spacer
spacer

SAS results for UniProt accession no. P0A7L8

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P0A7L8 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P0A7L8 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 64 unique sequences (including 29 consensus sequences) giving 344 sequence matches in all. The 72 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P0A7L8 mahkkaggstrngrdseakrlgvkrfggesvlagsiivrqrgtkfhaganvgcgrdhtlfakadg    50S ribosomal protein L27 OS=Escherichia coli (strain K12)  ...
1vs6:W*-ahkkaggstrngrdseakrlgvkrfggesvlagsiivrqrgtkfhaganvgcgrdhtlfakadg×23 Crystal structure of the bacterial ribosome from  ...
1vt2:W*------ggstrngrdseakrlgvkrfggesvlagsiivrqrgtkfhaganvgcgrdhtlfakadg×61 Crystal structure of the e. Coli ribosome bound to cem-101.  ...
3j19:W*---------trngrdseakrlgvkrfggesvlagsiivrqrgtkfhaganvgcgrdhtlfakadg×12 Structure of the bacterial ribosome complexed by tmrna-smpb  ...
3r8t:W*----------rngrdseakrlgvkrfggesvlagsiivrqrgtkfhaganvgcgrdhtlfakadg×9  Structures of the bacterial ribosome in classical and  ...
1p85:U*-----------------akrlgvkrfggesvlagsiivrqrgtkfhaganvgcgrdhtlfakadg×2  Real space refined coordinates of the 50s subunit fitted  ...
1y69:U*-ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfalsdg×9  Rrf domain i in complex with the 50s ribosomal subunit from  ...
1kc9:U*-ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfalsdg×19 Crystal structure of the large ribosomal subunit from  ...
3bbo:X -ahkkgagstkngrdspgqrlgvkiygdqvakpgaiivrqrgtkfhagknvgigkdhtifslidg    Homology model for the spinach chloroplast 50s subunit  ...
2hgj:Z*mahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdg×14 Crystal structure of the 70s thermus thermophilus ribosome  ...
2v47:0*mahkkalastrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdg×2  Structure of the ribosome recycling factor bound to the  ...
1vvm:0*-ahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdg×18 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
4qcn:0*-ahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdg×8  Crystal structure of the thermus thermophilus 70s ribosome  ...
2wdi:0*-ahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdg×56 Structure of the thermus thermophilus 70s ribosome in  ...
3pio:T*-----------ngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfalsdg×2  Crystal structure of the synergistic antibiotic pair  ...
2x9s:0*--hkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdg×2  Structure of the 70s ribosome bound to release factor 2 and  ...
3i9e:3 ------lgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdg    Initiation complex of 70s ribosome with two trnas and mRNA.  ...
3i9c:3 -----glgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdg    Initiation complex of 70s ribosome with two trnas and mRNA.  ...
3uxq:0*--------strngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdg×8  The structure of thermorubin in complex with the 70s  ...
3hux:0*--------strngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdg×11 Structure of ef-p bound to the 70s ribosome; this file  ...
1vs9:U*---------trngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdg×13 Crystal structure of a 70s ribosome-tRNA complex reveals  ...

                              
           7         8        
       67890123456789012345678                                              Protein name
       ----+---------+--------                                              ------------
P0A7L8 kvkfevkgpknrkfisieae---                                              50S ribosomal protein L27 OS=Escherichia coli (strain K12)  ...
1vs6:W*kvkfevkgpknrkfisieae---                                          ×23 Crystal structure of the bacterial ribosome from  ...
1vt2:W*kvkfevkgpknrkfisieae---                                          ×61 Crystal structure of the e. Coli ribosome bound to cem-101.  ...
3j19:W*kvkfevkgpknrkfisieae---                                          ×12 Structure of the bacterial ribosome complexed by tmrna-smpb  ...
3r8t:W*kvkfevkgpknrkfisieae---                                          ×9  Structures of the bacterial ribosome in classical and  ...
1p85:U*kvkfevkgpknrkfisieae---                                          ×2  Real space refined coordinates of the 50s subunit fitted  ...
1y69:U*kvvfinkg-kgarfisieaaq--                                          ×9  Rrf domain i in complex with the 50s ribosomal subunit from  ...
1kc9:U*kvvfinkg-kgarfisieaaqte                                          ×19 Crystal structure of the large ribosomal subunit from  ...
3bbo:X lvkfekfgp-drkkisvypreiv                                              Homology model for the spinach chloroplast 50s subunit  ...
2hgj:Z*vvefqdrgrlgryvhvrpla---                                          ×14 Crystal structure of the 70s thermus thermophilus ribosome  ...
2v47:0*vvefqdrgrlgryvhvrpla---                                          ×2  Structure of the ribosome recycling factor bound to the  ...
1vvm:0*vvefqdrgrlgryvhvrp-----                                          ×18 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
4qcn:0*vvefqdrgrlgryvhvrpl----                                          ×8  Crystal structure of the thermus thermophilus 70s ribosome  ...
2wdi:0*vvefqdrgrlgryvhvrpla---                                          ×56 Structure of the thermus thermophilus 70s ribosome in  ...
3pio:T*kvvfinkg-kgarfisieaaq--                                          ×2  Crystal structure of the synergistic antibiotic pair  ...
2x9s:0*vvefqdrgrlgryvhvrpla---                                          ×2  Structure of the 70s ribosome bound to release factor 2 and  ...
3i9e:3 vvefqdrgrlgryvhvrp-----                                              Initiation complex of 70s ribosome with two trnas and mRNA.  ...
3i9c:3 vvefqdrgrlgryvhvrpla---                                              Initiation complex of 70s ribosome with two trnas and mRNA.  ...
3uxq:0*vvefqdrgrlgryvhvrpl----                                          ×8  The structure of thermorubin in complex with the 70s  ...
3hux:0*vvefqdrgrlgryvhvrpla---                                          ×11 Structure of ef-p bound to the 70s ribosome; this file  ...
1vs9:U*vvefqdrgrlgryvhvrpla---                                          ×13 Crystal structure of a 70s ribosome-tRNA complex reveals  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P0A7L8. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 85 - - P0A7L8 50S ribosomal protein L27 OS=Escherichia coli (strain K12) GN=rpmA PE=1 SV=2
2. 551 100.0% 84 84 764.9 1.2e-35 1vs6:W * Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
3. " " " " " "  = 1vs8:W *
Crystal structure of the bacterial ribosome from escherichia complex with the antibiotic kasugamyin at 3.5a resolution. Contains the 50s subunit of one 70s ribosome. The entire cr structure contains two 70s ribosomes and is described in re
4. " " " " " "  = 2aw4:W *
Crystal structure of the bacterial ribosome from escherichia 3.5 a resolution. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib is described in remark 400.
5. " " " " " "  = 2awb:W *
Crystal structure of the bacterial ribosome from escherichia 3.5 a resolution. This file contains the 50s subunit of the 70s ribosome. The entire crystal structure contains two 70s and is described in remark 400.
6. " " " " " "  = 2gya:U *
Structure of the 50s subunit of a pre-translocational e. Coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-em map emd-1056
7. " " " " " "  = 2gyc:U *
Structure of the 50s subunit of a secm-stalled e. Coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-em map emd-1143
8. " " " " " "  = 2j28:W *
Model of e. Coli srp bound to 70s rncs
9. " " " " " "  = 2rdo:W *
50s subunit with ef-g(gdpnp) and rrf bound
10. " " " " " "  = 2vhm:W *
Structure of pdf binding helix in complex with the ribosome (part 1 of 4)
11. " " " " " "  = 2vhn:W *
Structure of pdf binding helix in complex with the ribosome. (Part 2 of 4)
12. " " " " " "  = 3bbx:W *
The hsp15 protein fitted into the low resolution cryo-em map 50s.Nc-tRNA.Hsp15 complex
13. " " " " " "  = 3e1b:P *
Structure of the 50s subunit of e. Coli ribosome in pre-acco state
14. " " " " " "  = 3e1d:P *
Structure of the 50s subunit of e. Coli ribosome in post-acc state
15. " " " " " "  = 3izt:X *
Structural insights into cognate vs. Near-cognate discrimina during decoding. This entry contains the large subunit of a programmed with a near-cognate codon.
16. " " " " " "  = 3izu:X *
Structural insights into cognate vs. Near-cognate discrimina during decoding. This entry contains the large subunit of a programmed with a cognate codon
17. " " " " " "  = 3j01:W *
Structure of the ribosome-secye complex in the membrane envi
18. " " " " " "  = 3j0t:Y *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class2 of the six classes)
19. " " " " " "  = 3j0w:Y *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 4a of the six classes)
20. " " " " " "  = 3j0y:Y *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 4b of the six classes)
21. " " " " " "  = 3j11:Y *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 3 of the six classes)
22. " " " " " "  = 3j12:Y *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 5 of the six classes)
23. " " " " " "  = 3j14:Y *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 6 of the six classes)
24. " " " " " "  = 3j37:0 *
Tetracycline resistance protein tet(o) bound to the ribosome
25. 519 100.0% 79 79 721.6 3.2e-33 1vt2:W * Crystal structure of the e. Coli ribosome bound to cem-101. Contains the 50s subunit of the second 70s ribosome.
26. " " " " " "  = 2i2t:W *
Crystal structure of ribosome with messenger RNA and the anticodon stem-loop of p-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
27. " " " " " "  = 2i2v:W *
Crystal structure of ribosome with messenger RNA and the anticodon stem-loop of p-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
28. " " " " " "  = 2qam:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with neomycin. This file contains the 50s subunit of the first 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
29. " " " " " "  = 2qao:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with neomycin. This file contains the 50s subunit of the second 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
30. " " " " " "  = 2qba:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin. This file contains the 50s subunit of the first 70s ribosome, with gentamicin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
31. " " " " " "  = 2qbc:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin. This file contains the 50s subunit of the second 70s ribosome, with gentamicin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
32. " " " " " "  = 2qbe:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
33. " " " " " "  = 2qbg:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
34. " " " " " "  = 2qbi:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin and ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with gentamicin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
35. " " " " " "  = 2qbk:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin and ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with gentamicin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
36. " " " " " "  = 2qov:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin. This file contains the 50s subunit of the first 70s ribosome. The entire crystal structure contains two 70s ribosomes.
37. " " " " " "  = 2qox:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin. This file contains the 50s subunit of the second 70s ribosome. The entire crystal structure contains two 70s ribosomes.
38. " " " " " "  = 2qoz:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin and neomycin. This file contains the 50s subunit of the first 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes.
39. " " " " " "  = 2qp1:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin and neomycin. This file contains the 50s subunit of the second 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes.
40. " " " " " "  = 2wwq:Y *
E.Coli 70s ribosome stalled during translation of tnac leader peptide. This file contains the 50s, the p-site tRNA and the tnac leader peptide (part 2 of 2).
41. " " " " " "  = 2z4l:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with paromomycin and ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with paromomycin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
42. " " " " " "  = 2z4n:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with paromomycin and ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with paromomycin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
43. " " " " " "  = 3df2:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with hygromycin b. This file contains the 50s subunit of the first 70s ribosome. The entire crystal structure contains two 70s ribosomes.
44. " " " " " "  = 3df4:W *
Crystal structure of the bacterial ribosome from escherichia coli in complex with hygromycin b. This file contains the 50s subunit of the second 70s ribosome. The entire crystal structure contains two 70s ribosomes.
45. " " " " " "  = 3fik:W *
Ternary complex-bound e.Coli 70s ribosome. This entry consis 50s subunit.
46. " " " " " "  = 3i1n:W *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
47. " " " " " "  = 3i1p:W *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
48. " " " " " "  = 3i1r:W *
Crystal structure of the e. Coli 70s ribosome in an intermed of ratcheting
49. " " " " " "  = 3i1t:W *
Crystal structure of the e. Coli 70s ribosome in an intermed of ratcheting
50. " " " " " "  = 3i20:W *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
51. " " " " " "  = 3i22:W *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
52. " " " " " "  = 3j4x:W *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic pre- translocation state (pre1b, 50s subunit)
53. " " " " " "  = 3j50:W *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (pre2, 50s subunit)
54. " " " " " "  = 3j51:W *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (pre3, 50s subunit)
55. " " " " " "  = 3j52:W *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic pre- translocation state (pre1a, 50s subunit)
56. " " " " " "  = 3j54:W *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre4, 50s subunit)
57. " " " " " "  = 3j56:W *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre5a, 50s subunit)
58. " " " " " "  = 3j58:W *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre5b, 50s subunit)
59. " " " " " "  = 3j5a:W *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic post translocation state (post1, 50s subunit)
60. " " " " " "  = 3j5c:W *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post2a, 50s subunit)
61. " " " " " "  = 3j5e:W *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post2b, 50s subunit)
62. " " " " " "  = 3j5g:W *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post3a, 50s subunit)
63. " " " " " "  = 3j5i:W *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post3b, 50s subunit)
64. " " " " " "  = 3j5k:W *
E. Coli 70s-fmetval-trnaval post-translocation complex (post subunit)
65. " " " " " "  = 3j5o:W *
Visualization of two trnas trapped in transit during ef-g-me translocation (50s subunit)
66. " " " " " "  = 3kcr:W *
Ribosome-secy complex. This entry 3kcr contains 50s ribosomal subnit. The 30s ribosomal subunit can be found in PDB entry 3kc4
67. " " " " " "  = 3oas:W *
Crystal structure of the e. Coli ribosome bound to telithrom file contains the 50s subunit of the second 70s ribosome.
68. " " " " " "  = 3oat:W *
Crystal structure of the e. Coli ribosome bound to telithrom file contains the 50s subunit of the first 70s ribosome wit telithromycin bound.
69. " " " " " "  = 3ofc:W *
Crystal structure of the e. Coli ribosome bound to chloramph this file contains the 50s subunit of the first 70s ribosom chloramphenicol bound.
70. " " " " " "  = 3ofd:W *
Crystal structure of the e. Coli ribosome bound to chloramph this file contains the 50s subunit of the second 70s riboso
71. " " " " " "  = 3ofq:W *
Crystal structure of the e. Coli ribosome bound to erythromy file contains the 50s subunit of the second 70s ribosome.
72. " " " " " "  = 3ofr:W *
Crystal structure of the e. Coli ribosome bound to erythromy file contains the 50s subunit of the first 70s ribosome wit erthromycin bound.
73. " " " " " "  = 3ofz:W *
Crystal structure of the e. Coli ribosome bound to clindamyc file contains the 50s subunit of the first 70s ribosome bou clindamycin.
74. " " " " " "  = 3og0:W *
Crystal structure of the e. Coli ribosome bound to clindamyc file contains the 50s subunit of the second 70s ribosome.
75. " " " " " "  = 3orb:W *
Crystal structure of the e. Coli ribosome bound to cem-101. Contains the 50s subunit of the first 70s ribosome bound to
76. " " " " " "  = 3sgf:0 *
Crystal structure of release factor rf3 trapped in the gtp s rotated conformation of the ribosome
77. " " " " " "  = 3uos:0 *
Crystal structure of release factor rf3 trapped in the gtp s rotated conformation of the ribosome (without viomycin)
78. " " " " " "  = 4kix:W *
Control of ribosomal subunit rotation by elongation factor g
79. " " " " " "  = 4kiz:W *
Control of ribosomal subunit rotation by elongation factor g
80. " " " " " "  = 4kj1:W *
Control of ribosomal subunit rotation by elongation factor g
81. " " " " " "  = 4kj3:W *
Control of ribosomal subunit rotation by elongation factor g
82. " " " " " "  = 4kj5:W *
Control of ribosomal subunit rotation by elongation factor g
83. " " " " " "  = 4kj7:W *
Control of ribosomal subunit rotation by elongation factor g
84. " " " " " "  = 4kj9:W *
Control of ribosomal subunit rotation by elongation factor g
85. " " " " " "  = 4kjb:W *
Control of ribosomal subunit rotation by elongation factor g
86. 498 100.0% 76 76 693.2 1.2e-31 3j19:W * Structure of the bacterial ribosome complexed by tmrna-smpb during translocation and mld-loading (50s subunit)
87. " " " " " "  = 3j5u:Y *
Structure of the ribosome with elongation factor g trapped i translocation state (pre-translocation 70s tRNA structure, subunit)
88. " " " " " "  = 3j5w:Z *
Structure of the ribosome with elongation factor g trapped i translocation state (pre-translocation 70s tRNA Ef-g struct subunit)
89. " " " " " "  = 3r8s:W *
Structures of the bacterial ribosome in classical and hybrid tRNA binding
90. " " " " " "  = 4gau:W *
Allosteric control of the ribosome by small-molecule antibio
91. " " " " " "  = 4peb:W *
Crystal structure of the e. Coli ribosome bound to quinupris file contains the 50s subunit of the first 70s ribosome wit quinupristin bound.
92. " " " " " "  = 4tom:W *
Crystal structure of the e. Coli ribosome bound to linoprist file contains the 50s subunit of the first 70s ribosome wit linopristin bound.
93. " " " " " "  = 4tov:W *
Crystal structure of the e. Coli ribosome bound to flopristi file contains the 50s subunit of the first 70s ribosome wit flopristin bound.
94. " " " " " "  = 4tp1:W *
Crystal structure of the e. Coli ribosome bound to dalfopris file contains the 50s subunit of the first 70s ribosome wit dalfopristin bound.
95. " " " " " "  = 4tp5:W *
Crystal structure of the e. Coli ribosome bound to virginiam this file contains the 50s subunit of the first 70s ribosom virginiamycin m1 bound.
96. " " " " " "  = 4tp9:W *
Crystal structure of the e. Coli ribosome bound to dalfopris quinupristin. This file contains the 50s subunit of the fir ribosome with dalfopristin and quinupristin bound.
97. " " " " " "  = 4tpd:W *
Crystal structure of the e. Coli ribosome bound to flopristi linopristin. This file contains the 50s subunit of the firs ribosome with flopristin and linopristin bound.
98. 493 100.0% 75 75 686.5 2.9e-31 3r8t:W * Structures of the bacterial ribosome in classical and hybrid tRNA binding
99. " " " " " "  = 4gar:W *
Allosteric control of the ribosome by small-molecule antibio
100. " " " " " "  = 4pec:W *
Crystal structure of the e. Coli ribosome bound to quinupris file contains the 50s subunit of the second 70s ribosome wi quinupristin bound.
101. " " " " " "  = 4too:W *
Crystal structure of the e. Coli ribosome bound to linoprist file contains the 50s subunit of the second 70s ribosome wi linopristin bound.
102. " " " " " "  = 4tox:W *
Crystal structure of the e. Coli ribosome bound to flopristi file contains the 50s subunit of the second 70s ribosome wi flopristin bound.
103. " " " " " "  = 4tp3:W *
Crystal structure of the e. Coli ribosome bound to dalfopris file contains the 50s subunit of the second 70s ribosome wi dalfopristin bound.
104. " " " " " "  = 4tp7:W *
Crystal structure of the e. Coli ribosome bound to virginiam this file contains the 50s subunit of the second 70s riboso virginiamycin m1 bound.
105. " " " " " "  = 4tpb:W *
Crystal structure of the e. Coli ribosome bound to dalfopris quinupristin. This file contains the 50s subunit of the sec ribosome with dalfopristin and quinupristin bound.
106. " " " " " "  = 4tpf:W *
Crystal structure of the e. Coli ribosome bound to flopristi linopristin. This file contains the 50s subunit of the seco ribosome with flopristin and linopristin bound.
107. 445 100.0% 68 68 621.6 1.2e-27 1p85:U * Real space refined coordinates of the 50s subunit fitted int resolution cryo-em map of the ef-g.Gtp state of e. Coli 70s
108. " " " " " "  = 1p86:U *
Real space refined coordinates of the 50s subunit fitted int resolution cryo-em map of the initiation-like state of e. C ribosome
109. 356 69.9% 83 84 498.9 8.2e-21 1y69:U * Rrf domain i in complex with the 50s ribosomal subunit from deinococcus radiodurans
110. " " " " " "  = 2zjp:T *
Thiopeptide antibiotic nosiheptide bound to the large riboso subunit of deinococcus radiodurans
111. " " " " " "  = 2zjq:T *
Interaction of l7 with l11 induced by microccocin binding to deinococcus radiodurans 50s subunit
112. " " " " " "  = 2zjr:T *
Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
113. " " " " " "  = 3cf5:T *
Thiopeptide antibiotic thiostrepton bound to the large ribos subunit of deinococcus radiodurans
114. " " " " " "  = 3dll:T *
The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
115. " " " " " "  = 4io9:T *
Crystal structure of compound 4d bound to large ribosomal su (50s) from deinococcus radiodurans
116. " " " " " "  = 4ioa:T *
Crystal structure of compound 4e bound to large ribosomal su (50s) from deinococcus radiodurans
117. " " " " " "  = 4ioc:T *
Crystal structure of compound 4f bound to large ribosomal su (50s) from deinococcus radiodurans
118. 356 69.9% 83 86 498.8 8.3e-21 1kc9:U * Crystal structure of the large ribosomal subunit from deinococcus radiodurans
119. " " " " " "  = 1kpj:U *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
120. " " " " " "  = 1lnr:U *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
121. " " " " " "  = 1nkw:U *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
122. " " " " " "  = 1nwx:U *
Complex of the large ribosomal subunit from deinococcus radiodurans with abt-773
123. " " " " " "  = 1nwy:U *
Complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin
124. " " " " " "  = 1pnu:U *
Crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. This file, 1pnu, contains only molecules of the 50s ribosomal subunit. The 30s subunit, mRNA, p-site tRNA, and a-site tRNA are in the PDB file 1pns.
125. " " " " " "  = 1pny:U *
Crystal structure of the wild type ribosome from e. Coli, 50s subunit of 70s ribosome. This file, 1pny, contains only molecules of the 50s ribosomal subunit. The 30s subunit is in the PDB file 1pnx.
126. " " " " " "  = 1sm1:U *
Complex of the large ribosomal subunit from deinococcus radi with quinupristin and dalfopristin
127. " " " " " "  = 1vor:X *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
128. " " " " " "  = 1vou:X *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
129. " " " " " "  = 1vow:X *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
130. " " " " " "  = 1voy:X *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
131. " " " " " "  = 1vp0:X *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
132. " " " " " "  = 1xbp:U *
Inhibition of peptide bond formation by pleuromutilins: the structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with tiamulin
133. " " " " " "  = 1yl3:3 *
Crystal structure of 70s ribosome with thrs operator and trn subunit. The coordinates for the small subunit are in the p 1yl4.
134. " " " " " "  = 2b66:0 *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400
135. " " " " " "  = 2b9n:0 *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400.
136. " " " " " "  = 2b9p:0 *
50s ribosomal subunit from a crystal structure of the riboso complex with trnas and mRNA with a stop codon in the a-site file contains the 50s subunit from a crystal structure of t ribosome in complex with trnas and mRNA with a stop codon i site and is described in remark 400.
137. 333 64.2% 81 86 467.4 4.7e-19 3bbo:X Homology model for the spinach chloroplast 50s subunit fitte cryo-em map of the 70s chlororibosome
138. 326 66.2% 77 85 457.9 1.6e-18 2hgj:Z * Crystal structure of the 70s thermus thermophilus ribosome s the 16s 3'-end mimicks mRNA e and p codons. This entry 2hgj 50s ribosomal subunit. The 30s ribosomal subunit can be fou entry 2hgi.
139. " " " " " "  = 2hgq:Z *
Crystal structure of the 70s thermus thermophilus ribosome w translocated and rotated shine-dalgarno duplex. This entry contains 50s ribosomal subunit. The 30s ribosomal subunit c found in PDB entry 2hgp.
140. " " " " " "  = 2hgu:Z *
70s t.Th. Ribosome functional complex with mRNA and e- and p trnas at 4.5a. This entry 2hgu contains 50s ribosomal subun 30s ribosomal subunit can be found in PDB entry 2hgr.
141. " " " " " "  = 2j01:0 *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 2 of 4). This file contains the 50s subunit from molecule i.
142. " " " " " "  = 2j03:0 *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50s subunit from molecule ii.
143. " " " " " "  = 3fin:0 *
T. Thermophilus 70s ribosome in complex with mRNA, trnas and tu.Gdp.Kirromycin ternary complex, fitted to a 6.4 a cryo-e this file contains the 50s subunit.
144. " " " " " "  = 3oh5:0 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
145. " " " " " "  = 3oh7:0 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
146. " " " " " "  = 3ohj:0 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
147. " " " " " "  = 3ohk:0 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
148. " " " " " "  = 3ohz:0 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
149. " " " " " "  = 3oi1:0 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
150. " " " " " "  = 3oi3:0 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
151. " " " " " "  = 3oi5:0 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
152. 323 66.2% 77 85 453.8 2.7e-18 2v47:0 * Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 2 of 4). This file contains the 50s subunit for molecule 1.
153. " " " " " "  = 2v49:0 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 4 of 4). This file contains the 50s subunit of molecule 2.
154. 319 65.8% 76 82 448.6 5.2e-18 1vvm:0 * Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u on the ribosome
155. " " " " " "  = 1vvo:0 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u on the ribosome
156. " " " " " "  = 1vvq:0 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-a on the ribosome
157. " " " " " "  = 1vvs:0 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-a on the ribosome
158. " " " " " "  = 1vvu:0 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccg-g on the ribosome
159. " " " " " "  = 1vvw:0 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccg-g on the ribosome
160. " " " " " "  = 1vvy:0 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u in the absence of paromomycin
161. " " " " " "  = 1vw0:0 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u in the absence of paromomycin
162. " " " " " "  = 1vx9:0 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-u ribosome
163. " " " " " "  = 1vxj:0 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-u ribosome
164. " " " " " "  = 1vxl:0 *
Crystal structure of tRNA proline (cgg) bound to codon ccg-g ribosome
165. " " " " " "  = 1vxn:0 *
Crystal structure of tRNA proline (cgg) bound to codon ccg-g ribosome
166. " " " " " "  = 1vxq:0 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-g ribosome
167. " " " " " "  = 1vxt:0 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-g ribosome
168. " " " " " "  = 1vy1:0 *
Crystal structure of unmodified tRNA proline (cgg) bound to on the ribosome
169. " " " " " "  = 1vy3:0 *
Crystal structure of unmodified tRNA proline (cgg) bound to on the ribosome
170. " " " " " "  = 4kx0:0 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-g on the ribosome
171. " " " " " "  = 4kx2:0 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-g on the ribosome
172. 319 65.8% 76 83 448.5 5.2e-18 4qcn:0 * Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing acylated substrates in the a and p sites. This entry contains the 50 of the first 70s ribosome in the asu.
173. " " " " " "  = 4qcp:0 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing acylated substrates in the a and p sites. This entry contains the 50 of the second 70s ribosome in the asu.
174. " " " " " "  = 4qcr:0 *
Crystal structure of the thermus thermophilus 70s ribosome i post-catalysis state of peptide bond formation containing d tRNA in the a site and deacylated tRNA in the p site. This contains the 50s subunit of the first 70s ribosome in the a
175. " " " " " "  = 4qct:0 *
Crystal structure of the thermus thermophilus 70s ribosome i post-catalysis state of peptide bond formation containing d tRNA in the a site and deacylated tRNA in the p site. This contains the 50s subunit of the second 70s ribosome in the
176. " " " " " "  = 4qcv:0 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-puromycin in the a site and acylated tRNA in site. This entry contains the 50s subunit of the first 70s in the asu.
177. " " " " " "  = 4qcx:0 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-puromycin in the a site and acylated tRNA in site. This entry contains the 50s subunit of the second 70s in the asu.
178. " " " " " "  = 4qcz:0 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-cytidine-puromycin in the a site and acylate the p site. This entry contains the 50s subunit of the firs ribosome in the asu.
179. " " " " " "  = 4qd1:0 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-cytidine-puromycin in the a site and acylate the p site. This entry contains the 50s subunit of the seco ribosome in the asu.
180. 319 65.8% 76 84 448.4 5.3e-18 2wdi:0 * Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule i.
181. " " " " " "  = 2wdj:0 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule ii.
182. " " " " " "  = 2wdl:0 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule i.
183. " " " " " "  = 2wdn:0 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule ii.
184. " " " " " "  = 2wrj:0 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state (part 2 of 4).
185. " " " " " "  = 2wrl:0 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state. (Part 4 of 4).
186. " " " " " "  = 2wro:0 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 2 of 4).
187. " " " " " "  = 2wrr:0 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 4 of 4).
188. " " " " " "  = 2xg0:0 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 2 of 4)
189. " " " " " "  = 2xg2:0 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 4 of 4)
190. " " " " " "  = 2xqe:0 *
The structure of ef-tu and aminoacyl-tRNA bound to the 70s ribosome with a gtp analog
191. " " " " " "  = 2xtg:0 *
tRNA tranlocation on the 70s ribosome: the pre- translocational translocation intermediate ti(pre)
192. " " " " " "  = 2xux:0 *
tRNA translocation on the 70s ribosome: the post- translocational translocation intermediate ti(post)
193. " " " " " "  = 2y0v:0 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
194. " " " " " "  = 2y0x:0 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
195. " " " " " "  = 2y0z:0 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
196. " " " " " "  = 2y11:0 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
197. " " " " " "  = 2y13:0 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
198. " " " " " "  = 2y15:0 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a cognate codon on the 70s ribosome.
199. " " " " " "  = 2y17:0 *
Ef-tu complex 3
200. " " " " " "  = 2y19:0 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
201. " " " " " "  = 3huz:0 *
Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule ii.
202. " " " " " "  = 3i8f:3 *
Elongation complex of the 70s ribosome with three trnas and entry 3i8f contains 50s ribosomal subunit. The 30s ribosoma can be found in PDB entry 3i8g. Molecule b in the same asym unit is deposited as 3i8g (30s) and 3i8f (50s).
203. " " " " " "  = 3i8i:3 *
Elongation complex of the 70s ribosome with three trnas and entry 3i8i contains 50s ribosomal subnit. The 30s ribosomal can be found in PDB entry 3i8h. Molecule a in the same asym unit is deposited as 3i8f (50s) and 3i8g (30s).
204. " " " " " "  = 3kir:0 *
Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 2 of 4)
205. " " " " " "  = 3kit:0 *
Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 4 of 4)
206. " " " " " "  = 3kiw:0 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 2 of 4)
207. " " " " " "  = 3kiy:0 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 4 of 4)
208. " " " " " "  = 3kni:0 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule i
209. " " " " " "  = 3knk:0 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule ii.
210. " " " " " "  = 3knm:0 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule i.
211. " " " " " "  = 3kno:0 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule ii
212. " " " " " "  = 3v6w:0 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit
213. " " " " " "  = 3v6x:0 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit
214. " " " " " "  = 3zn9:0 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
215. " " " " " "  = 3zne:0 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
216. " " " " " "  = 3zvp:0 *
Crystal structure of the hybrid state of ribosome in complex the guanosine triphosphatase release factor 3
217. " " " " " "  = 4abs:0 *
Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin w 70s ribosome
218. " " " " " "  = 4b8g:0 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
219. " " " " " "  = 4b8i:0 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
220. " " " " " "  = 4btd:0 *
Thermus thermophilus ribosome
221. " " " " " "  = 4byc:0 *
Structure of thermus thermophilus 50s ribosome
222. " " " " " "  = 4bye:0 *
Structure of thermus thermophilus 50s ribosome
223. " " " " " "  = 4ejb:0 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit.
224. " " " " " "  = 4ejc:0 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit.
225. " " " " " "  = 4jux:0 *
Crystal structure of the ribosome bound to elongation factor guanosine triphosphatase state (this file contains the 50s
226. " " " " " "  = 4k0m:0 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
227. " " " " " "  = 4k0q:0 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
228. " " " " " "  = 4kbu:0 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit a. The full asymmetric unit contains PDB entries 4kbt (30s subunit a), 4kbv (30s subuni 4kbw (50s subunit b).
229. " " " " " "  = 4kbw:0 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit b. The full asymmetric unit contains PDB entries 4kbv (30s subunit b), 4kbt (30s subuni 4kbu (50s subunit a).
230. " " " " " "  = 4kcz:0 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state.T contains the 50s ribosomal subunit a. The 30s subunit a can in 4kcy. Molecule b in the same asymmetric unit is deposite (30s) and 4kd2 (50s).G1 50s ribosomal subunit i
231. " " " " " "  = 4kd2:0 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains the 50s ribosomal subunit b. The 30s subunit b can in 4kd0. Molecule a in the same asymmetric unit is deposite (30s) and 4kcz (50s).
232. " " " " " "  = 4kd9:0 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kd8. Molecule b in the same asymmetric uni deposited as 4kda (30s) and 4kdb (50s).
233. " " " " " "  = 4kdb:0 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kda. Molecule a in the same asymmetric uni deposited as 4kd8 (30s) and 4kd9 (50s).
234. " " " " " "  = 4kdh:0 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kdg. Molecule b in the same asymmetric uni deposited as 4kdj (30s) and 4kdk (50s).
235. " " " " " "  = 4kdk:0 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kdj. Molecule a in the same asymmetric uni deposited as 4kdg (30s) and 4kdh (50s).
236. 315 71.2% 73 74 443.8 9.6e-18 3pio:T * Crystal structure of the synergistic antibiotic pair lankamy lankacidin in complex with the large ribosomal subunit
237. " " " " " "  = 3pip:T *
Crystal structure of the synergistic antibiotic pair lankamy lankacidin in complex with the large ribosomal subunit
238. 314 65.3% 75 83 441.7 1.3e-17 2x9s:0 * Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
239. " " " " " "  = 2x9u:0 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
240. 296 65.7% 70 77 417.6 2.8e-16 3i9e:3 Initiation complex of 70s ribosome with two trnas and mRNA. 3i9e contains 50s ribosomal subunit of molecule a. The 30s subunit can be found in PDB entry 3i9d. Molecule b in the s asymmetric unit is deposited as 3i9b (30s) and 3i9c (50s)
241. 296 65.7% 70 80 417.4 2.8e-16 3i9c:3 Initiation complex of 70s ribosome with two trnas and mRNA. 3i9c contains 50s ribosomal subunit of molecule b. The 30s subunit can be found in PDB entry 3i9b. Molecule a in the s asymmetric unit is deposited as 3i9d (30s) and 3i9e (50s)
242. 288 65.2% 69 76 406.8 1.1e-15 3uxq:0 * The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
243. " " " " " "  = 3uxr:0 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
244. " " " " " "  = 3v23:0 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
245. " " " " " "  = 3v25:0 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 2nd ribosom asu
246. " " " " " "  = 3v27:0 *
Crystal structure of hpf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
247. " " " " " "  = 3v29:0 *
Crystal structure of hpf bound to the 70s ribosome. This ent contains the 50s subunit of the 2nd molecule in the asu.
248. " " " " " "  = 3v2d:0 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 1st ribosom asu
249. " " " " " "  = 4dha:0 *
Crystal structure of yaej bound to the 70s ribosome
250. 288 65.2% 69 77 406.7 1.1e-15 3hux:0 * Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule i.
251. " " " " " "  = 3tvh:3 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-leu complex
252. " " " " " "  = 3uyg:3 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
253. " " " " " "  = 3uz2:3 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-leu complex with paromomycin.
254. " " " " " "  = 3uz8:3 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-tyr complex.
255. " " " " " "  = 3uzh:3 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex.
256. " " " " " "  = 3uzn:3 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex with paromomycin
257. " " " " " "  = 3v2f:0 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 2nd ribosom asu
258. " " " " " "  = 4dhc:0 *
Crystal structure of yaej bound to the 70s ribosome
259. " " " " " "  = 4g5n:3 *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule b.
260. " " " " " "  = 4g5w:3 *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule b.
261. 283 64.7% 68 76 400.0 2.7e-15 1vs9:U * Crystal structure of a 70s ribosome-tRNA complex reveals functional interactions and rearrangements. This file, 1vs9, contains the 50s ribosome subunit. 30s ribosome subunit is in the file 2i1c
262. " " " " " "  = 2jl6:0 *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 2 of 4). This file contains the 50s subunit.
263. " " " " " "  = 2jl8:0 *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 4 of 4). This file contains the 50s subunit.
264. " " " " " "  = 2wh2:0 *
Insights into translational termination from the structure of rf2 bound to the ribosome
265. " " " " " "  = 2wh4:0 *
Insights into translational termination from the structure of rf2 bound to the ribosome
266. " " " " " "  = 3tve:3 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-leu complex
267. " " " " " "  = 3uye:3 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
268. " " " " " "  = 3uz1:3 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex with paromomycin
269. " " " " " "  = 3uz9:3 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-tyr complex.
270. " " " " " "  = 3uzf:3 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex
271. " " " " " "  = 3uzk:3 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex with paromomycin
272. " " " " " "  = 4g5l:3 *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule a.
273. " " " " " "  = 4g5u:3 *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule a.

Number of sequences: 273

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 279 63.2% 68 76 394.5 5.3e-15 1vsa:U * Crystal structure of a 70s ribosome-tRNA complex reveals fun interactions and rearrangements. This file, 1vsa, contains ribosome subunit. 30s ribosome subunit is in the file 2ow8
2. " " " " " "  = 1vsp:U *
Interactions and dynamics of the shine-dalgarno helix in the ribosome. This file, 1vsp, contains the 50s ribosome subuni ribosome subunit is in the file 2qnh
3. " " " " " "  = 3d5b:0 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of one 70s ribosome. The enti structure contains two 70s ribosomes as described in remark
4. " " " " " "  = 3d5d:0 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of the second 70s ribosome. T crystal structure contains two 70s ribosomes as described i 400.
5. " " " " " "  = 3f1f:0 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of o ribosome. The entire crystal structure contains two 70s rib described in remark 400.
6. " " " " " "  = 3f1h:0 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of t 70s ribosome. The entire crystal structure contains two 70s as described in remark 400.
7. " " " " " "  = 3mrz:W *
Recognition of the amber stop codon by release factor rf1. T 3mrz contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3ms0. Molecule a in the same asymmetric deposited as 3mr8 (50s) and 3ms1 (30s).
8. " " " " " "  = 3ms1:W *
Recognition of the amber stop codon by release factor rf1. T 3ms1 contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3mr8. Molecule b in the same asymmetric deposited as 3mrz (50s) and 3ms0 (30s).
9. " " " " " "  = 3pyo:W *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the first 70s ribosome.
10. " " " " " "  = 3pyr:W *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the second 70s ribosome.
11. " " " " " "  = 3pyt:W *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the first 70s ribosome.
12. " " " " " "  = 3pyv:W *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the second 70s ribosome.
13. " " " " " "  = 4kfi:0 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the a subunit
14. " " " " " "  = 4kfl:0 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the b subunit
15. " " " " " "  = 4l6j:W *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the first 70s ribosome.
16. " " " " " "  = 4l6l:W *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the second 70s ribosome
17. 223 60.3% 58 66 319.0 8.6e-11 1v8q:A Crystal structure of ribosomal protein l27 from thermus thermophilus hb8
18. 193 43.5% 69 69 277.8 1.7e-08 2ftc:O * Structural model for the large subunit of the mammalian mito ribosome
19. " " " " " "  = 3iy9:O *
Leishmania tarentolae mitochondrial large ribosomal subunit model
20. 163 36.0% 75 76 236.3 3.5e-06 4ce4:0 39s large subunit of the porcine mitochondrial ribosome
21. 84 26.1% 69 121 125.7 5 1pkq:E Myelin oligodendrocyte glycoprotein-(8-18c5) fab-complex
22. 84 26.1% 69 124 125.5 5.1 1pko:A Myelin oligodendrocyte glycoprotein (mog)
23. 80 26.2% 65 116 120.5 9.8 1py9:A The crystal structure of an autoantigen in multiple sclerosis
24. 85 31.6% 57 543 117.8 14 3do6:A Crystal structure of putative formyltetrahydrofolate synthetase (tm1766) from thermotoga maritima at 1.85 a resolution
25. 84 32.6% 46 442 117.7 14 4kk8:A Structure of the e148q mutant of clc-ec1 deltanc construct i fluoride
26. 84 32.6% 46 444 117.6 14 1otu:A * Structure of the escherichia coli clc chloride channel e148q mutant and fab complex
27. " " " " " "  = 2exy:A *
Crystal structure of the e148q mutant of ecclc, fab complexed in absence of bound ions
28. 84 32.6% 46 444 117.6 14 2ez0:A Crystal structure of the s107a/e148q/y445a mutant of ecclc, in complex with a fab fragment
29. 84 32.6% 46 444 117.6 14 4lou:A Structure of the e148q mutant of clc-ec1 deltanc construct i absence of halide
30. 83 32.6% 46 432 116.4 16 4ftp:A Structure of the e202y mutant of the cl-/h+ antiporter clc-e e.Coli
31. 83 32.6% 46 444 116.3 17 1ots:A * Structure of the escherichia coli clc chloride channel and fab complex
32. " " " " " "  = 2exw:A *
Crystal structure of a ecclc-fab complex in the absence of bound ions
33. 83 32.6% 46 444 116.3 17 2fec:A * Structure of the e203q mutant of the cl-/h+ exchanger clc- ec1 from e.Coli
34. " " " " " "  = 2fed:A *
Structure of the e203q mutant of the cl-/h+ exchanger clc- ec1 from e.Coli
35. 83 32.6% 46 444 116.3 17 2fee:A * Structure of the cl-/h+ exchanger clc-ec1 from e.Coli in nabr
36. " " " " " "  = 2h2p:A *
Crystal structure of clc-ec1 in complex with fab fragment in secn-
37. 83 32.6% 46 444 116.3 17 2hlf:A Structure of the escherichis coli clc chloride channel y445e mutant and fab complex
38. 83 32.6% 46 444 116.3 17 2ht2:A Structure of the escherichia coli clc chloride channel y445h mutant and fab complex
39. 83 32.6% 46 444 116.3 17 2ht3:A Structure of the escherichia coli clc chloride channel y445l mutant and fab complex
40. 83 32.6% 46 444 116.3 17 2ht4:A Structure of the escherichia coli clc chloride channel y445w mutant and fab complex
41. 83 32.6% 46 444 116.3 17 2htk:A Structure of the escherichia coli clc chloride channel y445a mutant and fab complex
42. 83 32.6% 46 444 116.3 17 2htl:A Structure of the escherichia coli clc chloride channel y445f mutant and fab complex
43. 83 32.6% 46 444 116.3 17 2r9h:A Crystal structure of q207c mutant of clc-ec1 in complex with
44. 83 32.6% 46 444 116.3 17 3ejy:A Structure of e203h mutant of e.Coli cl-/h+ antiporter, clc-e
45. 83 32.6% 46 444 116.3 17 3ejz:A Structure of e203v mutant e.Coli cl-/h+ exchanger, clc-ec1
46. 83 32.6% 46 439 116.3 17 3nmo:A Crystal structure of an engineered monomeric clc-ec1 cl-/h+ transporter
47. 83 32.6% 46 444 116.3 17 4ene:A Structure of the n- and c-terminal trimmed clc-ec1 cl-/h+ an and fab complex
48. 83 32.6% 46 443 116.3 17 4kjp:A Structure of the clc-ec1 deltanc construct in the absence of
49. 83 32.6% 46 444 116.3 17 4kjq:A * Structure of the clc-ec1 deltanc construct in 100mm fluoride
50. " " " " " "  = 4kjw:A *
Structure of the clc-ec1 deltanc construct in 100mm fluoride bromide
51. " " " " " "  = 4kk5:A *
Structure of the clc-ec1 deltanc construct in 20mm fluoride bromide
52. 83 32.6% 46 443 116.3 17 4kk6:A Structure of clc-ec1 deltanc construct in 20mm bromide
53. 83 32.6% 46 450 116.2 17 1kpk:A Crystal structure of the clc chloride channel from e. Coli
54. 83 30.3% 66 653 113.9 23 2xcq:A The 2.98a crystal structure of the catalytic core (b'a' region) of staphylococcus aureus DNA gyrase
55. 81 32.6% 46 444 113.6 24 1ott:A * Structure of the escherichia coli clc chloride channel e148a mutant and fab complex
56. " " " " " "  = 2h2s:A *
Crystal structure of e148a mutant of clc-ec1 in secn-
57. 81 32.6% 46 444 113.6 24 3det:A Structure of the e148a, y445a doubly ungated mutant of e.Col cl-/h+ antiporter
58. 81 32.6% 46 444 113.6 24 4fg6:A Structure of ecclc e148a mutant in glutamate
59. 81 32.6% 46 443 113.6 24 4kk9:A * Structure of the e148a mutant of clc-ec1 deltanc construct i fluoride and 2mm bromide
60. " " " " " "  = 4kka:A *
Structure of the e148a mutant of clc-ec1 deltanc construct i fluoride and 20mm bromide
61. 81 32.6% 46 444 113.6 24 4kkb:A * Structure of the e148a mutant of clc-ec1 deltanc construct i fluoride and 20mm bromide
62. " " " " " "  = 4kkc:A *
Structure of the e148a mutant of clc-ec1 deltanc construct i bromide
63. " " " " " "  = 4kkl:A *
Structure of the e148a mutant of clc-ec1 delta nc construct fluoride
64. 75 29.7% 37 160 111.7 30 2yyo:A Crystal sturcture of human spry domain
65. 77 36.8% 57 256 111.5 31 1cov:2 * Coxsackievirus b3 coat protein
66. " " " " " "  = 1jew:2 *
Cryo-em structure of coxsackievirus b3(m strain) with its cellular receptor, coxsackievirus and adenovirus receptor (car).
67. 73 24.6% 65 119 110.8 34 1q70:A Homology model of the extracellular domain of human myelin oligodendrocyte glycoprotein
68. 71 43.9% 41 85 110.1 37 2qkt:A * Crystal structure of the 5th pdz domain of inad
69. " " " " " "  = 2qku:A *
The 5th pdz domain of inad in 10mm dtt
70. 71 43.9% 41 90 109.7 39 2qku:C The 5th pdz domain of inad in 10mm dtt
71. 71 43.9% 41 92 109.6 40 2qkv:A Crystal structure of the c645s mutant of the 5th pdz domain of inad
72. 71 43.9% 41 106 108.7 44 2la8:A Solution structure of inad pdz5 complexed with kon-tiki pept

Number of sequences: 72

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer