spacer
spacer

SAS results for UniProt accession no. P20435

Sequence annotated by structure

Key:
Sec. struc: By homology Predicted
  Helix Strand   Helix Strand
PROSITE patterns: Low   High conservation

Predicted secondary structure (green) comes from the DSC program. The lighter the green the less certain the prediction. Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P20435 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P20435 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 28 unique sequences (including 10 consensus sequences) giving 132 sequence matches in all. The 9 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P20435 -----------------------------------------------------------------    DNA-directed RNA polymerases I, II, and III subunit RPABC2  ...
4c2m:F*-----------------------------------------------------------------×4  Structure of RNA polymerase i at 2.8 a resolution
2nvx:F*-----------------------------------------------------------------×5  RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2ja5:F*-----------------------------------------------------------------×17 Cpd lesion containing RNA polymerase ii elongation complex a
2e2i:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2e2j:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with  ...
2nvq:F*-----------------------------------------------------------------×20 RNA polymerase ii elongation complex in 150 mm mg+2 with  ...
1i3q:F*-----------------------------------------------------------------×50 RNA polymerase ii crystal form i at 3.1 a resolution
1twa:F*-----------------------------------------------------------------×6  RNA polymerase ii complexed with atp
3h0g:F -----------------------------------------------------------------    RNA polymerase ii from schizosaccharomyces pombe
1qkl:A -----------------------------------------------------------------    Hrpabc14.4, essential subunit of human RNA polymerases i,  ...
2y0s:I -----------------------------------------------------------------    Crystal structure of sulfolobus shibatae RNA polymerase in  ...
4ayb:K*-----------------------------------------------------------------×3  Rnap at 3.2ang
2pmz:K*-----------------------------------------------------------------×4  Archaeal RNA polymerase from sulfolobus solfataricus
1i2d:A -anaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmnqadyd    Crystal structure of atp sulfurylase from penicillium  ...
1m8p:A manaphggvlkdllardaprqaelaaeaeslpavtlterqlcdlelimnggfsplegfmnqadyd    Crystal structure of p. Chrysogenum atp sulfurylase in the t
3iz5:X*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
1zty:A --------rseltivpdfyptmvrnfnpylatnlrtttdfiyeplvvfnemkgntpvfrlaesyk    Crystal structure of the chitin oligasaccharide binding  ...
1zu0:A --------rseltivpdfyptmvrnfnpylatnlrtttdfiyeplvvfnemkgntpvfrlaesyk    Crystal structure of the liganded chitin oligasaccharide  ...
4gf8:A --------rseltivpdfyptmvrnfnpylatnlrtttdfiyeplvvfnemkgntpvfrlaesyk    Crystal structure of the chitin oligasaccharide binding prot
4gfr:A --------rseltivpdfyptmvrnfnpylatnlrtttdfiyeplvvfnemkgntpvfrlaesyk    Crystal structure of the liganded chitin oligasaccharide  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P20435 -----------------------------------------------------------------    DNA-directed RNA polymerases I, II, and III subunit RPABC2  ...
4c2m:F*-----------------------------------------------------------------×4  Structure of RNA polymerase i at 2.8 a resolution
2nvx:F*-----------------------------------------------------------------×5  RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2ja5:F*-----------------------------------------------------------------×17 Cpd lesion containing RNA polymerase ii elongation complex a
2e2i:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2e2j:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with  ...
2nvq:F*-----------------------------------------------------------------×20 RNA polymerase ii elongation complex in 150 mm mg+2 with  ...
1i3q:F*-----------------------------------------------------------------×50 RNA polymerase ii crystal form i at 3.1 a resolution
1twa:F*-----------------------------------------------------------------×6  RNA polymerase ii complexed with atp
3h0g:F -----------------------------------------------------------------    RNA polymerase ii from schizosaccharomyces pombe
1qkl:A -----------------------------------------------------------------    Hrpabc14.4, essential subunit of human RNA polymerases i,  ...
2y0s:I -----------------------------------------------------------------    Crystal structure of sulfolobus shibatae RNA polymerase in  ...
4ayb:K*-----------------------------------------------------------------×3  Rnap at 3.2ang
2pmz:K*-----------------------------------------------------------------×4  Archaeal RNA polymerase from sulfolobus solfataricus
1i2d:A rvcednrladgnvfsmpitldasqevidekklqagsritlrdfrddrnlailtiddiyrpdktke    Crystal structure of atp sulfurylase from penicillium  ...
1m8p:A rvcednrladgnvfsmpitldasqevidekklqaasritlrdfrddrnlailtiddiyrpdktke    Crystal structure of p. Chrysogenum atp sulfurylase in the t
3iz5:X*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
1zty:A maddlmsvtfdirkgvkwsdgeaftaddvvysfgllkakpeldqrginkwvtsvekvdeykvrfr    Crystal structure of the chitin oligasaccharide binding  ...
1zu0:A maddlmsvtfdirkgvkwsdgeaftaddvvysfgllkakpeldqrginkwvtsvekvdeykvrfr    Crystal structure of the liganded chitin oligasaccharide  ...
4gf8:A maddlmsvtfdirkgvkwsdgeaftaddvvysfgllkakpeldqrginkwvtsvekvdeykvrfr    Crystal structure of the chitin oligasaccharide binding prot
4gfr:A maddlmsvtfdirkgvkwsdgeaftaddvvysfgllkakpeldqrginkwvtsvekvdeykvrfr    Crystal structure of the liganded chitin oligasaccharide  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P20435 -----------------------------------------------------------------    DNA-directed RNA polymerases I, II, and III subunit RPABC2  ...
4c2m:F*-----------------------------------------------------------------×4  Structure of RNA polymerase i at 2.8 a resolution
2nvx:F*-----------------------------------------------------------------×5  RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2ja5:F*-----------------------------------------------------------------×17 Cpd lesion containing RNA polymerase ii elongation complex a
2e2i:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2e2j:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with  ...
2nvq:F*-----------------------------------------------------------------×20 RNA polymerase ii elongation complex in 150 mm mg+2 with  ...
1i3q:F*-----------------------------------------------------------------×50 RNA polymerase ii crystal form i at 3.1 a resolution
1twa:F*-----------------------------------------------------------------×6  RNA polymerase ii complexed with atp
3h0g:F -----------------------------------------------------------------    RNA polymerase ii from schizosaccharomyces pombe
1qkl:A -----------------------------------------------------------------    Hrpabc14.4, essential subunit of human RNA polymerases i,  ...
2y0s:I -----------------------------------------------------------------    Crystal structure of sulfolobus shibatae RNA polymerase in  ...
4ayb:K*-----------------------------------------------------------------×3  Rnap at 3.2ang
2pmz:K*-----------------------------------------------------------------×4  Archaeal RNA polymerase from sulfolobus solfataricus
1i2d:A aklvfggdpehpaivylnntvkefyiggkieavnklnhydyvalrytpaelrvhfdklgwsrvva    Crystal structure of atp sulfurylase from penicillium  ...
1m8p:A aklvfggdpehpaivylnntvkefyiggkieavnklnhydyvalrytpaelrvhfdklgwsrvva    Crystal structure of p. Chrysogenum atp sulfurylase in the t
3iz5:X*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
1zty:A lseansnvpyeislipivaehvwkdvkdpttftnenpvgtgpftvidtftpqlyiqcrnpnywda    Crystal structure of the chitin oligasaccharide binding  ...
1zu0:A lseansnvpyeislipivaehvwkdvkdpttftnenpvgtgpftvidtftpqlyiqcrnpnywda    Crystal structure of the liganded chitin oligasaccharide  ...
4gf8:A lseansnvpyeislipivaehvwkdvkdpttftnenpvgtgpftvidtftpqlyiqcrnpnywda    Crystal structure of the chitin oligasaccharide binding prot
4gfr:A lseansnvpyeislipivaehvwkdvkdpttftnenpvgtgpftvidtftpqlyiqcrnpnywda    Crystal structure of the liganded chitin oligasaccharide  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P20435 -----------------------------------------------------------------    DNA-directed RNA polymerases I, II, and III subunit RPABC2  ...
4c2m:F*-----------------------------------------------------------------×4  Structure of RNA polymerase i at 2.8 a resolution
2nvx:F*-----------------------------------------------------------------×5  RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2ja5:F*-----------------------------------------------------------------×17 Cpd lesion containing RNA polymerase ii elongation complex a
2e2i:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2e2j:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with  ...
2nvq:F*-----------------------------------------------------------------×20 RNA polymerase ii elongation complex in 150 mm mg+2 with  ...
1i3q:F*-----------------------------------------------------------------×50 RNA polymerase ii crystal form i at 3.1 a resolution
1twa:F*-----------------------------------------------------------------×6  RNA polymerase ii complexed with atp
3h0g:F -----------------------------------------------------------------    RNA polymerase ii from schizosaccharomyces pombe
1qkl:A -----------------------------------------------------------------    Hrpabc14.4, essential subunit of human RNA polymerases i,  ...
2y0s:I -----------------------------------------------------------------    Crystal structure of sulfolobus shibatae RNA polymerase in  ...
4ayb:K*-----------------------------------------------------------------×3  Rnap at 3.2ang
2pmz:K*-----------------------------------------------------------------×4  Archaeal RNA polymerase from sulfolobus solfataricus
1i2d:A fqtrnpmhrahreltvraarsrqanvlihpvvgltkpgdidhftrvrayqallprypngmavlgl    Crystal structure of atp sulfurylase from penicillium  ...
1m8p:A fqtrnpmhrahreltvraarsrqanvlihpvvgltkpgdidhftrvrayqallprypngmavlgl    Crystal structure of p. Chrysogenum atp sulfurylase in the t
3iz5:X*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
1zty:A anlevdclrvpqianndqllgkivnseldwtssfvpdidrtyaaanpnhhywypaagtqafmvnf    Crystal structure of the chitin oligasaccharide binding  ...
1zu0:A anlevdclrvpqianndqllgkivnseldwtssfvpdidrtyaaanpnhhywypaagtqafmvnf    Crystal structure of the liganded chitin oligasaccharide  ...
4gf8:A anlevdclrvpqianndqllgkivnseldwtssfvpdidrtyaaanpnhhywypaagtqafmvnf    Crystal structure of the chitin oligasaccharide binding prot
4gfr:A anlevdclrvpqianndqllgkivnseldwtssfvpdidrtyaaanpnhhywypaagtqafmvnf    Crystal structure of the liganded chitin oligasaccharide  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P20435 ---------------------------------------------------msdyeeafnd--gn    DNA-directed RNA polymerases I, II, and III subunit RPABC2  ...
4c2m:F*-----------------------------------------------------------------×4  Structure of RNA polymerase i at 2.8 a resolution
2nvx:F*-----------------------------------------------------------------×5  RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2ja5:F*-----------------------------------------------------------------×17 Cpd lesion containing RNA polymerase ii elongation complex a
2e2i:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2e2j:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with  ...
2nvq:F*-----------------------------------------------------------------×20 RNA polymerase ii elongation complex in 150 mm mg+2 with  ...
1i3q:F*-----------------------------------------------------------------×50 RNA polymerase ii crystal form i at 3.1 a resolution
1twa:F*-----------------------------------------------------------------×6  RNA polymerase ii complexed with atp
3h0g:F -----------------------------------------------------------------    RNA polymerase ii from schizosaccharomyces pombe
1qkl:A ---------------------------------------------------------------ms    Hrpabc14.4, essential subunit of human RNA polymerases i,  ...
2y0s:I -----------------------------------------------------------------    Crystal structure of sulfolobus shibatae RNA polymerase in  ...
4ayb:K*-----------------------------------------------------------------×3  Rnap at 3.2ang
2pmz:K*-----------------------------------------------------------------×4  Archaeal RNA polymerase from sulfolobus solfataricus
1i2d:A lglamrmggpreaiwhaiirknhgathfivgrdhagpgsnskgedfygpydaqhavekykdelgi    Crystal structure of atp sulfurylase from penicillium  ...
1m8p:A lglamrmggpreaiwhaiirknhgathfivgrdhagpgsnskgedfygpydaqhavekykdelgi    Crystal structure of p. Chrysogenum atp sulfurylase in the t
3iz5:X*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
1zty:A knpdpakkealdnvdfrrafsmaldrqtiidiafygsgtvndfasglgyafeawsdeathk--ky    Crystal structure of the chitin oligasaccharide binding  ...
1zu0:A knpdpakkealdnvdfrrafsmaldrqtiidiafygsgtvndfasglgyafeawsdeathk--ky    Crystal structure of the liganded chitin oligasaccharide  ...
4gf8:A knpdpakkealdnvdfrrafsmaldrqtiidiafygsgtvndfasglgyafeawsdeathk--ky    Crystal structure of the chitin oligasaccharide binding prot
4gfr:A knpdpakkealdnvdfrrafsmaldrqtiidiafygsgtvndfasglgyafeawsdeathk--ky    Crystal structure of the liganded chitin oligasaccharide  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P20435 enfedfdvehfsdeetyeekpqfkd----g-ettdang----kt---ivtggngpedfqqheqir    DNA-directed RNA polymerases I, II, and III subunit RPABC2  ...
4c2m:F*------------------------------------------------------pedfqqheqir×4  Structure of RNA polymerase i at 2.8 a resolution
2nvx:F*-----------------------------------------------------------------×5  RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2ja5:F*-----------------------------------------------------------------×17 Cpd lesion containing RNA polymerase ii elongation complex a
2e2i:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2e2j:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with  ...
2nvq:F*-----------------------------------------------------------------×20 RNA polymerase ii elongation complex in 150 mm mg+2 with  ...
1i3q:F*-----------------------------------------------------------------×50 RNA polymerase ii crystal form i at 3.1 a resolution
1twa:F*-----------------------------------------------------------------×6  RNA polymerase ii complexed with atp
3h0g:F -----------------------------------------------------------------    RNA polymerase ii from schizosaccharomyces pombe
1qkl:A dnednfdgddfddveedeglddlen----a-eeegqen----ve---ilpsgerpqanqk-----    Hrpabc14.4, essential subunit of human RNA polymerases i,  ...
2y0s:I -----------------------------------------------------------------    Crystal structure of sulfolobus shibatae RNA polymerase in  ...
4ayb:K*-----------------------------------------------------------------×3  Rnap at 3.2ang
2pmz:K*-----------------------------------------------------------------×4  Archaeal RNA polymerase from sulfolobus solfataricus
1i2d:A evvefqmvtylpdtdeyrpvdqvpa----gvktlnisgtelrrr---lrsgahipewfsypevv-    Crystal structure of atp sulfurylase from penicillium  ...
1m8p:A evvefqmvtylpdtdeyrpvdqvpa----gvktlnisgtelrrr---lrsgahipewfsypevv-    Crystal structure of p. Chrysogenum atp sulfurylase in the t
3iz5:X*---------------------------------------------------rkskkirtsvtfhr×3  Localization of the large subunit ribosomal proteins into a  ...
1zty:A kgfntydve---gskkllakagfkdvngdg-fvetpsg----ksfelliqspngwtdfnntvqla    Crystal structure of the chitin oligasaccharide binding  ...
1zu0:A kgfntydve---gskkllakagfkdvngdg-fvetpsg----ksfelliqspngwtdfnntvqla    Crystal structure of the liganded chitin oligasaccharide  ...
4gf8:A kgfntydve---gskkllakagfkdvngdg-fvetpsg----ksfelliqspngwtdfnntvqla    Crystal structure of the chitin oligasaccharide binding prot
4gfr:A kgfntydve---gskkllakagfkdvngdg-fvetpsg----ksfelliqspngwtdfnntvqla    Crystal structure of the liganded chitin oligasaccharide  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P20435 rktlkekaipkdqrattpymtky-erarilg----tralqism---napvf-vdleg--etdplr    DNA-directed RNA polymerases I, II, and III subunit RPABC2  ...
4c2m:F*rktlkekaipkdqrattpymtky-erarilg----tralqism---napvf-vdleg--etdplr×4  Structure of RNA polymerase i at 2.8 a resolution
2nvx:F*--tlkekaipkdqrattpymtky-erarilg----tralqism---napvf-vdleg--etdplr×5  RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2ja5:F*---lkekaipkdqrattpymtky-erarilg----tralqism---napvf-vdleg--etdplr×17 Cpd lesion containing RNA polymerase ii elongation complex a
2e2i:F ----kekaipkdqrattpymtky-erarilg----tralqism---napvf-vdleg--etdplr    RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2e2j:F ---lkekaipkdqrattpymtky-erarilg----tralqism---napvf-vdleg--etdplr    RNA polymerase ii elongation complex in 5 mm mg+2 with  ...
2nvq:F*-----ekaipkdqrattpymtky-erarilg----tralqism---napvf-vdleg--etdplr×20 RNA polymerase ii elongation complex in 150 mm mg+2 with  ...
1i3q:F*------kaipkdqrattpymtky-erarilg----tralqism---napvf-vdleg--etdplr×50 RNA polymerase ii crystal form i at 3.1 a resolution
1twa:F*------kaipkdqrattpymtky-erarilg----tralqism---napvf-vdleg--etdplr×6  RNA polymerase ii complexed with atp
3h0g:F ----sgkavakedrtttpymtky-erarilg----tralqism---napvl-vdleg--etdplq    RNA polymerase ii from schizosaccharomyces pombe
1qkl:A -------------rittpymtky-erarvlg----tralqiam---capvm-veleg--etdpll    Hrpabc14.4, essential subunit of human RNA polymerases i,  ...
2y0s:I ---qdlhfnevfvslwqnkltry-eiarvis----aralqlam---gapal-idinnisstdvis    Crystal structure of sulfolobus shibatae RNA polymerase in  ...
4ayb:K*---qdlhfnevfvslwqnkltry-eiarvis----aralqlam---gapal-idinnisstdvis×3  Rnap at 3.2ang
2pmz:K*---qdlhfnevfislwqnrltry-eiarvis----aralqlam---gapal-idinnlsstdvis×4  Archaeal RNA polymerase from sulfolobus solfataricus
1i2d:A -kilresnppratqgftifltgymnsgkdai----aralqvtl---nqqgg-rsvsl--llgdtv    Crystal structure of atp sulfurylase from penicillium  ...
1m8p:A -kilresnppratqgftifltgymnsgkdai----aralqvtl---nqqgg-rsvsl--llgdtv    Crystal structure of p. Chrysogenum atp sulfurylase in the t
3iz5:X*pktlkkardpkyprvsapgrnkl-dqyqilkyplttesamkkiednntlvfivdlka--dkkkik×3  Localization of the large subunit ribosomal proteins into a  ...
1zty:A veqlqevgika--kartpefavy-nqamleg----tydvaytn---yfhga-dpfty--wnsgyn    Crystal structure of the chitin oligasaccharide binding  ...
1zu0:A veqlqevgika--kartpefavy-nqamleg----tydvaytn---yfhga-dpfty--wnsgyn    Crystal structure of the liganded chitin oligasaccharide  ...
4gf8:A veqlqevgika--kartpefavy-nqamleg----tydvaytn---yfhga-dpfty--wnsgyn    Crystal structure of the chitin oligasaccharide binding prot
4gfr:A veqlqevgika--kartpefavy-nqamleg----tydvaytn---yfhga-dpfty--wnsgyn    Crystal structure of the liganded chitin oligasaccharide  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P20435 iamkelae---kkiplvirrylpdgsfedwsveelivdl--------------------------    DNA-directed RNA polymerases I, II, and III subunit RPABC2  ...
4c2m:F*iamkelae---kkiplvirrylpdgsfedwsveelivd---------------------------×4  Structure of RNA polymerase i at 2.8 a resolution
2nvx:F*iamkelae---kkiplvirrylpdgsfedwsveelivdl--------------------------×5  RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2ja5:F*iamkelae---kkiplvirrylpdgsfedwsveelivdl--------------------------×17 Cpd lesion containing RNA polymerase ii elongation complex a
2e2i:F iamkelae---kkiplvirrylpdgsfedwsveelivdl--------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2e2j:F iamkelae---kkiplvirrylpdgsfedwsveelivd---------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with  ...
2nvq:F*iamkelae---kkiplvirrylpdgsfedwsveelivdl--------------------------×20 RNA polymerase ii elongation complex in 150 mm mg+2 with  ...
1i3q:F*iamkelae---kkiplvirrylpdgsfedwsveelivdl--------------------------×50 RNA polymerase ii crystal form i at 3.1 a resolution
1twa:F*iamkelae---kkiplvirrylpdgsfedwsveelivd---------------------------×6  RNA polymerase ii complexed with atp
3h0g:F iamkelaq---kkipllvrrylpdgsyedwsvaeli-----------------------------    RNA polymerase ii from schizosaccharomyces pombe
1qkl:A iamkelka---rkipiiirrylpdgsyedwgvdeliitd--------------------------    Hrpabc14.4, essential subunit of human RNA polymerases i,  ...
2y0s:I iaeeefkr---gvlpitirrrlpngkiillsl---------------------------------    Crystal structure of sulfolobus shibatae RNA polymerase in  ...
4ayb:K*iaeeefkr---gvlpitirrrlpngkiillslrk-------------------------------×3  Rnap at 3.2ang
2pmz:K*iaeeefrr---gvlpitirrrlpngkiillsl---------------------------------×4  Archaeal RNA polymerase from sulfolobus solfataricus
1i2d:A rhelssel---gftredrhtniqriafvateltragaaviaapiapyeesrkfardavsqagsff    Crystal structure of atp sulfurylase from penicillium  ...
1m8p:A rhelssel---gftredrhtniqriafvateltragaaviaapiapyeesrkfardavsqagsff    Crystal structure of p. Chrysogenum atp sulfurylase in the t
3iz5:X*aavkkmydiqakkvntlir---pdgkkkayvkltpdydaldvankigii----------------×3  Localization of the large subunit ribosomal proteins into a  ...
1zty:A salqsgdg---mprfamhyftdkkldglldsfyktadkneqlaiahgiqkiiaenqvtipvmsga    Crystal structure of the chitin oligasaccharide binding  ...
1zu0:A salqsgdg---mprfamhyftdkkldglldsfyktadkneqlaiahgiqkiiaenqvtipvmsga    Crystal structure of the liganded chitin oligasaccharide  ...
4gf8:A salqsgdg---mprfamhyftdkkldglldsfyktadkneqlaiahgiqkiiaenqvtipvmsga    Crystal structure of the chitin oligasaccharide binding prot
4gfr:A salqsgdg---mprfamhyftdkkldglldsfyktadkneqlaiahgiqkiiaenqvtipvmsga    Crystal structure of the liganded chitin oligasaccharide  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P20435 -----------------------------------------------------------------    DNA-directed RNA polymerases I, II, and III subunit RPABC2  ...
4c2m:F*-----------------------------------------------------------------×4  Structure of RNA polymerase i at 2.8 a resolution
2nvx:F*-----------------------------------------------------------------×5  RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2ja5:F*-----------------------------------------------------------------×17 Cpd lesion containing RNA polymerase ii elongation complex a
2e2i:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2e2j:F -----------------------------------------------------------------    RNA polymerase ii elongation complex in 5 mm mg+2 with  ...
2nvq:F*-----------------------------------------------------------------×20 RNA polymerase ii elongation complex in 150 mm mg+2 with  ...
1i3q:F*-----------------------------------------------------------------×50 RNA polymerase ii crystal form i at 3.1 a resolution
1twa:F*-----------------------------------------------------------------×6  RNA polymerase ii complexed with atp
3h0g:F -----------------------------------------------------------------    RNA polymerase ii from schizosaccharomyces pombe
1qkl:A -----------------------------------------------------------------    Hrpabc14.4, essential subunit of human RNA polymerases i,  ...
2y0s:I -----------------------------------------------------------------    Crystal structure of sulfolobus shibatae RNA polymerase in  ...
4ayb:K*-----------------------------------------------------------------×3  Rnap at 3.2ang
2pmz:K*-----------------------------------------------------------------×4  Archaeal RNA polymerase from sulfolobus solfataricus
1i2d:A lvhvatplehceqsdkrgiyaaarrgeikgftgvddpyetpekadlvvdfskqsvrsivheiilv    Crystal structure of atp sulfurylase from penicillium  ...
1m8p:A lvhvatplehceqsdkrgiyaaarrgeikgftgvddpyetpekadlvvdfskqsvrsivheiilv    Crystal structure of p. Chrysogenum atp sulfurylase in the t
3iz5:X*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
1zty:A wmyqynttrftgwwseenpkgrpsvwagiperllhvldlkpv-----------------------    Crystal structure of the chitin oligasaccharide binding  ...
1zu0:A wmyqynttrftgwwseenpkgrpsvwagiperllhvldlkpvk----------------------    Crystal structure of the liganded chitin oligasaccharide  ...
4gf8:A wmyqynttrftgwwseenpkgrpsvwagiperllhvldlkpv-----------------------    Crystal structure of the chitin oligasaccharide binding prot
4gfr:A wmyqynttrftgwwseenpkgrpsvwagiperllhvldlkpvk----------------------    Crystal structure of the liganded chitin oligasaccharide  ...

           5     
           9     
       6789012345                                                           Protein name
       ----+-----                                                           ------------
P20435 ----------                                                           DNA-directed RNA polymerases I, II, and III subunit RPABC2  ...
4c2m:F*----------                                                       ×4  Structure of RNA polymerase i at 2.8 a resolution
2nvx:F*----------                                                       ×5  RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2ja5:F*----------                                                       ×17 Cpd lesion containing RNA polymerase ii elongation complex a
2e2i:F ----------                                                           RNA polymerase ii elongation complex in 5 mm mg+2 with 2'-  ...
2e2j:F ----------                                                           RNA polymerase ii elongation complex in 5 mm mg+2 with  ...
2nvq:F*----------                                                       ×20 RNA polymerase ii elongation complex in 150 mm mg+2 with  ...
1i3q:F*----------                                                       ×50 RNA polymerase ii crystal form i at 3.1 a resolution
1twa:F*----------                                                       ×6  RNA polymerase ii complexed with atp
3h0g:F ----------                                                           RNA polymerase ii from schizosaccharomyces pombe
1qkl:A ----------                                                           Hrpabc14.4, essential subunit of human RNA polymerases i,  ...
2y0s:I ----------                                                           Crystal structure of sulfolobus shibatae RNA polymerase in  ...
4ayb:K*----------                                                       ×3  Rnap at 3.2ang
2pmz:K*----------                                                       ×4  Archaeal RNA polymerase from sulfolobus solfataricus
1i2d:A lesqgflerq                                                           Crystal structure of atp sulfurylase from penicillium  ...
1m8p:A lesqgflerq                                                           Crystal structure of p. Chrysogenum atp sulfurylase in the t
3iz5:X*----------                                                       ×3  Localization of the large subunit ribosomal proteins into a  ...
1zty:A ----------                                                           Crystal structure of the chitin oligasaccharide binding  ...
1zu0:A ----------                                                           Crystal structure of the liganded chitin oligasaccharide  ...
4gf8:A ----------                                                           Crystal structure of the chitin oligasaccharide binding prot
4gfr:A ----------                                                           Crystal structure of the liganded chitin oligasaccharide  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P20435. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 155 - - P20435 DNA-directed RNA polymerases I, II, and III subunit RPABC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO26 PE=1 SV=1
2. 653 100.0% 100 100 806.2 6.2e-38 4c2m:F * Structure of RNA polymerase i at 2.8 a resolution
3. " " " " " "  = 4c3h:F *
Structure of 14-subunit RNA polymerase i at 3.27 a resolutio crystal form c2-93
4. " " " " " "  = 4c3i:F *
Structure of 14-subunit RNA polymerase i at 3.0 a resolution crystal form c2-100
5. " " " " " "  = 4c3j:F *
Structure of 14-subunit RNA polymerase i at 3.35 a resolutio crystal form c2-90
6. 564 100.0% 88 88 698.8 6e-32 2nvx:F * RNA polymerase ii elongation complex in 5 mm mg+2 with 2'- dutp
7. " " " " " "  = 2r92:F *
Elongation complex of RNA polymerase ii with artificial rdrp scaffold
8. " " " " " "  = 2r93:F *
Elongation complex of RNA polymerase ii with a hepatitis delta virus-derived RNA stem loop
9. " " " " " "  = 3i4m:F *
8-oxoguanine containing RNA polymerase ii elongation complex
10. " " " " " "  = 3i4n:F *
8-oxoguanine containing RNA polymerase ii elongation complex
11. 559 100.0% 87 87 692.8 1.3e-31 2ja5:F * Cpd lesion containing RNA polymerase ii elongation complex a
12. " " " " " "  = 2ja6:F *
Cpd lesion containing RNA polymerase ii elongation complex b
13. " " " " " "  = 2ja7:F *
Cpd lesion containing RNA polymerase ii elongation complex c
14. " " " " " "  = 2ja8:F *
Cpd lesion containing RNA polymerase ii elongation complex d
15. " " " " " "  = 3fki:F *
12-subunit RNA polymerase ii refined with zn-sad data
16. " " " " " "  = 3hou:F *
Complete RNA polymerase ii elongation complex i with a t-u mismatch
17. " " " " " "  = 3hov:F *
Complete RNA polymerase ii elongation complex ii
18. " " " " " "  = 3how:F *
Complete RNA polymerase ii elongation complex iii with a t-u mismatch and a frayed RNA 3'-uridine
19. " " " " " "  = 3hox:F *
Complete RNA polymerase ii elongation complex v
20. " " " " " "  = 3hoy:F *
Complete RNA polymerase ii elongation complex vi
21. " " " " " "  = 3hoz:F *
Complete RNA polymerase ii elongation complex iv with a t-u mismatch and a frayed RNA 3'-guanine
22. " " " " " "  = 3k1f:F *
Crystal structure of RNA polymerase ii in complex with tfiib
23. " " " " " "  = 3po2:F *
Arrested RNA polymerase ii elongation complex
24. " " " " " "  = 3qt1:F *
RNA polymerase ii variant containing a chimeric rpb9-c11 sub
25. " " " " " "  = 4bbr:F *
Structure of RNA polymerase ii-tfiib complex
26. " " " " " "  = 4bbs:F *
Structure of an initially transcribing RNA polymerase ii- tfiib complex
27. " " " " " "  = 4by7:F *
Elongating RNA polymerase ii-bye1 tld complex
28. 554 100.0% 86 86 686.8 2.8e-31 2e2i:F RNA polymerase ii elongation complex in 5 mm mg+2 with 2'- dgtp
29. 554 100.0% 86 86 686.8 2.8e-31 2e2j:F RNA polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
30. 548 100.0% 85 85 679.5 7.1e-31 2nvq:F * RNA polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
31. " " " " " "  = 2nvs:F *
RNA polymerase ii elongation complex in 150 mm mg+2 with utp
32. " " " " " "  = 2nvt:F *
RNA polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
33. " " " " " "  = 2yu9:F *
RNA polymerase ii elongation complex in 150 mm mg+2 with utp
34. " " " " " "  = 3gtg:F *
Backtracked RNA polymerase ii complex with 12mer RNA
35. " " " " " "  = 3gtj:F *
Backtracked RNA polymerase ii complex with 13mer RNA
36. " " " " " "  = 3gtk:F *
Backtracked RNA polymerase ii complex with 18mer RNA
37. " " " " " "  = 3rzd:F *
RNA polymerase ii initiation complex with a 5-nt RNA
38. " " " " " "  = 3rzo:F *
RNA polymerase ii initiation complex with a 4-nt RNA
39. " " " " " "  = 3s14:F *
RNA polymerase ii initiation complex with a 6-nt RNA
40. " " " " " "  = 3s15:F *
RNA polymerase ii initiation complex with a 7-nt RNA
41. " " " " " "  = 3s16:F *
RNA polymerase ii initiation complex with an 8-nt RNA
42. " " " " " "  = 3s17:F *
RNA polymerase ii initiation complex with a 9-nt RNA
43. " " " " " "  = 3s1m:F *
RNA polymerase ii initiation complex with a 5-nt RNA (varian
44. " " " " " "  = 3s1n:F *
RNA polymerase ii initiation complex with a 5-nt RNA (varian
45. " " " " " "  = 3s1q:F *
RNA polymerase ii initiation complex with a 5-nt 3'-deoxy rn with atp
46. " " " " " "  = 3s1r:F *
RNA polymerase ii initiation complex with a 5-nt 3'-deoxy rn with gtp
47. " " " " " "  = 3s2d:F *
RNA polymerase ii initiation complex with a 5-nt RNA contain u
48. " " " " " "  = 3s2h:F *
RNA polymerase ii initiation complex with a 6-nt RNA contain 2[prime]-iodo atp
49. " " " " " "  = 4by1:F *
Elongating RNA polymerase ii-bye1 tld complex soaked with am
50. 542 100.0% 84 84 672.3 1.8e-30 1i3q:F * RNA polymerase ii crystal form i at 3.1 a resolution
51. " " " " " "  = 1i50:F *
RNA polymerase ii crystal form ii at 2.8 a resolution
52. " " " " " "  = 1i6h:F *
RNA polymerase ii elongation complex
53. " " " " " "  = 1k83:F *
Crystal structure of yeast RNA polymerase ii complexed with inhibitor alpha amanitin
54. " " " " " "  = 1nik:F *
Wild type RNA polymerase ii
55. " " " " " "  = 1nt9:F *
Complete 12-subunit RNA polymerase ii
56. " " " " " "  = 1pqv:F *
RNA polymerase ii-tfiis complex
57. " " " " " "  = 1r5u:F *
RNA polymerase ii tfiib complex
58. " " " " " "  = 1r9r:F *
RNA polymerase ii strand separated elongation complex
59. " " " " " "  = 1r9s:F *
RNA polymerase ii strand separated elongation complex, matched nucleotide
60. " " " " " "  = 1r9t:F *
RNA polymerase ii strand separated elongation complex, mismatched nucleotide
61. " " " " " "  = 1sfo:F *
RNA polymerase ii strand separated elongation complex
62. " " " " " "  = 1twf:F *
RNA polymerase ii complexed with utp at 2.3 a resolution
63. " " " " " "  = 1wcm:F *
Complete 12-subunit RNA polymerase ii at 3.8 ang
64. " " " " " "  = 1y1v:F *
Refined RNA polymerase ii-tfiis complex
65. " " " " " "  = 1y1w:F *
Complete RNA polymerase ii elongation complex
66. " " " " " "  = 1y1y:F *
RNA polymerase ii-tfiis-DNA/RNA complex
67. " " " " " "  = 1y77:F *
Complete RNA polymerase ii elongation complex with substrate gmpcpp
68. " " " " " "  = 2b63:F *
Complete RNA polymerase ii-RNA inhibitor complex
69. " " " " " "  = 2b8k:F *
12-subunit RNA polymerase ii
70. " " " " " "  = 2nvy:F *
RNA polymerase ii form ii in 150 mm mn+2
71. " " " " " "  = 2r7z:F *
Cisplatin lesion containing RNA polymerase ii elongation com
72. " " " " " "  = 2vum:F *
Alpha-amanitin inhibited complete RNA polymerase ii elongation complex
73. " " " " " "  = 3cqz:F *
Crystal structure of 10 subunit RNA polymerase ii in complex inhibitor alpha-amanitin
74. " " " " " "  = 3gtl:F *
Backtracked RNA polymerase ii complex with 13mer with g<>u m
75. " " " " " "  = 3gtm:F *
Co-complex of backtracked RNA polymerase ii with tfiis
76. " " " " " "  = 3gto:F *
Backtracked RNA polymerase ii complex with 15mer RNA
77. " " " " " "  = 3gtp:F *
Backtracked RNA polymerase ii complex with 24mer RNA
78. " " " " " "  = 3gtq:F *
Backtracked RNA polymerase ii complex induced by damage
79. " " " " " "  = 3h3v:G *
Yeast rnap ii containing poly(a)-signal sequence in the acti
80. " " " " " "  = 3j0k:F *
Orientation of RNA polymerase ii within the human vp16-media ii-tfiif assembly
81. " " " " " "  = 3j1n:F *
Cryo-em map of a yeast minimal preinitiation complex interac the mediator head module
82. " " " " " "  = 3k7a:F *
Crystal structure of an RNA polymerase ii-tfiib complex
83. " " " " " "  = 3m3y:F *
RNA polymerase ii elongation complex c
84. " " " " " "  = 3m4o:F *
RNA polymerase ii elongation complex b
85. " " " " " "  = 3po3:F *
Arrested RNA polymerase ii reactivation intermediate
86. " " " " " "  = 4a3b:F *
RNA polymerase ii initial transcribing complex with a 4nt DNA-RNA hybrid
87. " " " " " "  = 4a3c:F *
RNA polymerase ii initial transcribing complex with a 5nt dn hybrid
88. " " " " " "  = 4a3d:F *
RNA polymerase ii initial transcribing complex with a 6nt dn hybrid
89. " " " " " "  = 4a3e:F *
RNA polymerase ii initial transcribing complex with a 5nt dn hybrid and soaked with ampcpp
90. " " " " " "  = 4a3f:F *
RNA polymerase ii initial transcribing complex with a 6nt dn hybrid and soaked with ampcpp
91. " " " " " "  = 4a3g:F *
RNA polymerase ii initial transcribing complex with a 2nt DNA-RNA hybrid
92. " " " " " "  = 4a3i:F *
RNA polymerase ii binary complex with DNA
93. " " " " " "  = 4a3j:F *
RNA polymerase ii initial transcribing complex with a 2nt DNA-RNA hybrid and soaked with gmpcpp
94. " " " " " "  = 4a3k:F *
RNA polymerase ii initial transcribing complex with a 7nt DNA-RNA hybrid
95. " " " " " "  = 4a3l:F *
RNA polymerase ii initial transcribing complex with a 7nt DNA-RNA hybrid and soaked with ampcpp
96. " " " " " "  = 4a3m:F *
RNA polymerase ii initial transcribing complex with a 4nt DNA-RNA hybrid and soaked with ampcpp
97. " " " " " "  = 4a93:F *
RNA polymerase ii elongation complex containing a cpd lesion
98. " " " " " "  = 4bxx:F *
Arrested RNA polymerase ii-bye1 complex
99. " " " " " "  = 4bxz:F *
RNA polymerase ii-bye1 complex
100. 537 100.0% 83 83 666.3 3.9e-30 1twa:F * RNA polymerase ii complexed with atp
101. " " " " " "  = 1twc:F *
RNA polymerase ii complexed with gtp
102. " " " " " "  = 1twg:F *
RNA polymerase ii complexed with ctp
103. " " " " " "  = 1twh:F *
RNA polymerase ii complexed with 2'datp
104. " " " " " "  = 2e2h:F *
RNA polymerase ii elongation complex at 5 mm mg2+ with gtp
105. " " " " " "  = 2nvz:F *
RNA polymerase ii elongation complex with utp, updated 11/2006
106. 461 85.2% 81 83 573.9 5.4e-25 3h0g:F RNA polymerase ii from schizosaccharomyces pombe
107. 423 50.0% 142 127 515.3 1e-21 1qkl:A Hrpabc14.4, essential subunit of human RNA polymerases i, ii and iii
108. 166 42.4% 59 82 215.2 5.2e-05 2y0s:I Crystal structure of sulfolobus shibatae RNA polymerase in p21 space group
109. 166 42.4% 59 84 215.1 5.3e-05 4ayb:K * Rnap at 3.2ang
110. " " " " " "  = 4b1o:K *
Archaeal rnap-DNA binary complex at 4.32ang
111. " " " " " "  = 4b1p:I *
Archaeal rnap-DNA binary complex at 4.32ang
112. 165 42.4% 59 82 214.0 6.1e-05 2pmz:K * Archaeal RNA polymerase from sulfolobus solfataricus
113. " " " " " "  = 2waq:K *
The complete structure of the archaeal 13-subunit DNA- directed RNA polymerase
114. " " " " " "  = 2wb1:I *
The complete structure of the archaeal 13-subunit DNA- directed RNA polymerase
115. " " " " " "  = 3hkz:K *
The x-ray crystal structure of RNA polymerase from archaea
116. 97 27.1% 107 572 119.2 12 1i2d:A Crystal structure of atp sulfurylase from penicillium chrysogenum
117. 97 27.1% 107 573 119.2 12 1m8p:A Crystal structure of p. Chrysogenum atp sulfurylase in the t
118. 92 31.8% 88 122 115.4 19 3iz5:X * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
119. " " " " " "  = 3izr:X *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
120. " " " " " "  = 3j61:X *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
121. 93 28.3% 99 528 114.8 20 1zty:A Crystal structure of the chitin oligasaccharide binding protein
122. 93 28.3% 99 529 114.8 20 1zu0:A Crystal structure of the liganded chitin oligasaccharide binding protein
123. 93 28.3% 99 528 114.8 20 4gf8:A Crystal structure of the chitin oligasaccharide binding prot
124. 93 28.3% 99 529 114.8 20 4gfr:A Crystal structure of the liganded chitin oligasaccharide bin protein

Number of sequences: 124

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 91 28.7% 108 373 114.5 21 3gb0:A Crystal structure of aminopeptidase pept (np_980509.1) from cereus atcc 10987 at 2.04 a resolution
2. 88 43.2% 37 328 111.7 30 1zsw:A Crystal structure of bacillus cereus metallo protein from gl family
3. 88 30.3% 66 336 111.5 31 3c6m:A Crystal structure of human spermine synthase in complex with spermine and 5-methylthioadenosine
4. 88 32.8% 64 404 110.4 36 1ei6:A Crystal structure of phosphonoacetate hydrolase complexed with phosphonoformate
5. 85 40.5% 42 255 109.6 39 4bo4:C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4-dihydro-2h-quinoline-1- carboxamide at 2.7a resolution
6. 85 28.6% 56 261 109.5 40 3nux:A Cdk6 (monomeric) in complex with inhibitor
7. 84 46.2% 26 247 108.6 45 4gkb:A Crystal structure of a short chain dehydrogenase homolog (ta 505321) from burkholderia multivorans, unliganded structure
8. 84 46.2% 26 258 108.3 47 4glo:A * Crystal structure of a short chain dehydrogenase homolog (ta 505321) from burkholderia multivorans, with bound NAD
9. " " " " " "  = 4gvx:A *
Crystal structure of a short chain dehydrogenase homolog (ta 505321) from burkholderia multivorans, with bound NADP and

Number of sequences: 9

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer