spacer
spacer

SAS results for UniProt accession no. P38902

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P38902 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P38902 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 16 unique sequences (including 7 consensus sequences) giving 119 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P38902 -----------------------------------------------------------------    DNA-directed RNA polymerase II subunit RPB11  ...
3i4m:K*-----------------------------------------------------------------×2  8-oxoguanine containing RNA polymerase ii elongation complex
1wcm:K*-----------------------------------------------------------------×22 Complete 12-subunit RNA polymerase ii at 3.8 ang
1i3q:K*-----------------------------------------------------------------×73 RNA polymerase ii crystal form i at 3.1 a resolution
3cqz:K -----------------------------------------------------------------    Crystal structure of 10 subunit RNA polymerase ii in  ...
2r92:K*-----------------------------------------------------------------×2  Elongation complex of RNA polymerase ii with artificial  ...
3h0g:K -----------------------------------------------------------------    RNA polymerase ii from schizosaccharomyces pombe
2waq:L*-----------------------------------------------------------------×5  The complete structure of the archaeal 13-subunit DNA-  ...
2wb1:L -----------------------------------------------------------------    The complete structure of the archaeal 13-subunit DNA-  ...
4c2m:K -----------------------------------------------------------------    Structure of RNA polymerase i at 2.8 a resolution
4c3h:K*-----------------------------------------------------------------×3  Structure of 14-subunit RNA polymerase i at 3.27 a  ...
2pa8:L*-----------------------------------------------------------------×3  X-ray crystal structure of the d/l subcomplex of the  ...
1xpp:A -----------------------------------------------------------------    Crystal structure of ta1416,DNA-directed RNA polymerase  ...
4bhu:A gplgsaslfatitgasxtewsfsdieltyrpntllslgvmeftlpsgftantkdtmngnalrttq    Crystal structure of bsla - a bacterial hydrophobin
2nzh:A -----------------------------------------------------------------    Crystal structure of a secretion chaperone csaa from  ...
2nzo:A -----------------------------------------------------------------    Crystal structure of a secretion chaperone csaa from  ...
1x67:A ---------------------------------------------------------gssgssgm    Solution structure of the cofilin homology domain of hip-55  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P38902 -----mnapdrfelfllgegesklkidpdtkapnavvitfekedhtl--gnliraellndrkvlf    DNA-directed RNA polymerase II subunit RPB11  ...
3i4m:K*-----mnapdrfelfllgegesklkidpdtkapnavvitfekedhtl--gnliraellndrkvlf×2  8-oxoguanine containing RNA polymerase ii elongation complex
1wcm:K*-----mnapdrfelfllgegesklkidpdtkapnavvitfekedhtl--gnliraellndrkvlf×22 Complete 12-subunit RNA polymerase ii at 3.8 ang
1i3q:K*-----mnapdrfelfllgegesklkidpdtkapnavvitfekedhtl--gnliraellndrkvlf×73 RNA polymerase ii crystal form i at 3.1 a resolution
3cqz:K ------napdrfelfllgegesklkidpdtkapnavvitfekedhtl--gnliraellndrkvlf    Crystal structure of 10 subunit RNA polymerase ii in  ...
2r92:K*-----mnapdrfelfllgegesklkidpdtkapnavvitfekedhtl--gnliraellndrkvlf×2  Elongation complex of RNA polymerase ii with artificial  ...
3h0g:K -----mnqperyeliel-mglpkvtyeldskspnaavvtlekedhtl--anmlanqllsdervlf    RNA polymerase ii from schizosaccharomyces pombe
2waq:L*-----------------------meikilksesnyleleiegedhtl--gnliagtlrkisgvsf×5  The complete structure of the archaeal 13-subunit DNA-  ...
2wb1:L -----------------------meikilksesnyleleiegedhtl--gnliagtlrkisgvsf    The complete structure of the archaeal 13-subunit DNA-  ...
4c2m:K --------pdrekiklltqats----edgtsasfqiv----eedhtl--gnalryvimknpdvef    Structure of RNA polymerase i at 2.8 a resolution
4c3h:K*------eepdrekiklltqats----edgtsasfqiv----eedhtl--gnalryvimknpdvef×3  Structure of 14-subunit RNA polymerase i at 3.27 a  ...
2pa8:L*-----------------------MEIRILKSESNYLELEIEGEDHTL--GNLIAGTLRRISGVSF×3  X-ray crystal structure of the d/l subcomplex of the  ...
1xpp:A -------------------aesslrv--iskeknsitveminydntl--lrtlveeilkddqvde    Crystal structure of ta1416,DNA-directed RNA polymerase  ...
4bhu:A ilnngktvrvplaldllgagefxlklnnkt-lpaagtytfraenkslsignxfyaeasidv----    Crystal structure of bsla - a bacterial hydrophobin
2nzh:A ---------------------------------maviddfekldirt--gtivkaeefpearv--    Crystal structure of a secretion chaperone csaa from  ...
2nzo:A --------------------------------hmaviddfekldirt--gtivkaeefpearv--    Crystal structure of a secretion chaperone csaa from  ...
1x67:A aanlsrngpalqeayvrvvteksptdwalftyegnsndirvagtgeg--gleemveelnsgkvmy    Solution structure of the cofilin homology domain of hip-55  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P38902 aaykvehpf--farfklr---iqttegydpkdalknacnsiinklgalktnfetewnlqtlaadd    DNA-directed RNA polymerase II subunit RPB11  ...
3i4m:K*aaykvehpf--farfklr---iqttegydpkdalknacnsiinklgalktnfetewnlqtlaa--×2  8-oxoguanine containing RNA polymerase ii elongation complex
1wcm:K*aaykvehpf--farfklr---iqttegydpkdalknacnsiinklgalktnfetewnlqtla---×22 Complete 12-subunit RNA polymerase ii at 3.8 ang
1i3q:K*aaykvehpf--farfklr---iqttegydpkdalknacnsiinklgalktnfetewnlqtl----×73 RNA polymerase ii crystal form i at 3.1 a resolution
3cqz:K aaykvehpf--farfklr---iqttegydpkdalknacnsiinklgalktnfetewnlqtl----    Crystal structure of 10 subunit RNA polymerase ii in  ...
2r92:K*aaykvehpf--farfklr---iqttegydpkdalknacnsiinklgalktnfetewnlq------×2  Elongation complex of RNA polymerase ii with artificial  ...
3h0g:K agykvphpl--nhnfilr---vqtvedcspkqvivdaakslithleeikvnfmrewelkmisveg    RNA polymerase ii from schizosaccharomyces pombe
2waq:L*asyyqphpl--tdkiivk---iltdgsiapkdallkaietvrvmashyideikglt---------×5  The complete structure of the archaeal 13-subunit DNA-  ...
2wb1:L asyyqphpl--tdkiivk---iltdgsiapkdallkaietvrvmashyideikgltk--------    The complete structure of the archaeal 13-subunit DNA-  ...
4c2m:K cgysiphps--enllnir---iqtygettavdalqkglkdlmdlcdvveskftekiksm------    Structure of RNA polymerase i at 2.8 a resolution
4c3h:K*cgysiphps--enllnir---iqtygettavdalqkglkdlmdlcdvveskftekiksm------×3  Structure of 14-subunit RNA polymerase i at 3.27 a  ...
2pa8:L*ASYYQPHPL--SDKIIVK---ILTDGSITPKDALLKAIENIRGMTSHYIDEIKGLTK--------×3  X-ray crystal structure of the d/l subcomplex of the  ...
1xpp:A aryyikhpv--idnpqiy---vrvksg-kpqsaikravrklsklyedlgtqfqkefqryesdh--    Crystal structure of ta1416,DNA-directed RNA polymerase  ...
4bhu:A -----------------------------------------------------------------    Crystal structure of bsla - a bacterial hydrophobin
2nzh:A paiklvidf--gteigikqssaqitkrykpeglinkqviavvnfpprriagfksevlvlggipgq    Crystal structure of a secretion chaperone csaa from  ...
2nzo:A paiklvidf--gteigikqssaqitkrykpeglinkqviavvnfpprriagfksevlvlggipgq    Crystal structure of a secretion chaperone csaa from  ...
1x67:A afcrvkdpnsglpkfvli---nwtgegvn--dvrkgacashvstmasflkgahvtinaraeedve    Solution structure of the cofilin homology domain of hip-55  ...

           2         2    
           0         1    
       6789012345678901234                                                  Protein name
       ----+---------+----                                                  ------------
P38902 af-----------------                                                  DNA-directed RNA polymerase II subunit RPB11  ...
3i4m:K*-------------------                                              ×2  8-oxoguanine containing RNA polymerase ii elongation complex
1wcm:K*-------------------                                              ×22 Complete 12-subunit RNA polymerase ii at 3.8 ang
1i3q:K*-------------------                                              ×73 RNA polymerase ii crystal form i at 3.1 a resolution
3cqz:K -------------------                                                  Crystal structure of 10 subunit RNA polymerase ii in  ...
2r92:K*-------------------                                              ×2  Elongation complex of RNA polymerase ii with artificial  ...
3h0g:K ve-----------------                                                  RNA polymerase ii from schizosaccharomyces pombe
2waq:L*-------------------                                              ×5  The complete structure of the archaeal 13-subunit DNA-  ...
2wb1:L -------------------                                                  The complete structure of the archaeal 13-subunit DNA-  ...
4c2m:K -------------------                                                  Structure of RNA polymerase i at 2.8 a resolution
4c3h:K*-------------------                                              ×3  Structure of 14-subunit RNA polymerase i at 3.27 a  ...
2pa8:L*-------------------                                              ×3  X-ray crystal structure of the d/l subcomplex of the  ...
1xpp:A -------------------                                                  Crystal structure of ta1416,DNA-directed RNA polymerase  ...
4bhu:A -------------------                                                  Crystal structure of bsla - a bacterial hydrophobin
2nzh:A gdvvllqpdqpvpngtkig                                                  Crystal structure of a secretion chaperone csaa from  ...
2nzo:A gdvvllqpdqpvpngtkig                                                  Crystal structure of a secretion chaperone csaa from  ...
1x67:A pecimekvasgpssg----                                                  Solution structure of the cofilin homology domain of hip-55  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P38902. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 120 - - P38902 DNA-directed RNA polymerase II subunit RPB11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB11 PE=1 SV=1
2. 754 100.0% 116 116 1011.7 2.2e-49 3i4m:K * 8-oxoguanine containing RNA polymerase ii elongation complex
3. " " " " " "  = 3i4n:K *
8-oxoguanine containing RNA polymerase ii elongation complex
4. 749 100.0% 115 115 1005.1 5.2e-49 1wcm:K * Complete 12-subunit RNA polymerase ii at 3.8 ang
5. " " " " " "  = 2b63:K *
Complete RNA polymerase ii-RNA inhibitor complex
6. " " " " " "  = 2b8k:K *
12-subunit RNA polymerase ii
7. " " " " " "  = 3fki:K *
12-subunit RNA polymerase ii refined with zn-sad data
8. " " " " " "  = 3hoz:K *
Complete RNA polymerase ii elongation complex iv with a t-u mismatch and a frayed RNA 3'-guanine
9. " " " " " "  = 3po2:K *
Arrested RNA polymerase ii elongation complex
10. " " " " " "  = 4a3b:K *
RNA polymerase ii initial transcribing complex with a 4nt DNA-RNA hybrid
11. " " " " " "  = 4a3c:K *
RNA polymerase ii initial transcribing complex with a 5nt dn hybrid
12. " " " " " "  = 4a3d:K *
RNA polymerase ii initial transcribing complex with a 6nt dn hybrid
13. " " " " " "  = 4a3e:K *
RNA polymerase ii initial transcribing complex with a 5nt dn hybrid and soaked with ampcpp
14. " " " " " "  = 4a3f:K *
RNA polymerase ii initial transcribing complex with a 6nt dn hybrid and soaked with ampcpp
15. " " " " " "  = 4a3g:K *
RNA polymerase ii initial transcribing complex with a 2nt DNA-RNA hybrid
16. " " " " " "  = 4a3i:K *
RNA polymerase ii binary complex with DNA
17. " " " " " "  = 4a3j:K *
RNA polymerase ii initial transcribing complex with a 2nt DNA-RNA hybrid and soaked with gmpcpp
18. " " " " " "  = 4a3k:K *
RNA polymerase ii initial transcribing complex with a 7nt DNA-RNA hybrid
19. " " " " " "  = 4a3l:K *
RNA polymerase ii initial transcribing complex with a 7nt DNA-RNA hybrid and soaked with ampcpp
20. " " " " " "  = 4a3m:K *
RNA polymerase ii initial transcribing complex with a 4nt DNA-RNA hybrid and soaked with ampcpp
21. " " " " " "  = 4a93:K *
RNA polymerase ii elongation complex containing a cpd lesion
22. " " " " " "  = 4bxx:K *
Arrested RNA polymerase ii-bye1 complex
23. " " " " " "  = 4bxz:K *
RNA polymerase ii-bye1 complex
24. " " " " " "  = 4by1:K *
Elongating RNA polymerase ii-bye1 tld complex soaked with am
25. " " " " " "  = 4by7:K *
Elongating RNA polymerase ii-bye1 tld complex
26. 744 100.0% 114 114 998.6 1.2e-48 1i3q:K * RNA polymerase ii crystal form i at 3.1 a resolution
27. " " " " " "  = 1i50:K *
RNA polymerase ii crystal form ii at 2.8 a resolution
28. " " " " " "  = 1i6h:K *
RNA polymerase ii elongation complex
29. " " " " " "  = 1k83:K *
Crystal structure of yeast RNA polymerase ii complexed with inhibitor alpha amanitin
30. " " " " " "  = 1nik:K *
Wild type RNA polymerase ii
31. " " " " " "  = 1nt9:K *
Complete 12-subunit RNA polymerase ii
32. " " " " " "  = 1pqv:K *
RNA polymerase ii-tfiis complex
33. " " " " " "  = 1r5u:K *
RNA polymerase ii tfiib complex
34. " " " " " "  = 1r9r:K *
RNA polymerase ii strand separated elongation complex
35. " " " " " "  = 1r9s:K *
RNA polymerase ii strand separated elongation complex, matched nucleotide
36. " " " " " "  = 1r9t:K *
RNA polymerase ii strand separated elongation complex, mismatched nucleotide
37. " " " " " "  = 1sfo:K *
RNA polymerase ii strand separated elongation complex
38. " " " " " "  = 1twa:K *
RNA polymerase ii complexed with atp
39. " " " " " "  = 1twc:K *
RNA polymerase ii complexed with gtp
40. " " " " " "  = 1twf:K *
RNA polymerase ii complexed with utp at 2.3 a resolution
41. " " " " " "  = 1twg:K *
RNA polymerase ii complexed with ctp
42. " " " " " "  = 1twh:K *
RNA polymerase ii complexed with 2'datp
43. " " " " " "  = 1y1v:K *
Refined RNA polymerase ii-tfiis complex
44. " " " " " "  = 1y1w:K *
Complete RNA polymerase ii elongation complex
45. " " " " " "  = 1y1y:K *
RNA polymerase ii-tfiis-DNA/RNA complex
46. " " " " " "  = 1y77:K *
Complete RNA polymerase ii elongation complex with substrate gmpcpp
47. " " " " " "  = 2e2h:K *
RNA polymerase ii elongation complex at 5 mm mg2+ with gtp
48. " " " " " "  = 2e2i:K *
RNA polymerase ii elongation complex in 5 mm mg+2 with 2'- dgtp
49. " " " " " "  = 2e2j:K *
RNA polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
50. " " " " " "  = 2ja5:K *
Cpd lesion containing RNA polymerase ii elongation complex a
51. " " " " " "  = 2ja6:K *
Cpd lesion containing RNA polymerase ii elongation complex b
52. " " " " " "  = 2ja7:K *
Cpd lesion containing RNA polymerase ii elongation complex c
53. " " " " " "  = 2ja8:K *
Cpd lesion containing RNA polymerase ii elongation complex d
54. " " " " " "  = 2nvq:K *
RNA polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
55. " " " " " "  = 2nvs:K *
RNA polymerase ii elongation complex in 150 mm mg+2 with utp
56. " " " " " "  = 2nvt:K *
RNA polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
57. " " " " " "  = 2nvx:K *
RNA polymerase ii elongation complex in 5 mm mg+2 with 2'- dutp
58. " " " " " "  = 2nvy:K *
RNA polymerase ii form ii in 150 mm mn+2
59. " " " " " "  = 2nvz:K *
RNA polymerase ii elongation complex with utp, updated 11/2006
60. " " " " " "  = 2r7z:K *
Cisplatin lesion containing RNA polymerase ii elongation com
61. " " " " " "  = 2vum:K *
Alpha-amanitin inhibited complete RNA polymerase ii elongation complex
62. " " " " " "  = 2yu9:K *
RNA polymerase ii elongation complex in 150 mm mg+2 with utp
63. " " " " " "  = 3gtg:K *
Backtracked RNA polymerase ii complex with 12mer RNA
64. " " " " " "  = 3gtj:K *
Backtracked RNA polymerase ii complex with 13mer RNA
65. " " " " " "  = 3gtk:K *
Backtracked RNA polymerase ii complex with 18mer RNA
66. " " " " " "  = 3gtl:K *
Sequence with no PDB entry
67. " " " " " "  = 3gtm:K *
Sequence with no PDB entry
68. " " " " " "  = 3gto:K *
Backtracked RNA polymerase ii complex with 15mer RNA
69. " " " " " "  = 3gtp:K *
Backtracked RNA polymerase ii complex with 24mer RNA
70. " " " " " "  = 3gtq:K *
Backtracked RNA polymerase ii complex induced by damage
71. " " " " " "  = 3h3v:L *
Yeast rnap ii containing poly(a)-signal sequence in the acti
72. " " " " " "  = 3hou:K *
Complete RNA polymerase ii elongation complex i with a t-u mismatch
73. " " " " " "  = 3hov:K *
Complete RNA polymerase ii elongation complex ii
74. " " " " " "  = 3how:K *
Complete RNA polymerase ii elongation complex iii with a t-u mismatch and a frayed RNA 3'-uridine
75. " " " " " "  = 3hox:K *
Complete RNA polymerase ii elongation complex v
76. " " " " " "  = 3hoy:K *
Complete RNA polymerase ii elongation complex vi
77. " " " " " "  = 3j0k:K *
Orientation of RNA polymerase ii within the human vp16-media ii-tfiif assembly
78. " " " " " "  = 3j1n:K *
Cryo-em map of a yeast minimal preinitiation complex interac the mediator head module
79. " " " " " "  = 3k1f:K *
Crystal structure of RNA polymerase ii in complex with tfiib
80. " " " " " "  = 3k7a:K *
Crystal structure of an RNA polymerase ii-tfiib complex
81. " " " " " "  = 3m3y:K *
RNA polymerase ii elongation complex c
82. " " " " " "  = 3m4o:K *
RNA polymerase ii elongation complex b
83. " " " " " "  = 3po3:K *
Arrested RNA polymerase ii reactivation intermediate
84. " " " " " "  = 3qt1:K *
RNA polymerase ii variant containing a chimeric rpb9-c11 sub
85. " " " " " "  = 3rzd:K *
RNA polymerase ii initiation complex with a 5-nt RNA
86. " " " " " "  = 3rzo:K *
RNA polymerase ii initiation complex with a 4-nt RNA
87. " " " " " "  = 3s14:K *
RNA polymerase ii initiation complex with a 6-nt RNA
88. " " " " " "  = 3s15:K *
RNA polymerase ii initiation complex with a 7-nt RNA
89. " " " " " "  = 3s16:K *
RNA polymerase ii initiation complex with an 8-nt RNA
90. " " " " " "  = 3s17:K *
RNA polymerase ii initiation complex with a 9-nt RNA
91. " " " " " "  = 3s1m:K *
RNA polymerase ii initiation complex with a 5-nt RNA (varian
92. " " " " " "  = 3s1n:K *
RNA polymerase ii initiation complex with a 5-nt RNA (varian
93. " " " " " "  = 3s1q:K *
RNA polymerase ii initiation complex with a 5-nt 3'-deoxy rn with atp
94. " " " " " "  = 3s1r:K *
RNA polymerase ii initiation complex with a 5-nt 3'-deoxy rn with gtp
95. " " " " " "  = 3s2d:K *
RNA polymerase ii initiation complex with a 5-nt RNA contain u
96. " " " " " "  = 3s2h:K *
RNA polymerase ii initiation complex with a 6-nt RNA contain 2[prime]-iodo atp
97. " " " " " "  = 4bbr:K *
Structure of RNA polymerase ii-tfiib complex
98. " " " " " "  = 4bbs:K *
Structure of an initially transcribing RNA polymerase ii- tfiib complex
99. 737 100.0% 113 113 989.3 3.9e-48 3cqz:K Crystal structure of 10 subunit RNA polymerase ii in complex inhibitor alpha-amanitin
100. 734 100.0% 112 112 985.4 6.5e-48 2r92:K * Elongation complex of RNA polymerase ii with artificial rdrp scaffold
101. " " " " " "  = 2r93:K *
Elongation complex of RNA polymerase ii with a hepatitis delta virus-derived RNA stem loop
102. 351 46.2% 117 119 476.5 1.5e-19 3h0g:K RNA polymerase ii from schizosaccharomyces pombe
103. 139 39.4% 66 91 196.9 0.00055 2waq:L * The complete structure of the archaeal 13-subunit DNA- directed RNA polymerase
104. " " " " " "  = 2y0s:L *
Crystal structure of sulfolobus shibatae RNA polymerase in p21 space group
105. " " " " " "  = 4ayb:L *
Rnap at 3.2ang
106. " " " " " "  = 4b1o:L *
Archaeal rnap-DNA binary complex at 4.32ang
107. " " " " " "  = 4b1p:M *
Archaeal rnap-DNA binary complex at 4.32ang
108. 139 39.4% 66 92 196.8 0.00055 2wb1:L The complete structure of the archaeal 13-subunit DNA- directed RNA polymerase
109. 139 29.4% 102 101 196.1 0.0006 4c2m:K Structure of RNA polymerase i at 2.8 a resolution
110. 139 29.4% 102 103 196.0 0.00061 4c3h:K * Structure of 14-subunit RNA polymerase i at 3.27 a resolutio crystal form c2-93
111. " " " " " "  = 4c3i:K *
Structure of 14-subunit RNA polymerase i at 3.0 a resolution crystal form c2-100
112. " " " " " "  = 4c3j:K *
Structure of 14-subunit RNA polymerase i at 3.35 a resolutio crystal form c2-90
113. 138 40.9% 66 92 195.5 0.00065 2pa8:L * X-ray crystal structure of the d/l subcomplex of the sulfolo solfataricus RNA polymerase
114. " " " " " "  = 2pmz:L *
Archaeal RNA polymerase from sulfolobus solfataricus
115. " " " " " "  = 3hkz:L *
The x-ray crystal structure of RNA polymerase from archaea
116. 118 26.6% 94 99 168.4 0.021 1xpp:A Crystal structure of ta1416,DNA-directed RNA polymerase subu from thermoplasma acidophilum
117. 76 43.9% 41 125 110.9 34 4bhu:A Crystal structure of bsla - a bacterial hydrophobin
118. 75 25.7% 70 110 110.6 35 2nzh:A Crystal structure of a secretion chaperone csaa from bacillu in the space group p 4 21 2
119. 75 25.7% 70 111 110.5 35 2nzo:A Crystal structure of a secretion chaperone csaa from bacillu in the space group p 32 2 1
120. 76 32.7% 55 146 110.0 38 1x67:A Solution structure of the cofilin homology domain of hip-55 (drebrin-like protein)

Number of sequences: 120

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer