spacer
spacer

SAS results for UniProt accession no. P0CX25

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA   to metal
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P0CX25 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P0CX25 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 46 unique sequences (including 12 consensus sequences) giving 186 sequence matches in all. The 93 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P0CX25 makrtkkvgitgkygvrygsslrrqvk-kleiqqharydcsfcgkktvkrgaagiwtcscckktv    60S ribosomal protein L43-A OS=Saccharomyces cerevisiae  ...
3izc:m*makrtkkvgitgkygvrygsslrrqvk-kleiqqharydcsfcgkktvkrgaagiwtcscckktv×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:p*-akrtkkvgitgkygvrygsslrrqvk-kleiqqharydcsfcgkktvkrgaagiwtcscckktv×3  The structure of the eukaryotic ribosome at 3.0 a  ...
3o58:g*---------itgkygvrygsslrrqvk-kleiqqharydcsfcgkktvkrgaagiwtcscckktv×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
1k5y:2*---------itgkygvrygsslrrqvk-kleiqqharydcsfcgkktvkrgaagiwtcscckktv×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:9 ----------tgkygvrygsslrrqvk-kleiqqharydcsfcgkktvkrgaagiwtcscckktv    Structure of the 60s proteins for eukaryotic ribosome based  ...
3j39:p -akrtkkvgivgkygtrygaslrkmvk-kmeitqhskytcsfcgkdsmkravvgiwsckrckrtv    Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:m*mtkrtkkagivgkygtrygaslrkqik-kmevsqhskyfcefcgkfavkrkavgiwgckdcgkvk×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:p --krtkkvgivgkygtrygaslrkmvk-kieisqhakytcsfcgktkmkrravgiwhcgscmktv    Structure of the human 60s ribosomal proteins
3zf7:o -akrtvkmgvmgrygarygsnprkrak-klevsqhakhfcsfcgkfafrrkavgiwrcdgcsktv    High-resolution cryo-electron microscopy structure of the  ...
4a17:Y*-akrtqkvgitrkygtrygaslrkvvk-kfeitqhakygcpfcgkvavkraavgiwkckpckkii×4  T.Thermophila 60s ribosomal subunit in complex with  ...
1ysh:D ---------ivgkygtrygaslrkqik-kmevsqhskyfcefcgkfavkrkavgiwgckdcgkvk    Localization and dynamic behavior of ribosomal protein l30e
2zkr:z ----------vgkygtrygaslrkmvk-kieisqhakytcsfcgktkmkrravgiwhcgscmktv    Structure of a mammalian ribosomal 60s subunit within an  ...
3j21:i*------kvgsagrfgaryglkirrrva-aveakmrqkhtcpvcgrkavkristgiwqcqkcgatf×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4hub:Z ------ktgssgrfgarygrvsrrrva-eiesemnedhacpncgedrvdrqgtgiwqcsycdykf    The re-refined crystal structure of the haloarcula  ...
1ffk:W ---------ptgrfgpryglkirvrvr-dveikhkkkykcpvcgfpklkrastsiwvcghcgyki    Crystal structure of the large ribosomal subunit from  ...
1jj2:Y*---------rtgrfgpryglkirvrva-dveikhkkkhkcpvcgfkklkragtgiwmcghcgyki×20 Fully refined crystal structure of the haloarcula  ...
3cpw:Y ----------sgrfgarygrvsrrrva-eiesemnedhacpncgedrvdrqgtgiwqcsycdykf    The structure of the antibiotic linezolid bound to the  ...
1s72:Z*---------rsgrfgarygrvsrrrva-eiesemnedhacpncgedrvdrqgtgiwqcsycdykf×24 Refined crystal structure of the haloarcula marismortui  ...
3cc2:Z*---------ssgrfgarygrvsrrrva-eiesemnedhacpncgedrvdrqgtgiwqcsycdykf×21 The refined crystal structure of the haloarcula marismortui  ...
1wff:A --------gssgssgihhlppvkaplqtkkkimkh----cflcgkkt---glatsfecrcgnnfc    Solution structure of the zf-an1 domain from mouse riken  ...

                                         1    
           7         8         9         0    
       678901234567890123456789012345678901234                              Protein name
       ----+---------+---------+---------+----                              ------------
P0CX25 aggaytvstaaaatvrstirrlremvea-----------                              60S ribosomal protein L43-A OS=Saccharomyces cerevisiae  ...
3izc:m*aggaytvstaaaatvrstirrlremvea-----------                          ×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:p*aggaytvstaaaatvrstirrlremvea-----------                          ×3  The structure of the eukaryotic ribosome at 3.0 a  ...
3o58:g*aggaytvstaaaatvrstirrlremvea-----------                          ×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
1k5y:2*aggaytvstaaaatvrst---------------------                          ×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:9 aggaytvstaaaatvrst---------------------                              Structure of the 60s proteins for eukaryotic ribosome based  ...
3j39:p aggawvysttaaasvrsavrrlretkeq-----------                              Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:m*aggaytmntasavtvrstirrlreqtea-----------                          ×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:p aggawtynttsavtvksairrlkelkdq-----------                              Structure of the human 60s ribosomal proteins
3zf7:o aggaytlstpnnttvrstvrrlrelkqsn----------                              High-resolution cryo-electron microscopy structure of the  ...
4a17:Y*aggawelttppavtakttmnrlkklqeeqaaaaalekkn                          ×4  T.Thermophila 60s ribosomal subunit in complex with  ...
1ysh:D aggaytmntasavtvrst---------------------                              Localization and dynamic behavior of ribosomal protein l30e
2zkr:z aggawtynttsavtvksa---------------------                              Structure of a mammalian ribosomal 60s subunit within an  ...
3j21:i*aggaylpvtpagkavrrite-------------------                          ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4hub:Z tggsykpetpggktvrrsiraalse--------------                              The re-refined crystal structure of the haloarcula  ...
1ffk:W aggaytpetvagkavmka---------------------                              Crystal structure of the large ribosomal subunit from  ...
1jj2:Y*aggcyqpetvagkavmka---------------------                          ×20 Fully refined crystal structure of the haloarcula  ...
3cpw:Y tggsykpetpggktvrrs---------------------                              The structure of the antibiotic linezolid bound to the  ...
1s72:Z*tggsykpetpggktvrrs---------------------                          ×24 Refined crystal structure of the haloarcula marismortui  ...
3cc2:Z*tggsykpetpggktvrrs---------------------                          ×21 The refined crystal structure of the haloarcula marismortui  ...
1wff:A ashryaeahgcnydyksagrryleeanpvsgpssg----                              Solution structure of the zf-an1 domain from mouse riken  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P0CX25. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 92 - - P0CX25 60S ribosomal protein L43-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL43A PE=1 SV=1
2. 604 100.0% 92 92 830.4 2.8e-39 3izc:m * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
3. " " " " " "  = 3izs:m *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
4. 597 100.0% 91 91 821.0 9.4e-39 3u5e:p * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
5. " " " " " "  = 3u5i:p *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
6. " " " " " "  = 4b6a:p *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
7. 549 100.0% 83 83 756.3 3.7e-35 3o58:g * Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
8. " " " " " "  = 3o5h:g *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
9. 489 100.0% 73 73 675.6 1.2e-30 1k5y:2 * Structure of the translating 80s ribosome from yeast, obtained by docking atomic models for RNA and protein components into a 15a cryo-em map. This file 1k5y contains the 60s ribosomal subunit. The file 1k5x contains the 40s ribosomal subunit, the p-site bound tRNA and the mRNA codon.
10. " " " " " "  = 1s1i:9 *
Structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 a cryo-em map. This file, 1s1i, contains 60s subunit. The 40s ribosomal subunit is in file 1s1h.
11. 484 100.0% 72 72 668.9 2.8e-30 3jyw:9 Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
12. 433 67.8% 90 91 598.7 2.2e-26 3j39:p Structure of the d. Melanogaster 60s ribosomal proteins
13. 429 67.4% 92 92 593.3 4.5e-26 3iz5:m * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
14. " " " " " "  = 3izr:m *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
15. " " " " " "  = 3j61:p *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
16. 414 67.8% 87 90 573.0 6.1e-25 3j3b:p Structure of the human 60s ribosomal proteins
17. 390 62.5% 88 92 540.4 4e-23 3zf7:o High-resolution cryo-electron microscopy structure of the tr brucei ribosome
18. 381 60.0% 90 102 527.8 2e-22 4a17:Y * T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 2.
19. " " " " " "  = 4a1a:Y *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 3.
20. " " " " " "  = 4a1c:Y *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 4.
21. " " " " " "  = 4a1e:Y *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 1
22. 336 64.4% 73 73 468.3 4.1e-19 1ysh:D Localization and dynamic behavior of ribosomal protein l30e
23. 330 65.7% 70 72 460.2 1.2e-18 2zkr:z Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
24. 245 45.9% 74 78 344.7 3.2e-12 3j21:i * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
25. " " " " " "  = 3j44:i *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
26. 218 39.7% 78 83 307.8 3.6e-10 4hub:Z The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
27. 215 42.0% 69 73 304.3 5.6e-10 1ffk:W Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
28. 206 40.6% 69 73 292.1 2.7e-09 1jj2:Y * Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
29. " " " " " "  = 1k73:1 *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
30. " " " " " "  = 1k8a:1 *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
31. " " " " " "  = 1k9m:1 *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
32. " " " " " "  = 1kc8:1 *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
33. " " " " " "  = 1kd1:1 *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
34. " " " " " "  = 1kqs:Y *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
35. " " " " " "  = 1m1k:1 *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
36. " " " " " "  = 1m90:1 *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
37. " " " " " "  = 1n8r:1 *
Structure of large ribosomal subunit in complex with virginiamycin m
38. " " " " " "  = 1nji:1 *
Structure of chloramphenicol bound to the 50s ribosomal subunit
39. " " " " " "  = 1q7y:1 *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
40. " " " " " "  = 1q81:1 *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
41. " " " " " "  = 1q82:1 *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
42. " " " " " "  = 1q86:1 *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
43. " " " " " "  = 1qvf:Y *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
44. " " " " " "  = 1qvg:Y *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
45. " " " " " "  = 1w2b:Y *
Trigger factor ribosome binding domain in complex with 50s
46. " " " " " "  = 3cxc:Y *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
47. " " " " " "  = 3ow2:Y *
Crystal structure of enhanced macrolide bound to 50s ribosom
48. 195 37.5% 72 72 277.3 1.8e-08 3cpw:Y The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
49. 195 37.5% 72 73 277.2 1.8e-08 1s72:Z * Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
50. " " " " " "  = 1vq4:Z *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
51. " " " " " "  = 1vq5:Z *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
52. " " " " " "  = 1vq6:Z *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
53. " " " " " "  = 1vq7:Z *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
54. " " " " " "  = 1vq8:Z *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
55. " " " " " "  = 1vq9:Z *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
56. " " " " " "  = 1vqk:Z *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
57. " " " " " "  = 1vql:Z *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
58. " " " " " "  = 1vqm:Z *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
59. " " " " " "  = 1vqn:Z *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
60. " " " " " "  = 1vqo:Z *
The structure of ccpmn bound to the large ribosomal subunit marismortui
61. " " " " " "  = 1vqp:Z *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
62. " " " " " "  = 1yhq:Z *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
63. " " " " " "  = 1yi2:Z *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
64. " " " " " "  = 1yij:Z *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
65. " " " " " "  = 1yit:Z *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
66. " " " " " "  = 1yj9:Z *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
67. " " " " " "  = 1yjn:Z *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
68. " " " " " "  = 1yjw:Z *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
69. " " " " " "  = 2otj:Z *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
70. " " " " " "  = 2otl:Z *
Girodazole bound to the large subunit of haloarcula marismor
71. " " " " " "  = 2qa4:Z *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
72. " " " " " "  = 2qex:Z *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
73. 195 37.5% 72 73 277.2 1.8e-08 3cc2:Z * The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
74. " " " " " "  = 3cc4:Z *
Co-crystal structure of anisomycin bound to the 50s ribosoma
75. " " " " " "  = 3cc7:Z *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
76. " " " " " "  = 3cce:Z *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
77. " " " " " "  = 3ccj:Z *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
78. " " " " " "  = 3ccl:Z *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
79. " " " " " "  = 3ccm:Z *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
80. " " " " " "  = 3ccq:Z *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
81. " " " " " "  = 3ccr:Z *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
82. " " " " " "  = 3ccs:Z *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
83. " " " " " "  = 3ccu:Z *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
84. " " " " " "  = 3ccv:Z *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
85. " " " " " "  = 3cd6:Z *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
86. " " " " " "  = 3cma:Z *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
87. " " " " " "  = 3cme:Z *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
88. " " " " " "  = 3g4s:Z *
Co-crystal structure of tiamulin bound to the large ribosoma
89. " " " " " "  = 3g6e:Z *
Co-crystal structure of homoharringtonine bound to the large subunit
90. " " " " " "  = 3g71:Z *
Co-crystal structure of bruceantin bound to the large riboso subunit
91. " " " " " "  = 3i55:Z *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
92. " " " " " "  = 3i56:Z *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
93. " " " " " "  = 4adx:Z *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
94. 93 27.2% 81 85 138.3 0.99 1wff:A Solution structure of the zf-an1 domain from mouse riken cdna 2810002d23 protein

Number of sequences: 94

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 97 37.8% 37 395 136.9 1.2 4n0o:A Complex structure of arterivirus nonstructural protein 10 (h with DNA
2. 97 37.8% 37 401 136.8 1.2 4n0n:A Crystal structure of arterivirus nonstructural protein 10 (h
3. 80 33.3% 24 54 122.8 7.3 2cjs:C Structural basis for a munc13-1 dimeric - munc13-1 - rim heterodimer switch: c2-domains as versatile protein- protein interaction modules
4. 80 33.3% 24 60 122.3 7.8 2a20:A Solution structure of rim2 zinc finger domain
5. 74 45.5% 22 31 117.1 15 1dfs:A Solution structure of the alpha-domain of mouse metallothionein-1
6. 77 30.6% 36 89 116.5 16 2m9a:A Solution nmr structure of e3 ubiquitin-protein ligase zfp91 sapiens, northeast structural genomics consortium (nesg) ta hr7784a
7. 73 32.3% 31 42 114.4 21 2epc:A Solution structure of zinc finger domain 7 in zinc finger protein 32
8. 77 32.7% 55 161 113.8 23 2lcq:A Solution structure of the endonuclease nob1 from p.Horikoshi
9. 74 42.9% 35 90 112.3 28 2yz8:A Crystal structure of the 32th ig-like domain of human obscur (kiaa1556)
10. 71 42.3% 26 38 112.1 29 1ovx:A Nmr structure of the e. Coli clpx chaperone zinc binding dom
11. 71 42.3% 26 40 111.9 29 2ds7:A Structure of the zbd in the hexagonal crystal form
12. 71 42.3% 26 42 111.7 30 2ds6:A Structure of the zbd in the tetragonal crystal form
13. 74 42.9% 35 103 111.7 30 2e7b:A Solution structure of the 6th ig-like domain from human kiaa1556
14. 71 42.3% 26 43 111.6 31 2ds5:A * Structure of the zbd in the orthorhomibic crystal from
15. " " " " " "  = 2ds8:A *
Structure of the zbd-xb complex
16. 71 42.3% 26 44 111.5 31 2ds5:B Structure of the zbd in the orthorhomibic crystal from
17. 72 31.7% 60 64 111.2 32 1uoy:A The bubble protein from penicillium brevicompactum dierckx exudate.
18. 74 36.6% 41 130 110.7 34 3cez:A Crystal structure of methionine-r-sulfoxide reductase from burkholderia pseudomallei
19. 74 36.6% 41 131 110.7 35 3cxk:A 1.7 a crystal structure of methionine-r-sulfoxide reductase burkholderia pseudomallei: crystallization in a microfluidi card.
20. 69 28.1% 32 35 109.8 39 2xtt:A Bovine trypsin in complex with evolutionary enhanced schistocerca gregaria protease inhibitor 1 (sgpi-1-p02)
21. 72 28.6% 56 86 109.8 38 3jyw:X Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
22. 71 24.1% 54 70 109.4 41 4aa6:B The oestrogen receptor recognizes an imperfectly palindromic response element through an alternative side- chain conformation
23. 71 27.9% 43 82 108.7 44 2fc7:A Solution structure of the zz domain of zzz3 protein
24. 71 27.1% 48 92 108.2 47 1ffk:Z Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
25. 68 37.0% 27 37 108.2 47 1ji9:A Solution structure of the alpha-domain of mouse metallothionein-3
26. 71 27.1% 48 92 108.2 47 1jj2:2 * Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
27. " " " " " "  = 1k73:4 *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
28. " " " " " "  = 1k8a:4 *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
29. " " " " " "  = 1k9m:4 *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
30. " " " " " "  = 1kc8:4 *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
31. " " " " " "  = 1kd1:4 *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
32. " " " " " "  = 1kqs:2 *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
33. " " " " " "  = 1m1k:4 *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
34. " " " " " "  = 1m90:4 *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
35. " " " " " "  = 1n8r:4 *
Structure of large ribosomal subunit in complex with virginiamycin m
36. " " " " " "  = 1nji:4 *
Structure of chloramphenicol bound to the 50s ribosomal subunit
37. " " " " " "  = 1q7y:4 *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
38. " " " " " "  = 1q81:4 *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
39. " " " " " "  = 1q82:4 *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
40. " " " " " "  = 1q86:4 *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
41. " " " " " "  = 1qvf:2 *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
42. " " " " " "  = 1qvg:2 *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
43. " " " " " "  = 1s72:3 *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
44. " " " " " "  = 1vq4:3 *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
45. " " " " " "  = 1vq5:3 *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
46. " " " " " "  = 1vq6:3 *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
47. " " " " " "  = 1vq7:3 *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
48. " " " " " "  = 1vq8:3 *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
49. " " " " " "  = 1vq9:3 *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
50. " " " " " "  = 1vqk:3 *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
51. " " " " " "  = 1vql:3 *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
52. " " " " " "  = 1vqm:3 *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
53. " " " " " "  = 1vqn:3 *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
54. " " " " " "  = 1vqo:3 *
The structure of ccpmn bound to the large ribosomal subunit marismortui
55. " " " " " "  = 1vqp:3 *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
56. " " " " " "  = 1w2b:2 *
Trigger factor ribosome binding domain in complex with 50s
57. " " " " " "  = 1yhq:3 *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
58. " " " " " "  = 1yi2:3 *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
59. " " " " " "  = 1yij:3 *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
60. " " " " " "  = 1yit:3 *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
61. " " " " " "  = 1yj9:3 *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
62. " " " " " "  = 1yjn:3 *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
63. " " " " " "  = 1yjw:3 *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
64. " " " " " "  = 2otj:3 *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
65. " " " " " "  = 2otl:3 *
Girodazole bound to the large subunit of haloarcula marismor
66. " " " " " "  = 2qa4:3 *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
67. " " " " " "  = 2qex:3 *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
68. " " " " " "  = 3cc2:3 *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
69. " " " " " "  = 3cc4:3 *
Co-crystal structure of anisomycin bound to the 50s ribosoma
70. " " " " " "  = 3cc7:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
71. " " " " " "  = 3cce:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
72. " " " " " "  = 3ccj:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
73. " " " " " "  = 3ccl:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
74. " " " " " "  = 3ccm:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
75. " " " " " "  = 3ccq:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
76. " " " " " "  = 3ccr:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
77. " " " " " "  = 3ccs:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
78. " " " " " "  = 3ccu:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
79. " " " " " "  = 3ccv:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
80. " " " " " "  = 3cd6:3 *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
81. " " " " " "  = 3cma:3 *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
82. " " " " " "  = 3cme:3 *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
83. " " " " " "  = 3cpw:2 *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
84. " " " " " "  = 3cxc:2 *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
85. " " " " " "  = 3g4s:3 *
Co-crystal structure of tiamulin bound to the large ribosoma
86. " " " " " "  = 3g6e:3 *
Co-crystal structure of homoharringtonine bound to the large subunit
87. " " " " " "  = 3g71:3 *
Co-crystal structure of bruceantin bound to the large riboso subunit
88. " " " " " "  = 3i55:3 *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
89. " " " " " "  = 3i56:3 *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
90. " " " " " "  = 3ow2:2 *
Crystal structure of enhanced macrolide bound to 50s ribosom
91. " " " " " "  = 4adx:3 *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
92. " " " " " "  = 4hub:3 *
The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
93. 70 31.0% 42 73 107.9 49 2ysl:A Solution structure of the ring domain (1-66) from tripartite motif-containing protein 31

Number of sequences: 93

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer