spacer
spacer

SAS results for UniProt accession no. Q3E7X9

Sequence annotated by structure
>

Key:
Sec. struc: By homology
  Helix Strand  

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

 

FASTA alignment for UniProt accession no. Q3E7X9 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q3E7X9 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 22 unique sequences (including 8 consensus sequences) giving 38 sequence matches in all. The 2 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q3E7X9 -----------------------------------------------------------------   40S ribosomal protein S28-A OS=Saccharomyces cerevisiae  ...
3u5c:c*-----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3izb:Y -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3j3a:c*-----------------------------------------------------------------×6 Structure of the human 40s ribosomal proteins
3o2z:R*-----------------------------------------------------------------×2 Yeast 80s ribosome. This entry consists of the 40s subunit  ...
3j38:c -----------------------------------------------------------------   Structure of the d. Melanogaster 40s ribosomal proteins
3iz6:Y*-----------------------------------------------------------------×2 Localization of the small subunit ribosomal proteins into a  ...
3j7a:5 -----------------------------------------------------------------   Cryo-em structure of the plasmodium falciparum 80s ribosome  ...
3zey:Z -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
2xzm:1*-----------------------------------------------------------------×2 Crystal structure of the eukaryotic 40s ribosomal subunit  ...
4bpe:1*-----------------------------------------------------------------×4 The crystal structure of the eukaryotic 40s ribosomal  ...
1ny4:A -----------------------------------------------------------------   Solution structure of the 30s ribosomal protein s28e from  ...
3j20:X*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
1ne3:A -----------------------------------------------------------------   Solution structure of ribosomal protein s28e from  ...
3k21:A --------------------------------------------------------------lyf   Crystal structure of carboxy-terminus of pfc0420w.
2dit:A -----------------------------------------------------------------   Solution structure of the rrm_1 domain of HIV tat specific  ...
3r5p:A -----------------------------------------------------------------   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3r5l:A -----------------------------------------------------------------   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3vti:C galieevfadafdneyiramedaallfgnitlttdsftvkplffpggdigklavcgtvndasmrg   Crystal structure of hype-hypf complex
3txx:A -----------------------------------------------------------------   Crystal structure of putrescine transcarbamylase from  ...
3r5r:A*-----------------------------------------------------------------×2 Structure of ddn, the deazaflavin-dependent nitroreductase  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q3E7X9 -----------------------------------------------------------------   40S ribosomal protein S28-A OS=Saccharomyces cerevisiae  ...
3u5c:c*-----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3izb:Y -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3j3a:c*-----------------------------------------------------------------×6 Structure of the human 40s ribosomal proteins
3o2z:R*-----------------------------------------------------------------×2 Yeast 80s ribosome. This entry consists of the 40s subunit  ...
3j38:c -----------------------------------------------------------------   Structure of the d. Melanogaster 40s ribosomal proteins
3iz6:Y*-----------------------------------------------------------------×2 Localization of the small subunit ribosomal proteins into a  ...
3j7a:5 -----------------------------------------------------------------   Cryo-em structure of the plasmodium falciparum 80s ribosome  ...
3zey:Z -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
2xzm:1*-----------------------------------------------------------------×2 Crystal structure of the eukaryotic 40s ribosomal subunit  ...
4bpe:1*-----------------------------------------------------------------×4 The crystal structure of the eukaryotic 40s ribosomal  ...
1ny4:A -----------------------------------------------------------------   Solution structure of the 30s ribosomal protein s28e from  ...
3j20:X*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
1ne3:A -----------------------------------------------------------------   Solution structure of ribosomal protein s28e from  ...
3k21:A qgihvlenfknyglllkfqklamtiiaqqsndydveklkstflvldedgkgyitkeqlkkglekd   Crystal structure of carboxy-terminus of pfc0420w.
2dit:A -----------------------------------------------------------------   Solution structure of the rrm_1 domain of HIV tat specific  ...
3r5p:A -----------------------------------------------------------------   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3r5l:A -----------------------------------------------------------------   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3vti:C akplfltaafiieegfpvedlkkivksmaeaakeagvkivagdtkvvekgsvdrifintsgigvl   Crystal structure of hype-hypf complex
3txx:A -----------------------------------------------------------------   Crystal structure of putrescine transcarbamylase from  ...
3r5r:A*-----------------------------------------------------------------×2 Structure of ddn, the deazaflavin-dependent nitroreductase  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q3E7X9 ---------------------------------------------------mdnktpvtlakv-i   40S ribosomal protein S28-A OS=Saccharomyces cerevisiae  ...
3u5c:c*-------------------------------------------------------tpvtlakv-i×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3izb:Y ---------------------------------------------------mdnktpvtlakv-i   Localization of the small subunit ribosomal proteins into a  ...
3j3a:c*-----------------------------------------------------rvqpiklarv-t×6 Structure of the human 40s ribosomal proteins
3o2z:R*---------------------------------------------------------vtlakv-i×2 Yeast 80s ribosome. This entry consists of the 40s subunit  ...
3j38:c --------------------------------------------------------pvvwarv-m   Structure of the d. Melanogaster 40s ribosomal proteins
3iz6:Y*---------------------------------------------------md--tqvklavv-v×2 Localization of the small subunit ribosomal proteins into a  ...
3j7a:5 -------------------------------------------------------eksklakv-e   Cryo-em structure of the plasmodium falciparum 80s ribosome  ...
3zey:Z -------------------------------------------------------dqaqvgvi-i   High-resolution cryo-electron microscopy structure of the  ...
2xzm:1*-----------------------------------------------------nteettkari-m×2 Crystal structure of the eukaryotic 40s ribosomal subunit  ...
4bpe:1*------------------------------------------------------teettkari-m×4 The crystal structure of the eukaryotic 40s ribosomal  ...
1ny4:A ----------------------------------------------------maedegypaev-i   Solution structure of the 30s ribosomal protein s28e from  ...
3j20:X*----------------------------------------------------maedegypaev-i×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
1ne3:A ---------------------------------------------------mddatp---aev-i   Solution structure of ribosomal protein s28e from  ...
3k21:A glklpynfdllldqidsdgsgkidytefiaaaldrkqlskkliycafrvfdvdndgeittael-a   Crystal structure of carboxy-terminus of pfc0420w.
2dit:A -----------------------------------------------------------------   Solution structure of the rrm_1 domain of HIV tat specific  ...
3r5p:A ---------------------------------------------------------gtfqkipv   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3r5l:A ------------------------------------------------------glggtfqkipv   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3vti:C yeganvsiknakpgdivlisgtigdhgmavmsareelqfdtpifsdvaplnglieklmtlgea-i   Crystal structure of hype-hypf complex
3txx:A hmkrdyvttetytkeemhylvdlslkikeaikngyypqllknkslgmifqqsstrtrvsfeta-m   Crystal structure of putrescine transcarbamylase from  ...
3r5r:A*------------------------------------------------------------kip-v×2 Structure of ddn, the deazaflavin-dependent nitroreductase  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q3E7X9 kvlgrtgsrggvtqvr-vefl--e--d-----tsrti-vrnvkgpvr-endilvlmeserearrl   40S ribosomal protein S28-A OS=Saccharomyces cerevisiae  ...
3u5c:c*kvlgrtgsrggvtqvr-vefl--e--d-----tsrti-vrnvkgpvr-endilvlmeserearrl×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3izb:Y kvlgrtgsrggvtqvr-vefl--e--d-----tsrti-vrnvkgpvr-endilvlmese------   Localization of the small subunit ribosomal proteins into a  ...
3j3a:c*kvlgrtgsqgqctqvr-vefm--d--d-----tsrsi-irnvkgpvr-egdvltlleserearrl×6 Structure of the human 40s ribosomal proteins
3o2z:R*kvlgrtgsrggvtqvr-vefl--e--d-----tsrti-vrnvkgpvr-endi-------------×2 Yeast 80s ribosome. This entry consists of the 40s subunit  ...
3j38:c kvlgrtgsqgqctqvk-vefl--g--e-----qnrqi-irnvkgpvr-egdiltlleserearrl   Structure of the d. Melanogaster 40s ribosomal proteins
3iz6:Y*kvmgrtgsrgqvtqvr-vkfl--d--d-----qnrli-mrnvkgpvr-egdiltllese------×2 Localization of the small subunit ribosomal proteins into a  ...
3j7a:5 kvlgrtgsrggviqvr-aqf-------------grfl-irnvkgpvr-egdilalleterearrl   Cryo-em structure of the plasmodium falciparum 80s ribosome  ...
3zey:Z kvlgrtgsrgnvtqvr-vrlm--a--eegspeanrti-vrnvkgpck-egdmlslmeterearrl   High-resolution cryo-electron microscopy structure of the  ...
2xzm:1*dvlgktgsrggitqvr-vvlisgk--e-----egrql-irnvkgacr-vgdvlelmecerearrl×2 Crystal structure of the eukaryotic 40s ribosomal subunit  ...
4bpe:1*dvlgktgsrggitqvr-vvlisgk--e-----egrql-irnvkgacr-vgdvlelmecerearrl×4 The crystal structure of the eukaryotic 40s ribosomal  ...
1ny4:A eiigrtgttgdvtqvk-vril--egrd-----kgrvi-rrnvrgpvr-vgdililreterearei   Solution structure of the 30s ribosomal protein s28e from  ...
3j20:X*eiigrtgttgdvtqvk-vril--egrd-----kgrvi-rrnvrgpvr-igdililreterearei×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
1ne3:A evlkrtgmtgevmqvk-cril--dgrd-----kgril-trnvmgpir-egdilmlldtireakei   Solution structure of ribosomal protein s28e from  ...
3k21:A hilyngnkkgnitqrd-vnrv--k--r-----mirdv-dknndgkid-fhefsemmkl-------   Crystal structure of carboxy-terminus of pfc0420w.
2dit:A ---gssgssggpsrmr-herv--------------vi-iknmfhpmdfeddplvlneiredlrve   Solution structure of the rrm_1 domain of HIV tat specific  ...
3r5p:A alltttgrktgqprvnplyfl--r--d-----ggrvi-vaaskggae-knpmwylnlkanpkvqv   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3r5l:A alltttgrktgqprvnplyfl--r--d-----ggrvi-vaaskggae-knpmwylnlkanpkvqv   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3vti:C kvl-rdptrggvaevl-yeis--k--m-----sgvgikiyeeklpvk-esvksacefmgidflhl   Crystal structure of hype-hypf complex
3txx:A eqlgghgeylapgqiq-leti--e--d-----tsrvl-srlvdilma-rverhhsivdlancati   Crystal structure of putrescine transcarbamylase from  ...
3r5r:A*alltttgrktgqprvnplyfl--r--d-----ggrvi-vaaskggae-knpmwylnlkanpkvqv×2 Structure of ddn, the deazaflavin-dependent nitroreductase  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q3E7X9 r----------------------------------------------------------------   40S ribosomal protein S28-A OS=Saccharomyces cerevisiae  ...
3u5c:c*r----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3izb:Y -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3j3a:c*-----------------------------------------------------------------×6 Structure of the human 40s ribosomal proteins
3o2z:R*-----------------------------------------------------------------×2 Yeast 80s ribosome. This entry consists of the 40s subunit  ...
3j38:c r----------------------------------------------------------------   Structure of the d. Melanogaster 40s ribosomal proteins
3iz6:Y*-----------------------------------------------------------------×2 Localization of the small subunit ribosomal proteins into a  ...
3j7a:5 -----------------------------------------------------------------   Cryo-em structure of the plasmodium falciparum 80s ribosome  ...
3zey:Z r----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
2xzm:1*r----------------------------------------------------------------×2 Crystal structure of the eukaryotic 40s ribosomal subunit  ...
4bpe:1*r----------------------------------------------------------------×4 The crystal structure of the eukaryotic 40s ribosomal  ...
1ny4:A ksrr-------------------------------------------------------------   Solution structure of the 30s ribosomal protein s28e from  ...
3j20:X*ksrr-------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
1ne3:A rtp--------------------------------------------------------------   Solution structure of ribosomal protein s28e from  ...
3k21:A -----------------------------------------------------------------   Crystal structure of carboxy-terminus of pfc0420w.
2dit:A cskfgqirklllfdrhpdgvasvsfrdpeeadyciqtldgrwfggrqitaqawdgttdyqsgpss   Solution structure of the rrm_1 domain of HIV tat specific  ...
3r5p:A qikkevldltardatdeeraeywpqlvtmypsyqdyqswtdrtipivvcep--------------   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3r5l:A qikkevldltardatdeeraeywpqlvtmypsyqdyqswtdrtipivvcep--------------   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3vti:C anegkvvvvverdyaekaleimksheygkdaeiigevndsklvtintiygtsrivdrp-------   Crystal structure of hype-hypf complex
3txx:A pvingmsdynhptqelgdlctmvehlpegkkledckvvfvgdatqvcfslglittkmgmnfvhfg   Crystal structure of putrescine transcarbamylase from  ...
3r5r:A*qikkevldltardatdeeraeywpqlvtmypsyqdyqswtdrtipivvcep--------------×2 Structure of ddn, the deazaflavin-dependent nitroreductase  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q3E7X9 -----------------------------------------------------------------   40S ribosomal protein S28-A OS=Saccharomyces cerevisiae  ...
3u5c:c*-----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3izb:Y -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3j3a:c*-----------------------------------------------------------------×6 Structure of the human 40s ribosomal proteins
3o2z:R*-----------------------------------------------------------------×2 Yeast 80s ribosome. This entry consists of the 40s subunit  ...
3j38:c -----------------------------------------------------------------   Structure of the d. Melanogaster 40s ribosomal proteins
3iz6:Y*-----------------------------------------------------------------×2 Localization of the small subunit ribosomal proteins into a  ...
3j7a:5 -----------------------------------------------------------------   Cryo-em structure of the plasmodium falciparum 80s ribosome  ...
3zey:Z -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
2xzm:1*-----------------------------------------------------------------×2 Crystal structure of the eukaryotic 40s ribosomal subunit  ...
4bpe:1*-----------------------------------------------------------------×4 The crystal structure of the eukaryotic 40s ribosomal  ...
1ny4:A -----------------------------------------------------------------   Solution structure of the 30s ribosomal protein s28e from  ...
3j20:X*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
1ne3:A -----------------------------------------------------------------   Solution structure of ribosomal protein s28e from  ...
3k21:A -----------------------------------------------------------------   Crystal structure of carboxy-terminus of pfc0420w.
2dit:A g----------------------------------------------------------------   Solution structure of the rrm_1 domain of HIV tat specific  ...
3r5p:A -----------------------------------------------------------------   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3r5l:A -----------------------------------------------------------------   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3vti:C -----------------------------------------------------------------   Crystal structure of hype-hypf complex
3txx:A pegfqlneehqaklakncevsggsflvtddassvegadflytdvwyglyeaelseeermkvfypk   Crystal structure of putrescine transcarbamylase from  ...
3r5r:A*-----------------------------------------------------------------×2 Structure of ddn, the deazaflavin-dependent nitroreductase  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q3E7X9 -----------------------------------------------------------------   40S ribosomal protein S28-A OS=Saccharomyces cerevisiae  ...
3u5c:c*-----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3izb:Y -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3j3a:c*-----------------------------------------------------------------×6 Structure of the human 40s ribosomal proteins
3o2z:R*-----------------------------------------------------------------×2 Yeast 80s ribosome. This entry consists of the 40s subunit  ...
3j38:c -----------------------------------------------------------------   Structure of the d. Melanogaster 40s ribosomal proteins
3iz6:Y*-----------------------------------------------------------------×2 Localization of the small subunit ribosomal proteins into a  ...
3j7a:5 -----------------------------------------------------------------   Cryo-em structure of the plasmodium falciparum 80s ribosome  ...
3zey:Z -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
2xzm:1*-----------------------------------------------------------------×2 Crystal structure of the eukaryotic 40s ribosomal subunit  ...
4bpe:1*-----------------------------------------------------------------×4 The crystal structure of the eukaryotic 40s ribosomal  ...
1ny4:A -----------------------------------------------------------------   Solution structure of the 30s ribosomal protein s28e from  ...
3j20:X*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
1ne3:A -----------------------------------------------------------------   Solution structure of ribosomal protein s28e from  ...
3k21:A -----------------------------------------------------------------   Crystal structure of carboxy-terminus of pfc0420w.
2dit:A -----------------------------------------------------------------   Solution structure of the rrm_1 domain of HIV tat specific  ...
3r5p:A -----------------------------------------------------------------   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3r5l:A -----------------------------------------------------------------   Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3vti:C -----------------------------------------------------------------   Crystal structure of hype-hypf complex
3txx:A yqvnqemmdraganckfmhclpatrgeevtdevidgknsicfdeaenrltsirgllvylmndyea   Crystal structure of putrescine transcarbamylase from  ...
3r5r:A*-----------------------------------------------------------------×2 Structure of ddn, the deazaflavin-dependent nitroreductase  ...

           4         4         4
           6         7         8
       6789012345678901234567890                                           Protein name
       ----+---------+---------+                                           ------------
Q3E7X9 -------------------------                                           40S ribosomal protein S28-A OS=Saccharomyces cerevisiae  ...
3u5c:c*-------------------------                                        ×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3izb:Y -------------------------                                           Localization of the small subunit ribosomal proteins into a  ...
3j3a:c*-------------------------                                        ×6 Structure of the human 40s ribosomal proteins
3o2z:R*-------------------------                                        ×2 Yeast 80s ribosome. This entry consists of the 40s subunit  ...
3j38:c -------------------------                                           Structure of the d. Melanogaster 40s ribosomal proteins
3iz6:Y*-------------------------                                        ×2 Localization of the small subunit ribosomal proteins into a  ...
3j7a:5 -------------------------                                           Cryo-em structure of the plasmodium falciparum 80s ribosome  ...
3zey:Z -------------------------                                           High-resolution cryo-electron microscopy structure of the  ...
2xzm:1*-------------------------                                        ×2 Crystal structure of the eukaryotic 40s ribosomal subunit  ...
4bpe:1*-------------------------                                        ×4 The crystal structure of the eukaryotic 40s ribosomal  ...
1ny4:A -------------------------                                           Solution structure of the 30s ribosomal protein s28e from  ...
3j20:X*-------------------------                                        ×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
1ne3:A -------------------------                                           Solution structure of ribosomal protein s28e from  ...
3k21:A -------------------------                                           Crystal structure of carboxy-terminus of pfc0420w.
2dit:A -------------------------                                           Solution structure of the rrm_1 domain of HIV tat specific  ...
3r5p:A -------------------------                                           Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3r5l:A -------------------------                                           Structure of ddn, the deazaflavin-dependent nitroreductase  ...
3vti:C -------------------------                                           Crystal structure of hype-hypf complex
3txx:A knpydlikqaeakkelevfldtqsi                                           Crystal structure of putrescine transcarbamylase from  ...
3r5r:A*-------------------------                                        ×2 Structure of ddn, the deazaflavin-dependent nitroreductase  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q3E7X9. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 67 - - Q3E7X9 40S ribosomal protein S28-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS28A PE=1 SV=1
2. 386 100.0% 63 63 554.9 6.3e-24 3u5c:c * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 40s subunit, ribosome a
3. " " " " " "  = 3u5g:c *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 40s subunit, ribosome b
4. " " " " " "  = 4byl:2 *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
5. " " " " " "  = 4byt:2 *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
6. 370 100.0% 60 60 532.8 1.1e-22 3izb:Y Localization of the small subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
7. 309 75.4% 61 64 447.2 6.2e-18 3j3a:c * Structure of the human 40s ribosomal proteins
8. " " " " " "  = 4kzx:c *
Rabbit 40s ribosomal subunit in complex with eif1.
9. " " " " " "  = 4kzy:c *
Rabbit 40s ribosomal subunit in complex with eif1 and eif1a.
10. " " " " " "  = 4kzz:c *
Rabbit 40s ribosomal subunit in complex with mRNA, initiator eif1a
11. " " " " " "  = 4w23:c *
Structure of the 80s mammalian ribosome bound to eef2 (this contains the small ribosomal subunit)
12. " " " " " "  = 4w28:c *
Structure of the translating mammalian ribosome-sec61 comple entry contains the small ribosomal subunit)
13. 288 100.0% 47 47 419.5 2.2e-16 3o2z:R * Yeast 80s ribosome. This entry consists of the 40s subunit o first 80s in the asymmetric unit.
14. " " " " " "  = 3o30:R *
Yeast 80s ribosome. This entry consists of the 40s subunit o second 80s in the asymmetric unit.
15. 289 72.6% 62 62 419.4 2.2e-16 3j38:c Structure of the d. Melanogaster 40s ribosomal proteins
16. 259 71.7% 60 58 377.8 4.6e-14 3iz6:Y * Localization of the small subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
17. " " " " " "  = 3j60:c *
Localization of the small subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
18. 253 72.4% 58 58 369.4 1.3e-13 3j7a:5 Cryo-em structure of the plasmodium falciparum 80s ribosome the anti-protozoan drug emetine, small subunit
19. 249 67.2% 61 68 363.0 3.1e-13 3zey:Z High-resolution cryo-electron microscopy structure of the tr brucei ribosome
20. 230 55.2% 67 67 336.5 9.1e-12 2xzm:1 * Crystal structure of the eukaryotic 40s ribosomal subunit in complex with initiation factor 1. This file contains the 40s subunit and initiation factor for molecule 1
21. " " " " " "  = 2xzn:1 *
Crystal structure of the eukaryotic 40s ribosomal subunit in complex with initiation factor 1. This file contains the 40s subunit and initiation factor for molecule 2
22. 226 58.1% 62 66 331.0 1.8e-11 4bpe:1 * The crystal structure of the eukaryotic 40s ribosomal subuni complex with eif1 and eif1a - complex 1
23. " " " " " "  = 4bpn:1 *
The crystal structure of the eukaryotic 40s ribosomal subuni complex with eif1 and eif1a - complex 2
24. " " " " " "  = 4bpo:1 *
The crystal structure of the eukaryotic 40s ribosomal subuni complex with eif1 and eif1a - complex 3
25. " " " " " "  = 4bpp:1 *
The crystal structure of the eukaryotic 40s ribosomal subuni complex with eif1 and eif1a - complex 4
26. 220 58.3% 60 71 322.2 5.7e-11 1ny4:A Solution structure of the 30s ribosomal protein s28e from pyrococcus horikoshii. Northeast structural genomics consortium target jr19.
27. 219 58.3% 60 71 320.8 6.8e-11 3j20:X * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal subunit)
28. " " " " " "  = 3j43:X *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (30s ribosomal subunit)
29. 197 49.3% 69 68 290.3 3.4e-09 1ne3:A Solution structure of ribosomal protein s28e from methanobacterium thermoautotrophicum. Ontario centre for structural proteomics target mth0256_1_68; northeast structural genomics target tt744
30. 75 22.4% 58 178 114.5 21 3k21:A Crystal structure of carboxy-terminus of pfc0420w.
31. 72 34.7% 49 112 112.9 26 2dit:A Solution structure of the rrm_1 domain of HIV tat specific factor 1 variant
32. 72 33.3% 51 113 112.8 26 3r5p:A Structure of ddn, the deazaflavin-dependent nitroreductase f mycobacterium tuberculosis involved in bioreductive activat 824
33. 72 33.3% 51 116 112.7 27 3r5l:A Structure of ddn, the deazaflavin-dependent nitroreductase f mycobacterium tuberculosis involved in bioreductive activat 824
34. 75 39.1% 46 305 111.6 31 3vti:C Crystal structure of hype-hypf complex
35. 74 34.1% 41 337 109.7 39 3txx:A Crystal structure of putrescine transcarbamylase from entero faecalis
36. 69 33.3% 45 109 108.8 44 3r5r:A * Structure of ddn, the deazaflavin-dependent nitroreductase f mycobacterium tuberculosis involved in bioreductive activat 824, with co-factor f420
37. " " " " " "  = 3r5w:A *
Structure of ddn, the deazaflavin-dependent nitroreductase f mycobacterium tuberculosis involved in bioreductive activat 824, with co-factor f420

Number of sequences: 37

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 73 26.8% 56 307 108.8 44 4gkr:B Structure of thE C-terminal motor domain of kar3 from candid
2. 69 29.1% 55 113 108.6 45 3j39:i Structure of the d. Melanogaster 60s ribosomal proteins

Number of sequences: 2

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer