3uzh:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex.
149. " " " " " "  = 3uzk:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex with paromomycin
150. " " " " " "  = 3uzn:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex with paromomycin
151. 271 67.7% 62 63 378.2 4.3e-14 1kc9:3 * Crystal structure of the large ribosomal subunit from deinococcus radiodurans
152. " " " " " "  = 1kpj:3 *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
153. " " " " " "  = 1lnr:3 *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
154. " " " " " "  = 1nkw:3 *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
155. " " " " " "  = 1nwx:3 *
Complex of the large ribosomal subunit from deinococcus radiodurans with abt-773
156. " " " " " "  = 1nwy:3 *
Complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin
157. " " " " " "  = 1pnu:3 *
Crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. This file, 1pnu, contains only molecules of the 50s ribosomal subunit. The 30s subunit, mRNA, p-site tRNA, and a-site tRNA are in the PDB file 1pns.
158. " " " " " "  = 1pny:3 *
Crystal structure of the wild type ribosome from e. Coli, 50s subunit of 70s ribosome. This file, 1pny, contains only molecules of the 50s ribosomal subunit. The 30s subunit is in the PDB file 1pnx.
159. " " " " " "  = 1sm1:3 *
Complex of the large ribosomal subunit from deinococcus radi with quinupristin and dalfopristin
160. " " " " " "  = 1vor:5 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
161. " " " " " "  = 1vou:5 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
162. " " " " " "  = 1vow:5 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
163. " " " " " "  = 1voy:5 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
164. " " " " " "  = 1vp0:5 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
165. " " " " " "  = 1vs9:a *
Crystal structure of a 70s ribosome-tRNA complex reveals functional interactions and rearrangements. This file, 1vs9, contains the 50s ribosome subunit. 30s ribosome subunit is in the file 2i1c
166. " " " " " "  = 1xbp:3 *
Inhibition of peptide bond formation by pleuromutilins: the structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with tiamulin
167. " " " " " "  = 1yl3:8 *
Crystal structure of 70s ribosome with thrs operator and trn subunit. The coordinates for the small subunit are in the p 1yl4.
168. " " " " " "  = 2b66:8 *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400
169. " " " " " "  = 2b9n:8 *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400.
170. " " " " " "  = 2b9p:8 *
50s ribosomal subunit from a crystal structure of the riboso complex with trnas and mRNA with a stop codon in the a-site file contains the 50s subunit from a crystal structure of t ribosome in complex with trnas and mRNA with a stop codon i site and is described in remark 400.
171. " " " " " "  = 2zjp:3 *
Thiopeptide antibiotic nosiheptide bound to the large riboso subunit of deinococcus radiodurans
172. " " " " " "  = 2zjq:3 *
Interaction of l7 with l11 induced by microccocin binding to deinococcus radiodurans 50s subunit
173. " " " " " "  = 2zjr:3 *
Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
174. " " " " " "  = 3cf5:3 *
Thiopeptide antibiotic thiostrepton bound to the large ribos subunit of deinococcus radiodurans
175. " " " " " "  = 3dll:3 *
The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
176. " " " " " "  = 4io9:3 *
Crystal structure of compound 4d bound to large ribosomal su (50s) from deinococcus radiodurans
177. " " " " " "  = 4ioa:3 *
Crystal structure of compound 4e bound to large ribosomal su (50s) from deinococcus radiodurans
178. " " " " " "  = 4ioc:3 *
Crystal structure of compound 4f bound to large ribosomal su (50s) from deinococcus radiodurans
179. 242 65.5% 58 59 339.9 5.9e-12 3pio:3 * Crystal structure of the synergistic antibiotic pair lankamy lankacidin in complex with the large ribosomal subunit
180. " " " " " "  = 3pip:3 *
Crystal structure of the synergistic antibiotic pair lankamy lankacidin in complex with the large ribosomal subunit
181. 133 33.9% 62 62 194.4 0.00075 3bbo:5 Homology model for the spinach chloroplast 50s subunit fitte cryo-em map of the 70s chlororibosome
182. 100 33.3% 63 64 150.2 0.22 1vs6:3 * Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
183. " " " " " "  = 1vs8:3 *
Crystal structure of the bacterial ribosome from escherichia complex with the antibiotic kasugamyin at 3.5a resolution. Contains the 50s subunit of one 70s ribosome. The entire cr structure contains two 70s ribosomes and is described in re
184. " " " " " "  = 1vt2:3 *
Crystal structure of the e. Coli ribosome bound to cem-101. Contains the 50s subunit of the second 70s ribosome.
185. " " " " " "  = 2aw4:3 *
Crystal structure of the bacterial ribosome from escherichia 3.5 a resolution. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib is described in remark 400.
186. " " " " " "  = 2awb:3 *
Crystal structure of the bacterial ribosome from escherichia 3.5 a resolution. This file contains the 50s subunit of the 70s ribosome. The entire crystal structure contains two 70s and is described in remark 400.
187. " " " " " "  = 2i2t:3 *
Crystal structure of ribosome with messenger RNA and the anticodon stem-loop of p-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
188. " " " " " "  = 2i2v:3 *
Crystal structure of ribosome with messenger RNA and the anticodon stem-loop of p-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
189. " " " " " "  = 2j28:3 *
Model of e. Coli srp bound to 70s rncs
190. " " " " " "  = 2qam:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with neomycin. This file contains the 50s subunit of the first 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
191. " " " " " "  = 2qao:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with neomycin. This file contains the 50s subunit of the second 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
192. " " " " " "  = 2qba:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin. This file contains the 50s subunit of the first 70s ribosome, with gentamicin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
193. " " " " " "  = 2qbc:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin. This file contains the 50s subunit of the second 70s ribosome, with gentamicin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
194. " " " " " "  = 2qbe:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
195. " " " " " "  = 2qbg:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
196. " " " " " "  = 2qbi:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin and ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with gentamicin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
197. " " " " " "  = 2qbk:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin and ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with gentamicin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
198. " " " " " "  = 2qov:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin. This file contains the 50s subunit of the first 70s ribosome. The entire crystal structure contains two 70s ribosomes.
199. " " " " " "  = 2qox:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin. This file contains the 50s subunit of the second 70s ribosome. The entire crystal structure contains two 70s ribosomes.
200. " " " " " "  = 2qoz:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin and neomycin. This file contains the 50s subunit of the first 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes.
201. " " " " " "  = 2qp1:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin and neomycin. This file contains the 50s subunit of the second 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes.
202. " " " " " "  = 2rdo:3 *
50s subunit with ef-g(gdpnp) and rrf bound
203. " " " " " "  = 2vhm:3 *
Structure of pdf binding helix in complex with the ribosome (part 1 of 4)
204. " " " " " "  = 2vhn:3 *
Structure of pdf binding helix in complex with the ribosome. (Part 2 of 4)
205. " " " " " "  = 2wwq:7 *
E.Coli 70s ribosome stalled during translation of tnac leader peptide. This file contains the 50s, the p-site tRNA and the tnac leader peptide (part 2 of 2).
206. " " " " " "  = 2z4l:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with paromomycin and ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with paromomycin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
207. " " " " " "  = 2z4n:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with paromomycin and ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with paromomycin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
208. " " " " " "  = 3bbx:3 *
The hsp15 protein fitted into the low resolution cryo-em map 50s.Nc-tRNA.Hsp15 complex
209. " " " " " "  = 3df2:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with hygromycin b. This file contains the 50s subunit of the first 70s ribosome. The entire crystal structure contains two 70s ribosomes.
210. " " " " " "  = 3df4:3 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with hygromycin b. This file contains the 50s subunit of the second 70s ribosome. The entire crystal structure contains two 70s ribosomes.
211. " " " " " "  = 3e1b:W *
Structure of the 50s subunit of e. Coli ribosome in pre-acco state
212. " " " " " "  = 3e1d:W *
Structure of the 50s subunit of e. Coli ribosome in post-acc state
213. " " " " " "  = 3fik:3 *
Ternary complex-bound e.Coli 70s ribosome. This entry consis 50s subunit.
214. " " " " " "  = 3i1n:3 *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
215. " " " " " "  = 3i1p:3 *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
216. " " " " " "  = 3i1r:3 *
Crystal structure of the e. Coli 70s ribosome in an intermed of ratcheting
217. " " " " " "  = 3i1t:3 *
Crystal structure of the e. Coli 70s ribosome in an intermed of ratcheting
218. " " " " " "  = 3i20:3 *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
219. " " " " " "  = 3i22:3 *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
220. " " " " " "  = 3izt:f *
Structural insights into cognate vs. Near-cognate discrimina during decoding. This entry contains the large subunit of a programmed with a near-cognate codon.
221. " " " " " "  = 3izu:f *
Structural insights into cognate vs. Near-cognate discrimina during decoding. This entry contains the large subunit of a programmed with a cognate codon
222. " " " " " "  = 3j01:3 *
Structure of the ribosome-secye complex in the membrane envi
223. " " " " " "  = 3j0t:6 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class2 of the six classes)
224. " " " " " "  = 3j0w:6 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 4a of the six classes)
225. " " " " " "  = 3j0y:6 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 4b of the six classes)
226. " " " " " "  = 3j11:6 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 3 of the six classes)
227. " " " " " "  = 3j12:6 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 5 of the six classes)
228. " " " " " "  = 3j14:6 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 6 of the six classes)
229. " " " " " "  = 3j19:3 *
Structure of the bacterial ribosome complexed by tmrna-smpb during translocation and mld-loading (50s subunit)
230. " " " " " "  = 3j37:8 *
Tetracycline resistance protein tet(o) bound to the ribosome
231. " " " " " "  = 3j4x:3 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic pre- translocation state (pre1b, 50s subunit)
232. " " " " " "  = 3j50:3 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (pre2, 50s subunit)
233. " " " " " "  = 3j51:3 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (pre3, 50s subunit)
234. " " " " " "  = 3j52:3 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic pre- translocation state (pre1a, 50s subunit)
235. " " " " " "  = 3j54:3 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre4, 50s subunit)
236. " " " " " "  = 3j56:3 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre5a, 50s subunit)
237. " " " " " "  = 3j58:3 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre5b, 50s subunit)
238. " " " " " "  = 3j5a:3 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic post translocation state (post1, 50s subunit)
239. " " " " " "  = 3j5c:3 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post2a, 50s subunit)
240. " " " " " "  = 3j5e:3 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post2b, 50s subunit)
241. " " " " " "  = 3j5g:3 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post3a, 50s subunit)
242. " " " " " "  = 3j5i:3 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post3b, 50s subunit)
243. " " " " " "  = 3j5k:3 *
E. Coli 70s-fmetval-trnaval post-translocation complex (post subunit)
244. " " " " " "  = 3j5o:3 *
Visualization of two trnas trapped in transit during ef-g-me translocation (50s subunit)
245. " " " " " "  = 3j5u:6 *
Structure of the ribosome with elongation factor g trapped i translocation state (pre-translocation 70s tRNA structure, subunit)
246. " " " " " "  = 3j5w:7 *
Structure of the ribosome with elongation factor g trapped i translocation state (pre-translocation 70s tRNA Ef-g struct subunit)
247. " " " " " "  = 3kcr:3 *
Ribosome-secy complex. This entry 3kcr contains 50s ribosomal subnit. The 30s ribosomal subunit can be found in PDB entry 3kc4
248. " " " " " "  = 3oas:3 *
Crystal structure of the e. Coli ribosome bound to telithrom file contains the 50s subunit of the second 70s ribosome.
249. " " " " " "  = 3oat:3 *
Crystal structure of the e. Coli ribosome bound to telithrom file contains the 50s subunit of the first 70s ribosome wit telithromycin bound.
250. " " " " " "  = 3ofc:3 *
Crystal structure of the e. Coli ribosome bound to chloramph this file contains the 50s subunit of the first 70s ribosom chloramphenicol bound.
251. " " " " " "  = 3ofd:3 *
Crystal structure of the e. Coli ribosome bound to chloramph this file contains the 50s subunit of the second 70s riboso
252. " " " " " "  = 3ofq:3 *
Crystal structure of the e. Coli ribosome bound to erythromy file contains the 50s subunit of the second 70s ribosome.
253. " " " " " "  = 3ofr:3 *
Crystal structure of the e. Coli ribosome bound to erythromy file contains the 50s subunit of the first 70s ribosome wit erthromycin bound.
254. " " " " " "  = 3ofz:3 *
Crystal structure of the e. Coli ribosome bound to clindamyc file contains the 50s subunit of the first 70s ribosome bou clindamycin.
255. " " " " " "  = 3og0:3 *
Crystal structure of the e. Coli ribosome bound to clindamyc file contains the 50s subunit of the second 70s ribosome.
256. " " " " " "  = 3orb:3 *
Crystal structure of the e. Coli ribosome bound to cem-101. Contains the 50s subunit of the first 70s ribosome bound to
257. " " " " " "  = 3r8s:3 *
Structures of the bacterial ribosome in classical and hybrid tRNA binding
258. " " " " " "  = 3r8t:3 *
Structures of the bacterial ribosome in classical and hybrid tRNA binding
259. " " " " " "  = 3sgf:7 *
Crystal structure of release factor rf3 trapped in the gtp s rotated conformation of the ribosome
260. " " " " " "  = 3uos:7 *
Crystal structure of release factor rf3 trapped in the gtp s rotated conformation of the ribosome (without viomycin)
261. " " " " " "  = 4gar:3 *
Allosteric control of the ribosome by small-molecule antibio
262. " " " " " "  = 4gau:3 *
Allosteric control of the ribosome by small-molecule antibio
263. " " " " " "  = 4kix:3 *
Control of ribosomal subunit rotation by elongation factor g
264. " " " " " "  = 4kiz:3 *
Control of ribosomal subunit rotation by elongation factor g
265. " " " " " "  = 4kj1:3 *
Control of ribosomal subunit rotation by elongation factor g
266. " " " " " "  = 4kj3:3 *
Control of ribosomal subunit rotation by elongation factor g
267. " " " " " "  = 4kj5:3 *
Control of ribosomal subunit rotation by elongation factor g
268. " " " " " "  = 4kj7:3 *
Control of ribosomal subunit rotation by elongation factor g
269. " " " " " "  = 4kj9:3 *
Control of ribosomal subunit rotation by elongation factor g
270. " " " " " "  = 4kjb:3 *
Control of ribosomal subunit rotation by elongation factor g
271. " " " " " "  = 4peb:3 *
Crystal structure of the e. Coli ribosome bound to quinupris file contains the 50s subunit of the first 70s ribosome wit quinupristin bound.
272. " " " " " "  = 4pec:3 *
Crystal structure of the e. Coli ribosome bound to quinupris file contains the 50s subunit of the second 70s ribosome wi quinupristin bound.
273. " " " " " "  = 4tom:3 *
Crystal structure of the e. Coli ribosome bound to linoprist file contains the 50s subunit of the first 70s ribosome wit linopristin bound.
274. " " " " " "  = 4too:3 *
Crystal structure of the e. Coli ribosome bound to linoprist file contains the 50s subunit of the second 70s ribosome wi linopristin bound.
275. " " " " " "  = 4tov:3 *
Crystal structure of the e. Coli ribosome bound to flopristi file contains the 50s subunit of the first 70s ribosome wit flopristin bound.
276. " " " " " "  = 4tox:3 *
Crystal structure of the e. Coli ribosome bound to flopristi file contains the 50s subunit of the second 70s ribosome wi flopristin bound.
277. " " " " " "  = 4tp1:3 *
Crystal structure of the e. Coli ribosome bound to dalfopris file contains the 50s subunit of the first 70s ribosome wit dalfopristin bound.
278. " " " " " "  = 4tp3:3 *
Crystal structure of the e. Coli ribosome bound to dalfopris file contains the 50s subunit of the second 70s ribosome wi dalfopristin bound.
279. " " " " " "  = 4tp5:3 *
Crystal structure of the e. Coli ribosome bound to virginiam this file contains the 50s subunit of the first 70s ribosom virginiamycin m1 bound.
280. " " " " " "  = 4tp7:3 *
Crystal structure of the e. Coli ribosome bound to virginiam this file contains the 50s subunit of the second 70s riboso virginiamycin m1 bound.
281. " " " " " "  = 4tp9:3 *
Crystal structure of the e. Coli ribosome bound to dalfopris quinupristin. This file contains the 50s subunit of the fir ribosome with dalfopristin and quinupristin bound.
282. " " " " " "  = 4tpb:3 *
Crystal structure of the e. Coli ribosome bound to dalfopris quinupristin. This file contains the 50s subunit of the sec ribosome with dalfopristin and quinupristin bound.
283. " " " " " "  = 4tpd:3 *
Crystal structure of the e. Coli ribosome bound to flopristi linopristin. This file contains the 50s subunit of the firs ribosome with flopristin and linopristin bound.
284. " " " " " "  = 4tpf:3 *
Crystal structure of the e. Coli ribosome bound to flopristi linopristin. This file contains the 50s subunit of the seco ribosome with flopristin and linopristin bound.
285. 92 36.2% 58 325 130.9 2.6 2mdh:B Oxidoreductase(NAD(a)-choh(d))
286. 81 26.8% 56 94 122.9 7.2 1pd6:A The nmr structure of domain c2 of human cardiac myosin binding protein c
287. 76 28.1% 57 92 116.3 17 2yxm:A Crystal structure of i-set domain of human myosin binding proteinc
288. 76 28.1% 57 100 115.9 18 2yuv:A Solution structure of 2nd immunoglobulin domain of slow type myosin-binding protein c
289. 78 50.0% 28 223 114.2 22 4f3p:A Crystal structure of a glutamine-binding periplasmic protein burkholderia pseudomallei in complex with glutamine
290. 78 35.0% 40 350 111.8 30 2ra8:A Crystal structure of the q64v53_bacfr protein from bacteroid fragilis. Northeast structural genomics consortium target b
291. 73 34.9% 43 113 111.2 32 2zkr:6 Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
292. 75 38.8% 49 208 110.6 35 4dok:A Crystal structure of arabidopsis thaliana chalcone-isomerase protein at5g05270 (atchil)
293. 74 37.1% 35 179 110.1 37 2z2i:A Crystal structure of peptidyl-tRNA hydrolase from mycobacter tuberculosis
294. 74 37.1% 35 180 110.0 37 2z2j:A * Crystal structure of peptidyl-tRNA hydrolase from mycobacter tuberculosis
295. " " " " " "  = 2z2k:A *
Crystal structure of peptidyl-tRNA hydrolase from mycobacter tuberculosis

Number of sequences: 295

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 74 37.1% 35 182 110.0 38 3tcn:A Crystal structures of peptidyl-tRNA hydrolase from mycobacte tuberculosis - form 2 grown in presence of pentaglycine
2. 74 37.1% 35 184 109.9 38 3td6:A Peptidyl-tRNA hydrolase from mycobacterium tuberculosis from partially dehydrated crystal
3. 74 37.1% 35 188 109.8 39 3tck:A Crystal structure of peptidyl-tRNA hydrolase from mycobacter tuberculosis - form 4
4. 74 37.1% 35 187 109.8 38 3td2:A Crystal structures of peptidyl-tRNA hydrolase from mycobacte tuberculosis - form 5
5. 74 37.1% 35 191 109.7 39 2jrc:A Solution structure of peptidyl-tRNA hydrolase from mycobacterium tuberculosis h37rv.
6. 70 32.6% 46 75 109.4 41 1wnr:A Crystal structure of the cpn10 from thermus thermophilus hb8
7. 70 38.6% 44 98 108.0 49 1ts9:A Crystal structure of the archaeal homolog of human rnase p protein rpp29 from archaeoglobus fulgidus

Number of sequences: 7

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer