spacer
spacer

SAS results for UniProt accession no. P09936

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand   to metal
Catalytic residues:   (from CSA)
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P09936 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P09936 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 24 unique sequences (including 5 consensus sequences) giving 31 sequence matches in all. The 4 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P09936 -----------------------------------------------------------------   Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo  ...
2etl:A*-----------------------------------------------------------------×3 Crystal structure of ubiquitin carboxy-terminal hydrolase l1
3irt:A*-----------------------------------------------------------------×2 Crystal structure of the i93m mutant of ubiquitin  ...
3ifw:A -----------------------------------------------------------------   Crystal structure of the s18y variant of ubiquitin carboxy  ...
2len:A -----------------------------------------------------------------   Solution structure of uchl1 s18y variant
1xd3:A -----------------------------------------------------------------   Crystal structure of uchl3-ubvme complex
1uch:A -----------------------------------------------------------------   Deubiquitinating enzyme uch-l3 (human) at 1.8 angstrom  ...
2we6:A -----------------------------------------------------------------   Crystal structure of plasmodium falciparum ubiquitin  ...
2wdt:A -----------------------------------------------------------------   Crystal structure of plasmodium falciparum uchl3 in complex  ...
3ris:A -----------------------------------------------------------------   Crystal structure of the catalytic domain of uchl5, a  ...
4i6n:A -----------------------------------------------------------------   Crystal structure of trichinella spiralis uch37 catalytic  ...
3rii:A -----------------------------------------------------------------   Crystal structure of the catalytic domain of uchl5, a  ...
1cmx:A -----------------------------------------------------------------   Structural basis for the specificity of ubiquitin c-  ...
3a7s:A*-----------------------------------------------------------------×3 Catalytic domain of uch37
3ihr:A -----------------------------------------------------------------   Crystal structure of uch37
3uo3:B -----------------------------------------------------------------   Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
4ig7:A -----------------------------------------------------------------   Crystal structure of trichinella spiralis uch37 bound to  ...
2ckg:A*efpeiteemekeiknvfrngnqdevlseafrltitrkdiqtlnhlnwlndeiinfymnmlmersk×2 The structure of senp1 sumo-2 co-complex suggests a  ...
1vz4:A -----------------------------------------------------------------   Fe-succinate complex of atsk
1nxj:A -----------------------------------------------------------------   Structure of rv3853 from mycobacterium tuberculosis
1svq:A*-----------------------------------------------------------------×2 Structure of severin domain 2 in solution

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P09936 ------------------------------mqlkpmeinpemlnkvlsrlgvagqwrfvdvlgle   Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo  ...
2etl:A*------------------------------MQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLE×3 Crystal structure of ubiquitin carboxy-terminal hydrolase l1
3irt:A*------------------------------MQLKPMEINPEMLNKVLSRLGVAGQWRFVDVLGLE×2 Crystal structure of the i93m mutant of ubiquitin  ...
3ifw:A ------------------------------MQLKPMEINPEMLNKVLYRLGVAGQWRFVDVLGLE   Crystal structure of the s18y variant of ubiquitin carboxy  ...
2len:A ------------------------------mqlkpmeinpemlnkvlyrlgvagqwrfvdvlgle   Solution structure of uchl1 s18y variant
1xd3:A ----------------------------EGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMD   Crystal structure of uchl3-ubvme complex
1uch:A -------------------------------rwlpleanpevtnqflkqlglhpnwqfvdvygmd   Deubiquitinating enzyme uch-l3 (human) at 1.8 angstrom  ...
2we6:A ------------------------------diwtplesnpdslylyscklg-qsklkfvdiygfn   Crystal structure of plasmodium falciparum ubiquitin  ...
2wdt:A ------------------------------diwtplesnpdslylyscklg-qsklkfvdiygfn   Crystal structure of plasmodium falciparum uchl3 in complex  ...
3ris:A -------------------------------ewclmesdpgvftelikgfgcrga-qveeiwsle   Crystal structure of the catalytic domain of uchl5, a  ...
4i6n:A -----------------------plgsmaegnwcliesdpgiftemihgfgctglq--veelvvl   Crystal structure of trichinella spiralis uch37 catalytic  ...
3rii:A ------------------------------gewclmesdpgvftelikgfgcrga-qveeiwsle   Crystal structure of the catalytic domain of uchl5, a  ...
1cmx:A ------------------------------ravvpiesnpevftnfahklglknewayfdiyslt   Structural basis for the specificity of ubiquitin c-  ...
3a7s:A*-------------------------------ewclmesdpgvftelikgfgcrga-qveeiwsle×3 Catalytic domain of uch37
3ihr:A -------------------------------ewclmesdpgvftelikgfgcrga-qveeiwsle   Crystal structure of uch37
3uo3:B -----------------------------------------------------------------   Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
4ig7:A ----------------------------------------------------gnwcliesdpgif   Crystal structure of trichinella spiralis uch37 bound to  ...
2ckg:A*ekglpsvhafntffftklktagyqavkrwtkkvdvfsvdillvpihlgvhwclavvdfrkknity×2 The structure of senp1 sumo-2 co-complex suggests a  ...
1vz4:A -----------------------------------------------------------------   Fe-succinate complex of atsk
1nxj:A -----------------------------------------------------------------   Structure of rv3853 from mycobacterium tuberculosis
1svq:A*-----------------------------------------------------------------×2 Structure of severin domain 2 in solution

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P09936 e-eslgsvpapacallllfpltaqhenfrkkqieelk--gqevspk----vyfmkqtignscgti   Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo  ...
2etl:A*E-ESLGSVPAPACALLLLFPLTAQHENFRKKQIEELK--GQEVSPK----VYFMKQTIGNSCGTI×3 Crystal structure of ubiquitin carboxy-terminal hydrolase l1
3irt:A*E-ESLGSVPAPACALLLLFPLTAQHENFRKKQIEELK--GQEVSPK----VYFMKQTIGNSCGTM×2 Crystal structure of the i93m mutant of ubiquitin  ...
3ifw:A E-ESLGSVPAPACALLLLFPLTAQHENFRKKQIEELK--GQEVSPK----VYFMKQTIGNSCGTI   Crystal structure of the s18y variant of ubiquitin carboxy  ...
2len:A e-eslgsvpapacallllfpltaqhenfrkkqieelk--gqevspk----vyfmkqtignscgti   Solution structure of uchl1 s18y variant
1xd3:A P-ELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSS----VYFMKQTISNACGTI   Crystal structure of uchl3-ubvme complex
1uch:A p-ellsmvprpvcavlllfpitekyevfrteeeekiksqgqdvtss----vyfmkqtisnacgti   Deubiquitinating enzyme uch-l3 (human) at 1.8 angstrom  ...
2we6:A n-dlldmipqpvqaviflypv---kenf----------------dn----vwfikqyipnscgti   Crystal structure of plasmodium falciparum ubiquitin  ...
2wdt:A n-dlldmipqpvqaviflypv-----nf----------------dn----vwfikqyipnscgti   Crystal structure of plasmodium falciparum uchl3 in complex  ...
3ris:A p-enfeklk-pvhgliflf---------kwqpgeepa--gsvvqdsrldtiffakqvinnacatq   Crystal structure of the catalytic domain of uchl5, a  ...
4i6n:A d-esiehlk-pihgfiflfrwlkkem---rkevdd----spqtctd----vyfsqqviqnacasq   Crystal structure of trichinella spiralis uch37 catalytic  ...
3rii:A p-enfeklk-pvhgliflf---------kwqpgeepa--gsvvqdsrldtiffakqvinnasatq   Crystal structure of the catalytic domain of uchl5, a  ...
1cmx:A epellaflprpvkaivllfpin-----------------------d----viwfkqsvknacgly   Structural basis for the specificity of ubiquitin c-  ...
3a7s:A*p-enfeklk-pvhgliflf---------kwqpgeepa--gsvvqdsrldtiffakqvinnaaatq×3 Catalytic domain of uch37
3ihr:A p-enfeklk-pvhgliflf---------kwqpgeepa--gsvvqdsrldtiffakqvinnacatq   Crystal structure of uch37
3uo3:B ----stfyelfpktfpkklpiwtidqsrlrkeyrqlq--aqtlnqa----yhtlkdplrrsqyml   Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
4ig7:A t-emihgfgctglqveelvvldesiehlkpihgfifl--frwlktd----vyfsqqviqnacasq   Crystal structure of trichinella spiralis uch37 bound to  ...
2ckg:A*y-dsmgginneacrillqy-lkqesidkkrkefdtng--wqlfskk----sqipqqmngsdcgmf×2 The structure of senp1 sumo-2 co-complex suggests a  ...
1vz4:A -----------------------------------------------------------------   Fe-succinate complex of atsk
1nxj:A -------------------------------------------------------------aisf   Structure of rv3853 from mycobacterium tuberculosis
1svq:A*-----------------------------------------eykpr----llhisgdknakvaev×2 Structure of severin domain 2 in solution

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P09936 glihavan--nqdklgfedgsvlkqfl-s---etekmspedr-----akcfekn---eaiqaahd   Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo  ...
2etl:A*GLIHAVAN--NQDKLGFEDGSVLKQFL-S---ETEKMSPEDR-----AKCFEKN---EAIQAAHD×3 Crystal structure of ubiquitin carboxy-terminal hydrolase l1
3irt:A*GLIHAVAN--NQDKLGFEDGSVLKQFL-S---ETEKMSPEDR-----AKCFEKN---EAIQAAHD×2 Crystal structure of the i93m mutant of ubiquitin  ...
3ifw:A GLIHAVAN--NQDKLGFEDGSVLKQFL-S---ETEKMSPEDR-----AKCFEKN---EAIQAAHD   Crystal structure of the s18y variant of ubiquitin carboxy  ...
2len:A glihavan--nqdklgfedgsvlkqfl-s---etekmspedr-----akcfekn---eaiqaahd   Solution structure of uchl1 s18y variant
1xd3:A GLIHAIAN--NKDKMHFESGSTLKKFL-E---ESVSMSPEER-----ARYLENY---DAIRVTHE   Crystal structure of uchl3-ubvme complex
1uch:A glihaian--nkdkmhfesgstlkkfl-e---esvsmspeer-----aryleny---dai-----   Deubiquitinating enzyme uch-l3 (human) at 1.8 angstrom  ...
2we6:A allhlygn--lrnkfeldkdsvlddff-n---kvnemsaekr-----gqelknn---ksienlhh   Crystal structure of plasmodium falciparum ubiquitin  ...
2wdt:A allhlygn--lrnkfeldkdsvlddff-n---kvnemsaekr-----gqelknn---ksienlhh   Crystal structure of plasmodium falciparum uchl3 in complex  ...
3ris:A aivsvllncthqd---vhlgetlsefk-e---fsqsfdaamk-----glalsns---dvirqvhn   Crystal structure of the catalytic domain of uchl5, a  ...
4i6n:A alinllln--c-dhpdvdlgptlkefk-d---ftydldsasr-----glcltns---ekiravhn   Crystal structure of trichinella spiralis uch37 catalytic  ...
3rii:A aivsvllncthqd---vhlgetlsefk-e---fsqsfdaamk-----glalsns---dvirqvhn   Crystal structure of the catalytic domain of uchl5, a  ...
1cmx:A ailhslsn--nqsll--epgsdldnflks---qsdtsssknrfddvttdqfvlnvikenvqtfst   Structural basis for the specificity of ubiquitin c-  ...
3a7s:A*aivsvllncthqd---vhlgetlsefk-e---fsqsfdaamk-----glalsns---dvirqvhn×3 Catalytic domain of uch37
3ihr:A aivsvllncthqd---vhlgetlsefk-e---fsqsfdaamk-----glalsns---dvirqvhn   Crystal structure of uch37
3uo3:B kllrnidl--tqeqtstsdpqlllkvl-dihdelsqmddeag-----vkllekq---nk-eriqd   Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
4ig7:A alinllln--c-dhpdvdlgptlkefk-d---ftydldsasr-----glcltns---ekiravhn   Crystal structure of trichinella spiralis uch37 bound to  ...
2ckg:A*ackyadci--tkdrpinftqqhmpyfr-k---rmvweilhrk-----ll----------------×2 The structure of senp1 sumo-2 co-complex suggests a  ...
1vz4:A ------------leldvhpvagrigae-i---rgvklspdld-----aatveai---qaalvrhk   Fe-succinate complex of atsk
1nxj:A rptadlvd--digpdvrscdlqfrqfg-g---rsqfagpist-----vrcfqdn---allksvls   Structure of rv3853 from mycobacterium tuberculosis
1svq:A*platssln--sgdcflldagltiyqf------ngsksspqek-----nkaaeva---raidaerk×2 Structure of severin domain 2 in solution

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P09936 avaq-egqcr---vdd--kvnfhfi-lfnnvdghlyeldgr-mpfpvnhgassedtllkdaa-kv   Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo  ...
2etl:A*AVAQ-EGQCR---VDD--KVNFHFI-LFNNVDGHLYELDGR-MPFPVNHGASSEDTLLKDAA-KV×3 Crystal structure of ubiquitin carboxy-terminal hydrolase l1
3irt:A*AVAQ-EGQCR---VDD--KVNFHFI-LFNNVDGHLYELDGR-MPFPVNHGASSEDTLLKDAA-KV×2 Crystal structure of the i93m mutant of ubiquitin  ...
3ifw:A AVAQ-EGQCR---VDD--KVNFHFI-LFNNVDGHLYELDGR-MPFPVNHGASSEDTLLKDAA-KV   Crystal structure of the s18y variant of ubiquitin carboxy  ...
2len:A avaq-egqcr---vdd--kvnfhfi-lfnnvdghlyeldgr-mpfpvnhgassedtllkdaa-kv   Solution structure of uchl1 s18y variant
1xd3:A TSAH-EGQTEAPSIDE--KVDLHFI-ALVHVDGHLYELDGR-KPFPINHGETSDETLLEDAI-EV   Crystal structure of uchl3-ubvme complex
1uch:A ---------r---vd------lhfi-alvhvdghlyeldgr-kpfpinhgetsdetlledai-ev   Deubiquitinating enzyme uch-l3 (human) at 1.8 angstrom  ...
2we6:A efcg-qvenr----ddildvdthfi-vfvqiegkiieldgr-kdhptvhcftngdnflydtg-ki   Crystal structure of plasmodium falciparum ubiquitin  ...
2wdt:A efcg-qvenr----ddildvdthfi-vfvqiegkiieldgr-kdhptvhcftngdnflydtg-ki   Crystal structure of plasmodium falciparum uchl3 in complex  ...
3ris:A sfar-qqmfe---fdt--kdafhfv-syvpvngrlyeldgl-regpidlgacnqddwisavr-pv   Crystal structure of the catalytic domain of uchl5, a  ...
4i6n:A sfgq-----k---lde--edvfhfv-tyvpvndgvyeldgl-raaplrlgtvasdgdwtevaika   Crystal structure of trichinella spiralis uch37 catalytic  ...
3rii:A sfar---qak---eed----afhfv-syvpvngrlyeldgl-regpidlgacnqddwisavr-pv   Crystal structure of the catalytic domain of uchl5, a  ...
1cmx:A gqse-apeat---ad----tnlhyi-tyveenggifeldgrnlsgplylgksdptatdlieq-el   Structural basis for the specificity of ubiquitin c-  ...
3a7s:A*sfar-a---------------fhfv-syvpvngrlyeldgl-regpidlgacnqddwisavr-pv×3 Catalytic domain of uch37
3ihr:A sfaa-----------------fhfv-syvpvngrlyeldgl-regpidlgacnqddwisavr-pv   Crystal structure of uch37
3uo3:B ieaq-lgqcy---ndk--dyaaavk-ltvelkywynlakaf-kdwap------------------   Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
4ig7:A sfge-d--------------vfhfv-tyvpvndgvyeldgl-raaplrlgtvasdgdwtevaika   Crystal structure of trichinella spiralis uch37 bound to  ...
2ckg:A*-----------------------------------------------------------------×2 The structure of senp1 sumo-2 co-complex suggests a  ...
1vz4:A viff-rgqth---ldd--qsqegfakllgepvahllqldqr-answhtdvtfveaypkasil-rs   Fe-succinate complex of atsk
1nxj:A qpsa-ggvlv---idg--agslhta-lvgdviaelarstgw-tgliv-hgavrdaaalrgid-ig   Structure of rv3853 from mycobacterium tuberculosis
1svq:A*glpkvevfce---tds--dipaefw-kllgg----------------------------------×2 Structure of severin domain 2 in solution

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P09936 cre-fter-eqgevrfsavalckaa----------------------------------------   Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo  ...
2etl:A*CRE-FTER-EQGEVRFSAVALCKAA----------------------------------------×3 Crystal structure of ubiquitin carboxy-terminal hydrolase l1
3irt:A*CRE-FTER-EQGEVRFSAVALCKAA----------------------------------------×2 Crystal structure of the i93m mutant of ubiquitin  ...
3ifw:A CRE-FTER-EQGEVRFSAVALCKAA----------------------------------------   Crystal structure of the s18y variant of ubiquitin carboxy  ...
2len:A cre-fter-eqgevrfsavalckaalehhhhhh--------------------------------   Solution structure of uchl1 s18y variant
1xd3:A CKK-FMER-DPDELRFNAIALSAA-----------------------------------------   Crystal structure of uchl3-ubvme complex
1uch:A ckk-fmer-dpdelrfnaialsaa-----------------------------------------   Deubiquitinating enzyme uch-l3 (human) at 1.8 angstrom  ...
2we6:A iqdkfiek-ckddlrfsalavipndn---------------------------------------   Crystal structure of plasmodium falciparum ubiquitin  ...
2wdt:A iqdkfiek-ckddlrfsalavipn-----------------------------------------   Crystal structure of plasmodium falciparum uchl3 in complex  ...
3ris:A iek-riqkysegeirfnlmaivsdrkmiyeqkiaelq----------------------------   Crystal structure of the catalytic domain of uchl5, a  ...
4i6n:A ikekikny-gesevrfnlmavisdq----------------------------------------   Crystal structure of trichinella spiralis uch37 catalytic  ...
3rii:A iek-riqkysegeirfnlmaivsdr----------------------------------------   Crystal structure of the catalytic domain of uchl5, a  ...
1cmx:A vrv-rvas-ymenaneedvlnfamlglgpn-----------------------------------   Structural basis for the specificity of ubiquitin c-  ...
3a7s:A*iek-riqkysegeirfnlmaivsd-----------------------------------------×3 Catalytic domain of uch37
3ihr:A iek-riqkysegeirfnlmaivsdrkmiyeqkiaelqrqlaeepmdmlsaiqsevaknqmlieee   Crystal structure of uch37
3uo3:B -----------------------------------------------------------------   Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
4ig7:A ikekikny-gesevrfnlmavisdqklkyeremekfaqagdsaevdrlvaliaaedakrerya--   Crystal structure of trichinella spiralis uch37 bound to  ...
2ckg:A*-----------------------------------------------------------------×2 The structure of senp1 sumo-2 co-complex suggests a  ...
1vz4:A vva-pasg-gdtvwantaaayqelpeplreladklwavhsneydyayetehpvvrvhpisgeral   Fe-succinate complex of atsk
1nxj:A ika-lgtn-prkstktgagerdveitlggvtfvpgdiaysdddgiivv-----------------   Structure of rv3853 from mycobacterium tuberculosis
1svq:A*-----------------------------------------------------------------×2 Structure of severin domain 2 in solution

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P09936 -----------------------------------------------------------------   Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo  ...
2etl:A*-----------------------------------------------------------------×3 Crystal structure of ubiquitin carboxy-terminal hydrolase l1
3irt:A*-----------------------------------------------------------------×2 Crystal structure of the i93m mutant of ubiquitin  ...
3ifw:A -----------------------------------------------------------------   Crystal structure of the s18y variant of ubiquitin carboxy  ...
2len:A -----------------------------------------------------------------   Solution structure of uchl1 s18y variant
1xd3:A -----------------------------------------------------------------   Crystal structure of uchl3-ubvme complex
1uch:A -----------------------------------------------------------------   Deubiquitinating enzyme uch-l3 (human) at 1.8 angstrom  ...
2we6:A -----------------------------------------------------------------   Crystal structure of plasmodium falciparum ubiquitin  ...
2wdt:A -----------------------------------------------------------------   Crystal structure of plasmodium falciparum uchl3 in complex  ...
3ris:A -----------------------------------------------------------------   Crystal structure of the catalytic domain of uchl5, a  ...
4i6n:A -----------------------------------------------------------------   Crystal structure of trichinella spiralis uch37 catalytic  ...
3rii:A -----------------------------------------------------------------   Crystal structure of the catalytic domain of uchl5, a  ...
1cmx:A -----------------------------------------------------------------   Structural basis for the specificity of ubiquitin c-  ...
3a7s:A*-----------------------------------------------------------------×3 Catalytic domain of uch37
3ihr:A vqklkrykienirrkhnylpfimellktlaehqqlipl---------------------------   Crystal structure of uch37
3uo3:B -----------------------------------------------------------------   Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
4ig7:A -----------------------------------------------------------------   Crystal structure of trichinella spiralis uch37 bound to  ...
2ckg:A*-----------------------------------------------------------------×2 The structure of senp1 sumo-2 co-complex suggests a  ...
1vz4:A qlghfvkrikgysladsqhlfavlqghvtrlentvrwrweagdvaiwdnratqhyavddygtqpr   Fe-succinate complex of atsk
1nxj:A -----------------------------------------------------------------   Structure of rv3853 from mycobacterium tuberculosis
1svq:A*-----------------------------------------------------------------×2 Structure of severin domain 2 in solution

           4         4        
           6         7        
       67890123456789012345678                                             Protein name
       ----+---------+--------                                             ------------
P09936 -----------------------                                             Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo  ...
2etl:A*-----------------------                                          ×3 Crystal structure of ubiquitin carboxy-terminal hydrolase l1
3irt:A*-----------------------                                          ×2 Crystal structure of the i93m mutant of ubiquitin  ...
3ifw:A -----------------------                                             Crystal structure of the s18y variant of ubiquitin carboxy  ...
2len:A -----------------------                                             Solution structure of uchl1 s18y variant
1xd3:A -----------------------                                             Crystal structure of uchl3-ubvme complex
1uch:A -----------------------                                             Deubiquitinating enzyme uch-l3 (human) at 1.8 angstrom  ...
2we6:A -----------------------                                             Crystal structure of plasmodium falciparum ubiquitin  ...
2wdt:A -----------------------                                             Crystal structure of plasmodium falciparum uchl3 in complex  ...
3ris:A -----------------------                                             Crystal structure of the catalytic domain of uchl5, a  ...
4i6n:A -----------------------                                             Crystal structure of trichinella spiralis uch37 catalytic  ...
3rii:A -----------------------                                             Crystal structure of the catalytic domain of uchl5, a  ...
1cmx:A -----------------------                                             Structural basis for the specificity of ubiquitin c-  ...
3a7s:A*-----------------------                                          ×3 Catalytic domain of uch37
3ihr:A -----------------------                                             Crystal structure of uch37
3uo3:B -----------------------                                             Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
4ig7:A -----------------------                                             Crystal structure of trichinella spiralis uch37 bound to  ...
2ckg:A*-----------------------                                          ×2 The structure of senp1 sumo-2 co-complex suggests a  ...
1vz4:A ivrrvtlagevpvgvdgqlsrtt                                             Fe-succinate complex of atsk
1nxj:A -----------------------                                             Structure of rv3853 from mycobacterium tuberculosis
1svq:A*-----------------------                                          ×2 Structure of severin domain 2 in solution

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P09936. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 223 - - P09936 Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo sapiens GN=UCHL1 PE=1 SV=2
2. 1485 100.0% 223 223 1893.7 1.7e-98 2etl:A * Crystal structure of ubiquitin carboxy-terminal hydrolase l1
3. " " " " " "  = 3kw5:A *
Crystal structure of ubiquitin carboxy terminal hydrolase l1 ubiquitin vinylmethylester
4. " " " " " "  = 4dm9:A *
The crystal structure of ubiquitin carboxy-terminal hydrolas (uchl1) bound to a tripeptide fluoromethyl ketone z-vae(ome
5. 1482 99.6% 223 223 1889.8 2.7e-98 3irt:A * Crystal structure of the i93m mutant of ubiquitin carboxy-te hydrolase l1
6. " " " " " "  = 3kvf:A *
Crystal structure of the i93m mutant of ubiquitin carboxy te hydrolase l1 bound to ubiquitin vinylmethylester
7. 1478 99.6% 223 223 1884.8 5.3e-98 3ifw:A Crystal structure of the s18y variant of ubiquitin carboxy t hydrolase l1 bound to ubiquitin vinylmethylester.
8. 1478 99.6% 223 231 1884.5 5.4e-98 2len:A Solution structure of uchl1 s18y variant
9. 856 55.2% 223 229 1093.2 6.5e-54 1xd3:A Crystal structure of uchl3-ubvme complex
10. 774 53.6% 220 206 677.8 8.9e-31 1uch:A Deubiquitinating enzyme uch-l3 (human) at 1.8 angstrom resolution
11. 401 33.5% 218 208 410.5 6.9e-16 2we6:A Crystal structure of plasmodium falciparum ubiquitin carboxyl-terminal hydrolase 3 (uchl3)
12. 391 33.0% 218 204 409.4 7.9e-16 2wdt:A Crystal structure of plasmodium falciparum uchl3 in complex with the suicide inhibitor ubvme
13. 248 24.9% 221 227 319.7 7.9e-11 3ris:A Crystal structure of the catalytic domain of uchl5, a protea associated human deubiquitinating enzyme, reveals an unprod form of the enzyme
14. 237 25.9% 216 219 286.8 5.3e-09 4i6n:A Crystal structure of trichinella spiralis uch37 catalytic do to ubiquitin vinyl methyl ester
15. 216 24.4% 221 212 255.2 3.1e-07 3rii:A Crystal structure of the catalytic domain of uchl5, a protea associated human deubiquitinating enzyme, reveals an unprod form of the enzyme
16. 248 29.2% 195 214 211.9 8e-05 1cmx:A Structural basis for the specificity of ubiquitin c- terminal hydrolases
17. 198 23.5% 221 204 176.5 0.0074 3a7s:A * Catalytic domain of uch37
18. " " " " " "  = 3sqa:A *
Crystal structure of the uch domain of uch-l5 with 6 residue
19. " " " " " "  = 3tb3:A *
Crystal structure of the uch domain of uch-l5 with 6 residue
20. 209 24.0% 221 282 174.6 0.0095 3ihr:A Crystal structure of uch37
21. 103 22.6% 106 147 137.8 1.1 3uo3:B Jac1 co-chaperone from saccharomyces cerevisiae, 5-182 clone
22. 192 29.4% 143 231 126.2 4.7 4ig7:A Crystal structure of trichinella spiralis uch37 bound to ubi vinyl methyl ester
23. 88 24.6% 69 225 116.1 17 2ckg:A * The structure of senp1 sumo-2 co-complex suggests a structural basis for discrimination between sumo paralogues during processing
24. " " " " " "  = 2ckh:A *
Senp1-sumo2 complex
25. 86 31.6% 57 249 113.0 26 1vz4:A Fe-succinate complex of atsk
26. 83 22.0% 82 156 112.0 29 1nxj:A Structure of rv3853 from mycobacterium tuberculosis
27. 80 22.2% 90 94 111.2 32 1svq:A * Structure of severin domain 2 in solution
28. " " " " " "  = 1svr:A *
Structure of severin domain 2 in solution

Number of sequences: 28

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 80 23.8% 84 102 110.7 34 4afl:A The crystal structure of the ing4 dimerization domain reveals the functional organization of the ing family of chromatin binding proteins.
2. 83 23.5% 132 290 108.2 47 2psb:A Crystal structure of yerb protein from bacillus subtilis. Northeast structural genomics target sr586
3. 81 31.7% 41 194 108.1 48 1uul:A Tryparedoxin peroxidase (txnpx) from trypanosoma cruzi in the reduced state
4. 81 31.7% 41 194 108.1 48 4llr:A Tryparedoxin peroxidase (txnpx) from trypanosoma cruzi in th state

Number of sequences: 4

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer