spacer
spacer

SAS results for UniProt accession no. P0A7N4

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P0A7N4 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P0A7N4 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 18 unique sequences (including 11 consensus sequences) giving 299 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345     Protein name
       ---------+---------+---------+---------+---------+---------+-----     ------------
P0A7N4 -----------------------------------------------------------------     50S ribosomal protein L32 OS=Escherichia coli (strain K12)  ...
1vs6:0*-----------------------------------------------------------------×103 Crystal structure of the bacterial ribosome from  ...
1p85:Z*-----------------------------------------------------------------×4   Real space refined coordinates of the 50s subunit fitted  ...
3pio:Z*-----------------------------------------------------------------×2   Crystal structure of the synergistic antibiotic pair  ...
1j5a:M*-----------------------------------------------------------------×35  Structural basis for the interaction of antibiotics with  ...
2hgj:4*-----------------------------------------------------------------×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
3hux:5 -----------------------------------------------------------------     Structure of ef-p bound to the 70s ribosome; this file  ...
1vvs:5 -----------------------------------------------------------------     Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3uyg:5 -----------------------------------------------------------------     Crystal structure analysis of ribosomal decoding. This  ...
1vvm:5*-----------------------------------------------------------------×119 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3zn9:5*-----------------------------------------------------------------×4   The crystal structure of agmatidine tRNA-ile2 bound to the  ...
1vsa:Y*-----------------------------------------------------------------×2   Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3kir:5*-----------------------------------------------------------------×4   Structure of rele nuclease bound to the 70s ribosome  ...
1twv:P -----------------------------------------------------------------     Model structure of the t. Thermophilus 70s ribosome,50s  ...
3j3v:0*-----------------------------------------------------------------×2   Atomic model of the immature 50s subunit from bacillus  ...
3d5b:5*-----------------------------------------------------------------×14  Structural basis for translation termination on the 70s  ...
3ct9:A -----------------------------------------------------------------     Crystal structure of a putative zinc peptidase (np_812461. ...
2jy9:A -----------------------------------------------------------------     Nmr structure of putative tRNA hydrolase domain from  ...
3j3b:E vkkgnlkakkpkkgkphcsrnpvlvrgigrysrsamysrkamykrkysaakskvekkkkekvlat     Structure of the human 60s ribosomal proteins

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890     Protein name
       ----+---------+---------+---------+---------+---------+---------+     ------------
P0A7N4 -----------------------------------------------------------------     50S ribosomal protein L32 OS=Escherichia coli (strain K12)  ...
1vs6:0*-----------------------------------------------------------------×103 Crystal structure of the bacterial ribosome from  ...
1p85:Z*-----------------------------------------------------------------×4   Real space refined coordinates of the 50s subunit fitted  ...
3pio:Z*-----------------------------------------------------------------×2   Crystal structure of the synergistic antibiotic pair  ...
1j5a:M*-----------------------------------------------------------------×35  Structural basis for the interaction of antibiotics with  ...
2hgj:4*-----------------------------------------------------------------×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
3hux:5 -----------------------------------------------------------------     Structure of ef-p bound to the 70s ribosome; this file  ...
1vvs:5 -----------------------------------------------------------------     Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3uyg:5 -----------------------------------------------------------------     Crystal structure analysis of ribosomal decoding. This  ...
1vvm:5*-----------------------------------------------------------------×119 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3zn9:5*-----------------------------------------------------------------×4   The crystal structure of agmatidine tRNA-ile2 bound to the  ...
1vsa:Y*-----------------------------------------------------------------×2   Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3kir:5*-----------------------------------------------------------------×4   Structure of rele nuclease bound to the 70s ribosome  ...
1twv:P -----------------------------------------------------------------     Model structure of the t. Thermophilus 70s ribosome,50s  ...
3j3v:0*-----------------------------------------------------------------×2   Atomic model of the immature 50s subunit from bacillus  ...
3d5b:5*-----------------------------------------------------------------×14  Structural basis for translation termination on the 70s  ...
3ct9:A -----------------------------------------------------------------     Crystal structure of a putative zinc peptidase (np_812461. ...
2jy9:A -----------------------------------------------------------------     Nmr structure of putative tRNA hydrolase domain from  ...
3j3b:E vtkpvggdknggtrvvklrkmpryyptedvprkllshgkkpfsqhvrklrasitpgtiliiltgr     Structure of the human 60s ribosomal proteins

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345     Protein name
       ---------+---------+---------+---------+---------+---------+-----     ------------
P0A7N4 ---------------mavqqnkptrskrgmrrshdaltavtslsvdktsgekhlrhhit-ad-g-     50S ribosomal protein L32 OS=Escherichia coli (strain K12)  ...
1vs6:0*----------------avqqnkptrskrgmrrshdaltavtslsvdktsgekhlrhhit-ad-g-×103 Crystal structure of the bacterial ribosome from  ...
1p85:Z*------------------------------------------lsvdktsgekhlrhhit-ad-g-×4   Real space refined coordinates of the 50s subunit fitted  ...
3pio:Z*--------------khpvpkkktskskrdmrrshhaltapnltecpqchgkk-lshhic-pncg-×2   Crystal structure of the synergistic antibiotic pair  ...
1j5a:M*-------------akhpvpkkktskskrdmrrshhaltapnltecpqchgkk-lshhic-pncg-×35  Structural basis for the interaction of antibiotics with  ...
2hgj:4*---------------hpvpkkktskarrdarrshhaltpptlvpcpeckamkp-phtvc-pecg-×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
3hux:5 -------------akhpvpkkktskarrdarrshhaltpptlvpcpeckamkp-phtvc-pecg-     Structure of ef-p bound to the 70s ribosome; this file  ...
1vvs:5 -------------akhpvpkkktskarrdarrshhaltpptlvpcpeckamkp-phtvc-pecg-     Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3uyg:5 --------------khpvpkkktskarrdarrshhaltpptlvpcpeckamkp-phtvc-pecg-     Crystal structure analysis of ribosomal decoding. This  ...
1vvm:5*-------------akhpvpkkktskarrdarrshhaltpptlvpcpeckamkp-phtvc-pecg-×119 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3zn9:5*-------------akhpvpkkktskarrdarrshhaltpptlvpcpeckamkp-phtvc-pecg-×4   The crystal structure of agmatidine tRNA-ile2 bound to the  ...
1vsa:Y*----------------pvpkkktskarrdarrshhaltppilvpcpeckamkp-phtvc-pecg-×2   Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3kir:5*-------------akhpvpkkktskarrdarrshhaltpptlvpcpeckamkp-phtvc-pecg-×4   Structure of rele nuclease bound to the 70s ribosome  ...
1twv:P ---------------hpvpkkktskarrdarrshhaltppilvpcpeckamkp-phtvc-pecg-     Model structure of the t. Thermophilus 70s ribosome,50s  ...
3j3v:0*----------------avpfrrtskmkkrlrrthfkln-vpgmtecpscgemklshrvckac-g-×2   Atomic model of the immature 50s subunit from bacillus  ...
3d5b:5*-------------akhpvpkkktskarrdarrshhaltppilvpcpeckamkp-phtvc-pecg-×14  Structural basis for translation termination on the 70s  ...
3ct9:A --------------------ydiptmtaeavsllkslisipsisreetqaadflqnyie-ae-g-     Crystal structure of a putative zinc peptidase (np_812461. ...
2jy9:A ---------------miaisrtvsiadneleitairaqgaggqhvnktssaihlrfdir-as-gl     Nmr structure of putative tRNA hydrolase domain from  ...
3j3b:E hrgkrvvflkqlasglllvtgplvlnrvplrrthqkfviatstkidisnvk--ipkhlt--d-a-     Structure of the human 60s ribosomal proteins

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890     Protein name
       ----+---------+---------+---------+---------+---------+---------+     ------------
P0A7N4 --yyrgrkviak-----------------------------------------------------     50S ribosomal protein L32 OS=Escherichia coli (strain K12)  ...
1vs6:0*--yyrgrkviak-----------------------------------------------------×103 Crystal structure of the bacterial ribosome from  ...
1p85:Z*--yyrgrkvia------------------------------------------------------×4   Real space refined coordinates of the 50s subunit fitted  ...
3pio:Z*--yydgrqvla------------------------------------------------------×2   Crystal structure of the synergistic antibiotic pair  ...
1j5a:M*--yydgrqvla------------------------------------------------------×35  Structural basis for the interaction of antibiotics with  ...
2hgj:4*--yyagrkvlev-----------------------------------------------------×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
3hux:5 --yyagrkvl-------------------------------------------------------     Structure of ef-p bound to the 70s ribosome; this file  ...
1vvs:5 --yyagrkvle------------------------------------------------------     Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3uyg:5 --yyagrkvlev-----------------------------------------------------     Crystal structure analysis of ribosomal decoding. This  ...
1vvm:5*--yyagrkvlev-----------------------------------------------------×119 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3zn9:5*--yyagrkv--------------------------------------------------------×4   The crystal structure of agmatidine tRNA-ile2 bound to the  ...
1vsa:Y*--yyagrkvlev-----------------------------------------------------×2   Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3kir:5*--yyagrk---------------------------------------------------------×4   Structure of rele nuclease bound to the 70s ribosome  ...
1twv:P --yyagrkv--------------------------------------------------------     Model structure of the t. Thermophilus 70s ribosome,50s  ...
3j3v:0*--syngkdinv------------------------------------------------------×2   Atomic model of the immature 50s subunit from bacillus  ...
3d5b:5*--yya------------------------------------------------------------×14  Structural basis for translation termination on the 70s  ...
3ct9:A --mqtgrkgnnvwclspmfdlkkptillnshidtvkpvftpreengklyglgsndagasvvsllq     Crystal structure of a putative zinc peptidase (np_812461. ...
2jy9:A peyykqrlltashhlisddgviiikaqefrsqelnreaaiarlvavikeltaeqksrratrptra     Nmr structure of putative tRNA hydrolase domain from  ...
3j3b:E --yfkkkklrkprhqegeifdtekekyeiteqrkidqkavdsqilpkikaipqlqgylrsvfalt     Structure of the human 60s ribosomal proteins

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345     Protein name
       ---------+---------+---------+---------+---------+---------+-----     ------------
P0A7N4 -----------------------------------------------------------------     50S ribosomal protein L32 OS=Escherichia coli (strain K12)  ...
1vs6:0*-----------------------------------------------------------------×103 Crystal structure of the bacterial ribosome from  ...
1p85:Z*-----------------------------------------------------------------×4   Real space refined coordinates of the 50s subunit fitted  ...
3pio:Z*-----------------------------------------------------------------×2   Crystal structure of the synergistic antibiotic pair  ...
1j5a:M*-----------------------------------------------------------------×35  Structural basis for the interaction of antibiotics with  ...
2hgj:4*-----------------------------------------------------------------×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
3hux:5 -----------------------------------------------------------------     Structure of ef-p bound to the 70s ribosome; this file  ...
1vvs:5 -----------------------------------------------------------------     Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3uyg:5 -----------------------------------------------------------------     Crystal structure analysis of ribosomal decoding. This  ...
1vvm:5*-----------------------------------------------------------------×119 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3zn9:5*-----------------------------------------------------------------×4   The crystal structure of agmatidine tRNA-ile2 bound to the  ...
1vsa:Y*-----------------------------------------------------------------×2   Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3kir:5*-----------------------------------------------------------------×4   Structure of rele nuclease bound to the 70s ribosome  ...
1twv:P -----------------------------------------------------------------     Model structure of the t. Thermophilus 70s ribosome,50s  ...
3j3v:0*-----------------------------------------------------------------×2   Atomic model of the immature 50s subunit from bacillus  ...
3d5b:5*-----------------------------------------------------------------×14  Structural basis for translation termination on the 70s  ...
3ct9:A vflqlcrtsqnynliylasceeevsgkegiesvlpglppvsfaivgeptemqpaiaekglmvldv     Crystal structure of a putative zinc peptidase (np_812461. ...
2jy9:A skerrlsskaqkssvkalrgkvrrpldlehhhhhh------------------------------     Nmr structure of putative tRNA hydrolase domain from  ...
3j3b:E ngiyphklvf-------------------------------------------------------     Structure of the human 60s ribosomal proteins

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890     Protein name
       ----+---------+---------+---------+---------+---------+---------+     ------------
P0A7N4 -----------------------------------------------------------------     50S ribosomal protein L32 OS=Escherichia coli (strain K12)  ...
1vs6:0*-----------------------------------------------------------------×103 Crystal structure of the bacterial ribosome from  ...
1p85:Z*-----------------------------------------------------------------×4   Real space refined coordinates of the 50s subunit fitted  ...
3pio:Z*-----------------------------------------------------------------×2   Crystal structure of the synergistic antibiotic pair  ...
1j5a:M*-----------------------------------------------------------------×35  Structural basis for the interaction of antibiotics with  ...
2hgj:4*-----------------------------------------------------------------×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
3hux:5 -----------------------------------------------------------------     Structure of ef-p bound to the 70s ribosome; this file  ...
1vvs:5 -----------------------------------------------------------------     Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3uyg:5 -----------------------------------------------------------------     Crystal structure analysis of ribosomal decoding. This  ...
1vvm:5*-----------------------------------------------------------------×119 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3zn9:5*-----------------------------------------------------------------×4   The crystal structure of agmatidine tRNA-ile2 bound to the  ...
1vsa:Y*-----------------------------------------------------------------×2   Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3kir:5*-----------------------------------------------------------------×4   Structure of rele nuclease bound to the 70s ribosome  ...
1twv:P -----------------------------------------------------------------     Model structure of the t. Thermophilus 70s ribosome,50s  ...
3j3v:0*-----------------------------------------------------------------×2   Atomic model of the immature 50s subunit from bacillus  ...
3d5b:5*-----------------------------------------------------------------×14  Structural basis for translation termination on the 70s  ...
3ct9:A tatgkaghaardegdnaiykvlndiawfrdyrfekespllgpvkmsvtvinagtqhnvvpdkctf     Crystal structure of a putative zinc peptidase (np_812461. ...
2jy9:A -----------------------------------------------------------------     Nmr structure of putative tRNA hydrolase domain from  ...
3j3b:E -----------------------------------------------------------------     Structure of the human 60s ribosomal proteins

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345     Protein name
       ---------+---------+---------+---------+---------+---------+-----     ------------
P0A7N4 -----------------------------------------------------------------     50S ribosomal protein L32 OS=Escherichia coli (strain K12)  ...
1vs6:0*-----------------------------------------------------------------×103 Crystal structure of the bacterial ribosome from  ...
1p85:Z*-----------------------------------------------------------------×4   Real space refined coordinates of the 50s subunit fitted  ...
3pio:Z*-----------------------------------------------------------------×2   Crystal structure of the synergistic antibiotic pair  ...
1j5a:M*-----------------------------------------------------------------×35  Structural basis for the interaction of antibiotics with  ...
2hgj:4*-----------------------------------------------------------------×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
3hux:5 -----------------------------------------------------------------     Structure of ef-p bound to the 70s ribosome; this file  ...
1vvs:5 -----------------------------------------------------------------     Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3uyg:5 -----------------------------------------------------------------     Crystal structure analysis of ribosomal decoding. This  ...
1vvm:5*-----------------------------------------------------------------×119 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3zn9:5*-----------------------------------------------------------------×4   The crystal structure of agmatidine tRNA-ile2 bound to the  ...
1vsa:Y*-----------------------------------------------------------------×2   Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3kir:5*-----------------------------------------------------------------×4   Structure of rele nuclease bound to the 70s ribosome  ...
1twv:P -----------------------------------------------------------------     Model structure of the t. Thermophilus 70s ribosome,50s  ...
3j3v:0*-----------------------------------------------------------------×2   Atomic model of the immature 50s subunit from bacillus  ...
3d5b:5*-----------------------------------------------------------------×14  Structural basis for translation termination on the 70s  ...
3ct9:A vvdirsnelysnedlfaeirkhiacdakarsfrlnssridekhpfvqkavkmgripfgsptlsdq     Crystal structure of a putative zinc peptidase (np_812461. ...
2jy9:A -----------------------------------------------------------------     Nmr structure of putative tRNA hydrolase domain from  ...
3j3b:E -----------------------------------------------------------------     Structure of the human 60s ribosomal proteins

           4         4         4         4         5 
           6         7         8         9         0 
       6789012345678901234567890123456789012345678901                        Protein name
       ----+---------+---------+---------+---------+-                        ------------
P0A7N4 ----------------------------------------------                        50S ribosomal protein L32 OS=Escherichia coli (strain K12)  ...
1vs6:0*----------------------------------------------                   ×103 Crystal structure of the bacterial ribosome from  ...
1p85:Z*----------------------------------------------                   ×4   Real space refined coordinates of the 50s subunit fitted  ...
3pio:Z*----------------------------------------------                   ×2   Crystal structure of the synergistic antibiotic pair  ...
1j5a:M*----------------------------------------------                   ×35  Structural basis for the interaction of antibiotics with  ...
2hgj:4*----------------------------------------------                   ×3   Crystal structure of the 70s thermus thermophilus ribosome  ...
3hux:5 ----------------------------------------------                        Structure of ef-p bound to the 70s ribosome; this file  ...
1vvs:5 ----------------------------------------------                        Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3uyg:5 ----------------------------------------------                        Crystal structure analysis of ribosomal decoding. This  ...
1vvm:5*----------------------------------------------                   ×119 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
3zn9:5*----------------------------------------------                   ×4   The crystal structure of agmatidine tRNA-ile2 bound to the  ...
1vsa:Y*----------------------------------------------                   ×2   Crystal structure of a 70s ribosome-tRNA complex reveals  ...
3kir:5*----------------------------------------------                   ×4   Structure of rele nuclease bound to the 70s ribosome  ...
1twv:P ----------------------------------------------                        Model structure of the t. Thermophilus 70s ribosome,50s  ...
3j3v:0*----------------------------------------------                   ×2   Atomic model of the immature 50s subunit from bacillus  ...
3d5b:5*----------------------------------------------                   ×14  Structural basis for translation termination on the 70s  ...
3ct9:A almsfasvkigpgrssrshtaeeyimlkeieeaigiyldlldglkl                        Crystal structure of a putative zinc peptidase (np_812461. ...
2jy9:A ----------------------------------------------                        Nmr structure of putative tRNA hydrolase domain from  ...
3j3b:E ----------------------------------------------                        Structure of the human 60s ribosomal proteins

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P0A7N4. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 57 - - P0A7N4 50S ribosomal protein L32 OS=Escherichia coli (strain K12) GN=rpmF PE=1 SV=2
2. 361 100.0% 56 56 571.6 7.3e-25 1vs6:0 * Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
3. " " " " " "  = 1vs8:0 *
Crystal structure of the bacterial ribosome from escherichia complex with the antibiotic kasugamyin at 3.5a resolution. Contains the 50s subunit of one 70s ribosome. The entire cr structure contains two 70s ribosomes and is described in re
4. " " " " " "  = 1vt2:0 *
Crystal structure of the e. Coli ribosome bound to cem-101. Contains the 50s subunit of the second 70s ribosome.
5. " " " " " "  = 2aw4:0 *
Crystal structure of the bacterial ribosome from escherichia 3.5 a resolution. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib is described in remark 400.
6. " " " " " "  = 2awb:0 *
Crystal structure of the bacterial ribosome from escherichia 3.5 a resolution. This file contains the 50s subunit of the 70s ribosome. The entire crystal structure contains two 70s and is described in remark 400.
7. " " " " " "  = 2i2t:0 *
Crystal structure of ribosome with messenger RNA and the anticodon stem-loop of p-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
8. " " " " " "  = 2i2v:0 *
Crystal structure of ribosome with messenger RNA and the anticodon stem-loop of p-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
9. " " " " " "  = 2j28:0 *
Model of e. Coli srp bound to 70s rncs
10. " " " " " "  = 2qam:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with neomycin. This file contains the 50s subunit of the first 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
11. " " " " " "  = 2qao:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with neomycin. This file contains the 50s subunit of the second 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
12. " " " " " "  = 2qba:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin. This file contains the 50s subunit of the first 70s ribosome, with gentamicin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
13. " " " " " "  = 2qbc:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin. This file contains the 50s subunit of the second 70s ribosome, with gentamicin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
14. " " " " " "  = 2qbe:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
15. " " " " " "  = 2qbg:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
16. " " " " " "  = 2qbi:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin and ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with gentamicin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
17. " " " " " "  = 2qbk:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin and ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with gentamicin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
18. " " " " " "  = 2qov:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin. This file contains the 50s subunit of the first 70s ribosome. The entire crystal structure contains two 70s ribosomes.
19. " " " " " "  = 2qox:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin. This file contains the 50s subunit of the second 70s ribosome. The entire crystal structure contains two 70s ribosomes.
20. " " " " " "  = 2qoz:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin and neomycin. This file contains the 50s subunit of the first 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes.
21. " " " " " "  = 2qp1:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin and neomycin. This file contains the 50s subunit of the second 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes.
22. " " " " " "  = 2rdo:0 *
50s subunit with ef-g(gdpnp) and rrf bound
23. " " " " " "  = 2vhm:0 *
Structure of pdf binding helix in complex with the ribosome (part 1 of 4)
24. " " " " " "  = 2vhn:0 *
Structure of pdf binding helix in complex with the ribosome. (Part 2 of 4)
25. " " " " " "  = 2wwq:3 *
E.Coli 70s ribosome stalled during translation of tnac leader peptide. This file contains the 50s, the p-site tRNA and the tnac leader peptide (part 2 of 2).
26. " " " " " "  = 2z4l:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with paromomycin and ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with paromomycin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
27. " " " " " "  = 2z4n:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with paromomycin and ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with paromomycin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
28. " " " " " "  = 3bbx:0 *
The hsp15 protein fitted into the low resolution cryo-em map 50s.Nc-tRNA.Hsp15 complex
29. " " " " " "  = 3df2:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with hygromycin b. This file contains the 50s subunit of the first 70s ribosome. The entire crystal structure contains two 70s ribosomes.
30. " " " " " "  = 3df4:0 *
Crystal structure of the bacterial ribosome from escherichia coli in complex with hygromycin b. This file contains the 50s subunit of the second 70s ribosome. The entire crystal structure contains two 70s ribosomes.
31. " " " " " "  = 3e1b:T *
Structure of the 50s subunit of e. Coli ribosome in pre-acco state
32. " " " " " "  = 3e1d:T *
Structure of the 50s subunit of e. Coli ribosome in post-acc state
33. " " " " " "  = 3fik:0 *
Ternary complex-bound e.Coli 70s ribosome. This entry consis 50s subunit.
34. " " " " " "  = 3i1n:0 *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
35. " " " " " "  = 3i1p:0 *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
36. " " " " " "  = 3i1r:0 *
Crystal structure of the e. Coli 70s ribosome in an intermed of ratcheting
37. " " " " " "  = 3i1t:0 *
Crystal structure of the e. Coli 70s ribosome in an intermed of ratcheting
38. " " " " " "  = 3i20:0 *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
39. " " " " " "  = 3i22:0 *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
40. " " " " " "  = 3izt:c *
Structural insights into cognate vs. Near-cognate discrimina during decoding. This entry contains the large subunit of a programmed with a near-cognate codon.
41. " " " " " "  = 3izu:c *
Structural insights into cognate vs. Near-cognate discrimina during decoding. This entry contains the large subunit of a programmed with a cognate codon
42. " " " " " "  = 3j01:0 *
Structure of the ribosome-secye complex in the membrane envi
43. " " " " " "  = 3j0t:3 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class2 of the six classes)
44. " " " " " "  = 3j0w:3 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 4a of the six classes)
45. " " " " " "  = 3j0y:3 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 4b of the six classes)
46. " " " " " "  = 3j11:3 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 3 of the six classes)
47. " " " " " "  = 3j12:3 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 5 of the six classes)
48. " " " " " "  = 3j14:3 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 6 of the six classes)
49. " " " " " "  = 3j19:0 *
Structure of the bacterial ribosome complexed by tmrna-smpb during translocation and mld-loading (50s subunit)
50. " " " " " "  = 3j37:5 *
Tetracycline resistance protein tet(o) bound to the ribosome
51. " " " " " "  = 3j4x:0 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic pre- translocation state (pre1b, 50s subunit)
52. " " " " " "  = 3j50:0 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (pre2, 50s subunit)
53. " " " " " "  = 3j51:0 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (pre3, 50s subunit)
54. " " " " " "  = 3j52:0 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic pre- translocation state (pre1a, 50s subunit)
55. " " " " " "  = 3j54:0 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre4, 50s subunit)
56. " " " " " "  = 3j56:0 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre5a, 50s subunit)
57. " " " " " "  = 3j58:0 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre5b, 50s subunit)
58. " " " " " "  = 3j5a:0 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic post translocation state (post1, 50s subunit)
59. " " " " " "  = 3j5c:0 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post2a, 50s subunit)
60. " " " " " "  = 3j5e:0 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post2b, 50s subunit)
61. " " " " " "  = 3j5g:0 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post3a, 50s subunit)
62. " " " " " "  = 3j5i:0 *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post3b, 50s subunit)
63. " " " " " "  = 3j5k:0 *
E. Coli 70s-fmetval-trnaval post-translocation complex (post subunit)
64. " " " " " "  = 3j5o:0 *
Visualization of two trnas trapped in transit during ef-g-me translocation (50s subunit)
65. " " " " " "  = 3j5u:3 *
Structure of the ribosome with elongation factor g trapped i translocation state (pre-translocation 70s tRNA structure, subunit)
66. " " " " " "  = 3j5w:4 *
Structure of the ribosome with elongation factor g trapped i translocation state (pre-translocation 70s tRNA Ef-g struct subunit)
67. " " " " " "  = 3kcr:0 *
Ribosome-secy complex. This entry 3kcr contains 50s ribosomal subnit. The 30s ribosomal subunit can be found in PDB entry 3kc4
68. " " " " " "  = 3oas:0 *
Crystal structure of the e. Coli ribosome bound to telithrom file contains the 50s subunit of the second 70s ribosome.
69. " " " " " "  = 3oat:0 *
Crystal structure of the e. Coli ribosome bound to telithrom file contains the 50s subunit of the first 70s ribosome wit telithromycin bound.
70. " " " " " "  = 3ofc:0 *
Crystal structure of the e. Coli ribosome bound to chloramph this file contains the 50s subunit of the first 70s ribosom chloramphenicol bound.
71. " " " " " "  = 3ofd:0 *
Crystal structure of the e. Coli ribosome bound to chloramph this file contains the 50s subunit of the second 70s riboso
72. " " " " " "  = 3ofq:0 *
Crystal structure of the e. Coli ribosome bound to erythromy file contains the 50s subunit of the second 70s ribosome.
73. " " " " " "  = 3ofr:0 *
Crystal structure of the e. Coli ribosome bound to erythromy file contains the 50s subunit of the first 70s ribosome wit erthromycin bound.
74. " " " " " "  = 3ofz:0 *
Crystal structure of the e. Coli ribosome bound to clindamyc file contains the 50s subunit of the first 70s ribosome bou clindamycin.
75. " " " " " "  = 3og0:0 *
Crystal structure of the e. Coli ribosome bound to clindamyc file contains the 50s subunit of the second 70s ribosome.
76. " " " " " "  = 3orb:0 *
Crystal structure of the e. Coli ribosome bound to cem-101. Contains the 50s subunit of the first 70s ribosome bound to
77. " " " " " "  = 3r8s:0 *
Structures of the bacterial ribosome in classical and hybrid tRNA binding
78. " " " " " "  = 3r8t:0 *
Structures of the bacterial ribosome in classical and hybrid tRNA binding
79. " " " " " "  = 3sgf:4 *
Crystal structure of release factor rf3 trapped in the gtp s rotated conformation of the ribosome
80. " " " " " "  = 3uos:4 *
Crystal structure of release factor rf3 trapped in the gtp s rotated conformation of the ribosome (without viomycin)
81. " " " " " "  = 4gar:0 *
Allosteric control of the ribosome by small-molecule antibio
82. " " " " " "  = 4gau:0 *
Allosteric control of the ribosome by small-molecule antibio
83. " " " " " "  = 4kix:0 *
Control of ribosomal subunit rotation by elongation factor g
84. " " " " " "  = 4kiz:0 *
Control of ribosomal subunit rotation by elongation factor g
85. " " " " " "  = 4kj1:0 *
Control of ribosomal subunit rotation by elongation factor g
86. " " " " " "  = 4kj3:0 *
Control of ribosomal subunit rotation by elongation factor g
87. " " " " " "  = 4kj5:0 *
Control of ribosomal subunit rotation by elongation factor g
88. " " " " " "  = 4kj7:0 *
Control of ribosomal subunit rotation by elongation factor g
89. " " " " " "  = 4kj9:0 *
Control of ribosomal subunit rotation by elongation factor g
90. " " " " " "  = 4kjb:0 *
Control of ribosomal subunit rotation by elongation factor g
91. " " " " " "  = 4peb:0 *
Crystal structure of the e. Coli ribosome bound to quinupris file contains the 50s subunit of the first 70s ribosome wit quinupristin bound.
92. " " " " " "  = 4pec:0 *
Crystal structure of the e. Coli ribosome bound to quinupris file contains the 50s subunit of the second 70s ribosome wi quinupristin bound.
93. " " " " " "  = 4tom:0 *
Crystal structure of the e. Coli ribosome bound to linoprist file contains the 50s subunit of the first 70s ribosome wit linopristin bound.
94. " " " " " "  = 4too:0 *
Crystal structure of the e. Coli ribosome bound to linoprist file contains the 50s subunit of the second 70s ribosome wi linopristin bound.
95. " " " " " "  = 4tov:0 *
Crystal structure of the e. Coli ribosome bound to flopristi file contains the 50s subunit of the first 70s ribosome wit flopristin bound.
96. " " " " " "  = 4tox:0 *
Crystal structure of the e. Coli ribosome bound to flopristi file contains the 50s subunit of the second 70s ribosome wi flopristin bound.
97. " " " " " "  = 4tp1:0 *
Crystal structure of the e. Coli ribosome bound to dalfopris file contains the 50s subunit of the first 70s ribosome wit dalfopristin bound.
98. " " " " " "  = 4tp3:0 *
Crystal structure of the e. Coli ribosome bound to dalfopris file contains the 50s subunit of the second 70s ribosome wi dalfopristin bound.
99. " " " " " "  = 4tp5:0 *
Crystal structure of the e. Coli ribosome bound to virginiam this file contains the 50s subunit of the first 70s ribosom virginiamycin m1 bound.
100. " " " " " "  = 4tp7:0 *
Crystal structure of the e. Coli ribosome bound to virginiam this file contains the 50s subunit of the second 70s riboso virginiamycin m1 bound.
101. " " " " " "  = 4tp9:0 *
Crystal structure of the e. Coli ribosome bound to dalfopris quinupristin. This file contains the 50s subunit of the fir ribosome with dalfopristin and quinupristin bound.
102. " " " " " "  = 4tpb:0 *
Crystal structure of the e. Coli ribosome bound to dalfopris quinupristin. This file contains the 50s subunit of the sec ribosome with dalfopristin and quinupristin bound.
103. " " " " " "  = 4tpd:0 *
Crystal structure of the e. Coli ribosome bound to flopristi linopristin. This file contains the 50s subunit of the firs ribosome with flopristin and linopristin bound.
104. " " " " " "  = 4tpf:0 *
Crystal structure of the e. Coli ribosome bound to flopristi linopristin. This file contains the 50s subunit of the seco ribosome with flopristin and linopristin bound.
105. 191 100.0% 29 29 312.8 1.9e-10 1p85:Z * Real space refined coordinates of the 50s subunit fitted int resolution cryo-em map of the ef-g.Gtp state of e. Coli 70s
106. " " " " " "  = 1p86:Z *
Real space refined coordinates of the 50s subunit fitted int resolution cryo-em map of the initiation-like state of e. C ribosome
107. " " " " " "  = 2gya:Z *
Structure of the 50s subunit of a pre-translocational e. Coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-em map emd-1056
108. " " " " " "  = 2gyc:Z *
Structure of the 50s subunit of a secm-stalled e. Coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-em map emd-1143
109. 149 49.1% 55 57 244.2 1.3e-06 3pio:Z * Crystal structure of the synergistic antibiotic pair lankamy lankacidin in complex with the large ribosomal subunit
110. " " " " " "  = 3pip:Z *
Crystal structure of the synergistic antibiotic pair lankamy lankacidin in complex with the large ribosomal subunit
111. 149 49.1% 55 58 244.1 1.3e-06 1j5a:M * Structural basis for the interaction of antibiotics with the peptidyl transferase center in eubacteria
112. " " " " " "  = 1jzx:M *
Structural basis for the interaction of antibiotics with the peptidyl transferase center in eubacteria
113. " " " " " "  = 1jzy:M *
Structural basis for the interaction of antibiotics with the peptidyl transferase center in eubacteria
114. " " " " " "  = 1jzz:M *
Structural basis for the interaction of antibiotics with the peptidyl transferase center in eubacteria
115. " " " " " "  = 1k00:M *
Structural basis for the interaction of antibiotics with the peptidyl transferase center in eubacteria
116. " " " " " "  = 1k01:M *
Structural basis for the interaction of antibiotics with the peptidyl transferase center in eubacteria
117. " " " " " "  = 1kc9:Z *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
118. " " " " " "  = 1kpj:Z *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
119. " " " " " "  = 1lnr:Z *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
120. " " " " " "  = 1nkw:Z *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
121. " " " " " "  = 1nwx:Z *
Complex of the large ribosomal subunit from deinococcus radiodurans with abt-773
122. " " " " " "  = 1nwy:Z *
Complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin
123. " " " " " "  = 1ond:Z *
The crystal structure of the 50s large ribosomal subunit from deinococcus radiodurans complexed with troleandomycin macrolide antibiotic
124. " " " " " "  = 1pnu:Z *
Crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. This file, 1pnu, contains only molecules of the 50s ribosomal subunit. The 30s subunit, mRNA, p-site tRNA, and a-site tRNA are in the PDB file 1pns.
125. " " " " " "  = 1pny:Z *
Crystal structure of the wild type ribosome from e. Coli, 50s subunit of 70s ribosome. This file, 1pny, contains only molecules of the 50s ribosomal subunit. The 30s subunit is in the PDB file 1pnx.
126. " " " " " "  = 1sm1:Z *
Complex of the large ribosomal subunit from deinococcus radi with quinupristin and dalfopristin
127. " " " " " "  = 1vor:2 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
128. " " " " " "  = 1vou:2 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
129. " " " " " "  = 1vow:2 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
130. " " " " " "  = 1voy:2 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
131. " " " " " "  = 1vp0:2 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
132. " " " " " "  = 1vs9:Y *
Crystal structure of a 70s ribosome-tRNA complex reveals functional interactions and rearrangements. This file, 1vs9, contains the 50s ribosome subunit. 30s ribosome subunit is in the file 2i1c
133. " " " " " "  = 1xbp:Z *
Inhibition of peptide bond formation by pleuromutilins: the structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with tiamulin
134. " " " " " "  = 1yl3:5 *
Crystal structure of 70s ribosome with thrs operator and trn subunit. The coordinates for the small subunit are in the p 1yl4.
135. " " " " " "  = 2b66:5 *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400
136. " " " " " "  = 2b9n:5 *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400.
137. " " " " " "  = 2b9p:5 *
50s ribosomal subunit from a crystal structure of the riboso complex with trnas and mRNA with a stop codon in the a-site file contains the 50s subunit from a crystal structure of t ribosome in complex with trnas and mRNA with a stop codon i site and is described in remark 400.
138. " " " " " "  = 2zjp:Y *
Thiopeptide antibiotic nosiheptide bound to the large riboso subunit of deinococcus radiodurans
139. " " " " " "  = 2zjq:Z *
Interaction of l7 with l11 induced by microccocin binding to deinococcus radiodurans 50s subunit
140. " " " " " "  = 2zjr:Z *
Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
141. " " " " " "  = 3cf5:Y *
Thiopeptide antibiotic thiostrepton bound to the large ribos subunit of deinococcus radiodurans
142. " " " " " "  = 3dll:Y *
The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
143. " " " " " "  = 4io9:Z *
Crystal structure of compound 4d bound to large ribosomal su (50s) from deinococcus radiodurans
144. " " " " " "  = 4ioa:Z *
Crystal structure of compound 4e bound to large ribosomal su (50s) from deinococcus radiodurans
145. " " " " " "  = 4ioc:Z *
Crystal structure of compound 4f bound to large ribosomal su (50s) from deinococcus radiodurans
146. 101 37.0% 54 57 170.1 0.017 2hgj:4 * Crystal structure of the 70s thermus thermophilus ribosome s the 16s 3'-end mimicks mRNA e and p codons. This entry 2hgj 50s ribosomal subunit. The 30s ribosomal subunit can be fou entry 2hgi.
147. " " " " " "  = 2hgq:4 *
Crystal structure of the 70s thermus thermophilus ribosome w translocated and rotated shine-dalgarno duplex. This entry contains 50s ribosomal subunit. The 30s ribosomal subunit c found in PDB entry 2hgp.
148. " " " " " "  = 2hgu:4 *
70s t.Th. Ribosome functional complex with mRNA and e- and p trnas at 4.5a. This entry 2hgu contains 50s ribosomal subun 30s ribosomal subunit can be found in PDB entry 2hgr.
149. 101 37.0% 54 57 170.1 0.017 3hux:5 Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule i.
150. 101 37.0% 54 58 170.0 0.017 1vvs:5 Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-a on the ribosome
151. 101 37.0% 54 58 170.0 0.017 3uyg:5 Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
152. 101 37.0% 54 59 169.9 0.017 1vvm:5 * Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u on the ribosome
153. " " " " " "  = 1vvo:5 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u on the ribosome
154. " " " " " "  = 1vvq:5 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-a on the ribosome
155. " " " " " "  = 1vvu:5 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccg-g on the ribosome
156. " " " " " "  = 1vvw:5 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccg-g on the ribosome
157. " " " " " "  = 1vvy:5 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u in the absence of paromomycin
158. " " " " " "  = 1vw0:5 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u in the absence of paromomycin
159. " " " " " "  = 1vx9:5 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-u ribosome
160. " " " " " "  = 1vxj:5 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-u ribosome
161. " " " " " "  = 1vxl:5 *
Crystal structure of tRNA proline (cgg) bound to codon ccg-g ribosome
162. " " " " " "  = 1vxn:5 *
Crystal structure of tRNA proline (cgg) bound to codon ccg-g ribosome
163. " " " " " "  = 1vxq:5 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-g ribosome
164. " " " " " "  = 1vxt:5 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-g ribosome
165. " " " " " "  = 1vy1:5 *
Crystal structure of unmodified tRNA proline (cgg) bound to on the ribosome
166. " " " " " "  = 1vy3:5 *
Crystal structure of unmodified tRNA proline (cgg) bound to on the ribosome
167. " " " " " "  = 2j01:5 *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 2 of 4). This file contains the 50s subunit from molecule i.
168. " " " " " "  = 2j03:5 *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50s subunit from molecule ii.
169. " " " " " "  = 2jl6:5 *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 2 of 4). This file contains the 50s subunit.
170. " " " " " "  = 2jl8:5 *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 4 of 4). This file contains the 50s subunit.
171. " " " " " "  = 2v47:5 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 2 of 4). This file contains the 50s subunit for molecule 1.
172. " " " " " "  = 2v49:5 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 4 of 4). This file contains the 50s subunit of molecule 2.
173. " " " " " "  = 2wdi:5 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule i.
174. " " " " " "  = 2wdj:5 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule ii.
175. " " " " " "  = 2wdl:5 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule i.
176. " " " " " "  = 2wdn:5 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule ii.
177. " " " " " "  = 2wh2:5 *
Insights into translational termination from the structure of rf2 bound to the ribosome
178. " " " " " "  = 2wh4:5 *
Insights into translational termination from the structure of rf2 bound to the ribosome
179. " " " " " "  = 2wrj:5 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state (part 2 of 4).
180. " " " " " "  = 2wrl:5 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state. (Part 4 of 4).
181. " " " " " "  = 2wro:5 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 2 of 4).
182. " " " " " "  = 2wrr:5 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 4 of 4).
183. " " " " " "  = 2x9s:5 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
184. " " " " " "  = 2x9u:5 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
185. " " " " " "  = 2xg0:5 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 2 of 4)
186. " " " " " "  = 2xg2:5 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 4 of 4)
187. " " " " " "  = 2xqe:5 *
The structure of ef-tu and aminoacyl-tRNA bound to the 70s ribosome with a gtp analog
188. " " " " " "  = 2xtg:5 *
tRNA tranlocation on the 70s ribosome: the pre- translocational translocation intermediate ti(pre)
189. " " " " " "  = 2xux:5 *
tRNA translocation on the 70s ribosome: the post- translocational translocation intermediate ti(post)
190. " " " " " "  = 2y0v:5 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
191. " " " " " "  = 2y0x:5 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
192. " " " " " "  = 2y0z:5 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
193. " " " " " "  = 2y11:5 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
194. " " " " " "  = 2y13:5 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
195. " " " " " "  = 2y15:5 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a cognate codon on the 70s ribosome.
196. " " " " " "  = 2y17:5 *
Ef-tu complex 3
197. " " " " " "  = 2y19:5 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
198. " " " " " "  = 3fin:5 *
T. Thermophilus 70s ribosome in complex with mRNA, trnas and tu.Gdp.Kirromycin ternary complex, fitted to a 6.4 a cryo-e this file contains the 50s subunit.
199. " " " " " "  = 3huz:5 *
Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule ii.
200. " " " " " "  = 3i8f:5 *
Elongation complex of the 70s ribosome with three trnas and entry 3i8f contains 50s ribosomal subunit. The 30s ribosoma can be found in PDB entry 3i8g. Molecule b in the same asym unit is deposited as 3i8g (30s) and 3i8f (50s).
201. " " " " " "  = 3i8i:5 *
Elongation complex of the 70s ribosome with three trnas and entry 3i8i contains 50s ribosomal subnit. The 30s ribosomal can be found in PDB entry 3i8h. Molecule a in the same asym unit is deposited as 3i8f (50s) and 3i8g (30s).
202. " " " " " "  = 3i9c:5 *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9c contains 50s ribosomal subunit of molecule b. The 30s subunit can be found in PDB entry 3i9b. Molecule a in the s asymmetric unit is deposited as 3i9d (30s) and 3i9e (50s)
203. " " " " " "  = 3i9e:5 *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9e contains 50s ribosomal subunit of molecule a. The 30s subunit can be found in PDB entry 3i9d. Molecule b in the s asymmetric unit is deposited as 3i9b (30s) and 3i9c (50s)
204. " " " " " "  = 3kni:5 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule i
205. " " " " " "  = 3knk:5 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule ii.
206. " " " " " "  = 3knm:5 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule i.
207. " " " " " "  = 3kno:5 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule ii
208. " " " " " "  = 3oh5:5 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
209. " " " " " "  = 3oh7:5 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
210. " " " " " "  = 3ohj:5 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
211. " " " " " "  = 3ohk:5 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
212. " " " " " "  = 3ohz:5 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
213. " " " " " "  = 3oi1:5 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
214. " " " " " "  = 3oi3:5 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
215. " " " " " "  = 3oi5:5 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
216. " " " " " "  = 3tve:5 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-leu complex
217. " " " " " "  = 3tvh:5 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-leu complex
218. " " " " " "  = 3uxq:5 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
219. " " " " " "  = 3uxr:5 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
220. " " " " " "  = 3uye:5 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
221. " " " " " "  = 3uz1:5 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex with paromomycin
222. " " " " " "  = 3uz2:5 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-leu complex with paromomycin.
223. " " " " " "  = 3uz8:5 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-tyr complex.
224. " " " " " "  = 3uz9:5 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-tyr complex.
225. " " " " " "  = 3uzf:5 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex
226. " " " " " "  = 3uzh:5 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex.
227. " " " " " "  = 3uzk:5 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex with paromomycin
228. " " " " " "  = 3uzn:5 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex with paromomycin
229. " " " " " "  = 3v23:5 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
230. " " " " " "  = 3v25:5 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 2nd ribosom asu
231. " " " " " "  = 3v27:5 *
Crystal structure of hpf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
232. " " " " " "  = 3v29:5 *
Crystal structure of hpf bound to the 70s ribosome. This ent contains the 50s subunit of the 2nd molecule in the asu.
233. " " " " " "  = 3v2d:5 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 1st ribosom asu
234. " " " " " "  = 3v2f:5 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 2nd ribosom asu
235. " " " " " "  = 3v6w:5 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit
236. " " " " " "  = 3v6x:5 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit
237. " " " " " "  = 3zvp:5 *
Crystal structure of the hybrid state of ribosome in complex the guanosine triphosphatase release factor 3
238. " " " " " "  = 4abs:5 *
Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin w 70s ribosome
239. " " " " " "  = 4b8g:5 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
240. " " " " " "  = 4b8i:5 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
241. " " " " " "  = 4btd:5 *
Thermus thermophilus ribosome
242. " " " " " "  = 4dha:5 *
Crystal structure of yaej bound to the 70s ribosome
243. " " " " " "  = 4dhc:5 *
Crystal structure of yaej bound to the 70s ribosome
244. " " " " " "  = 4ejb:5 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit.
245. " " " " " "  = 4ejc:5 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit.
246. " " " " " "  = 4g5l:5 *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule a.
247. " " " " " "  = 4g5n:5 *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule b.
248. " " " " " "  = 4g5u:5 *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule a.
249. " " " " " "  = 4g5w:5 *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule b.
250. " " " " " "  = 4jux:5 *
Crystal structure of the ribosome bound to elongation factor guanosine triphosphatase state (this file contains the 50s
251. " " " " " "  = 4k0m:5 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
252. " " " " " "  = 4k0q:5 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
253. " " " " " "  = 4kbu:5 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit a. The full asymmetric unit contains PDB entries 4kbt (30s subunit a), 4kbv (30s subuni 4kbw (50s subunit b).
254. " " " " " "  = 4kbw:5 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit b. The full asymmetric unit contains PDB entries 4kbv (30s subunit b), 4kbt (30s subuni 4kbu (50s subunit a).
255. " " " " " "  = 4kcz:5 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state.T contains the 50s ribosomal subunit a. The 30s subunit a can in 4kcy. Molecule b in the same asymmetric unit is deposite (30s) and 4kd2 (50s).G1 50s ribosomal subunit i
256. " " " " " "  = 4kd2:5 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains the 50s ribosomal subunit b. The 30s subunit b can in 4kd0. Molecule a in the same asymmetric unit is deposite (30s) and 4kcz (50s).
257. " " " " " "  = 4kd9:5 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kd8. Molecule b in the same asymmetric uni deposited as 4kda (30s) and 4kdb (50s).
258. " " " " " "  = 4kdb:5 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kda. Molecule a in the same asymmetric uni deposited as 4kd8 (30s) and 4kd9 (50s).
259. " " " " " "  = 4kdh:5 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kdg. Molecule b in the same asymmetric uni deposited as 4kdj (30s) and 4kdk (50s).
260. " " " " " "  = 4kdk:5 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kdj. Molecule a in the same asymmetric uni deposited as 4kdg (30s) and 4kdh (50s).
261. " " " " " "  = 4kx0:5 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-g on the ribosome
262. " " " " " "  = 4kx2:5 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-g on the ribosome
263. " " " " " "  = 4qcn:5 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing acylated substrates in the a and p sites. This entry contains the 50 of the first 70s ribosome in the asu.
264. " " " " " "  = 4qcp:5 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing acylated substrates in the a and p sites. This entry contains the 50 of the second 70s ribosome in the asu.
265. " " " " " "  = 4qcr:5 *
Crystal structure of the thermus thermophilus 70s ribosome i post-catalysis state of peptide bond formation containing d tRNA in the a site and deacylated tRNA in the p site. This contains the 50s subunit of the first 70s ribosome in the a
266. " " " " " "  = 4qct:5 *
Crystal structure of the thermus thermophilus 70s ribosome i post-catalysis state of peptide bond formation containing d tRNA in the a site and deacylated tRNA in the p site. This contains the 50s subunit of the second 70s ribosome in the
267. " " " " " "  = 4qcv:5 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-puromycin in the a site and acylated tRNA in site. This entry contains the 50s subunit of the first 70s in the asu.
268. " " " " " "  = 4qcx:5 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-puromycin in the a site and acylated tRNA in site. This entry contains the 50s subunit of the second 70s in the asu.
269. " " " " " "  = 4qcz:5 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-cytidine-puromycin in the a site and acylate the p site. This entry contains the 50s subunit of the firs ribosome in the asu.
270. " " " " " "  = 4qd1:5 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-cytidine-puromycin in the a site and acylate the p site. This entry contains the 50s subunit of the seco ribosome in the asu.
271. 99 37.7% 53 56 167.1 0.025 3zn9:5 * The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
272. " " " " " "  = 3zne:5 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
273. " " " " " "  = 4byc:5 *
Structure of thermus thermophilus 50s ribosome
274. " " " " " "  = 4bye:5 *
Structure of thermus thermophilus 50s ribosome
275. 95 35.2% 54 56 161.0 0.055 1vsa:Y * Crystal structure of a 70s ribosome-tRNA complex reveals fun interactions and rearrangements. This file, 1vsa, contains ribosome subunit. 30s ribosome subunit is in the file 2ow8
276. " " " " " "  = 1vsp:Y *
Interactions and dynamics of the shine-dalgarno helix in the ribosome. This file, 1vsp, contains the 50s ribosome subuni ribosome subunit is in the file 2qnh
277. 94 36.5% 52 55 159.5 0.066 3kir:5 * Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 2 of 4)
278. " " " " " "  = 3kit:5 *
Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 4 of 4)
279. " " " " " "  = 3kiw:5 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 2 of 4)
280. " " " " " "  = 3kiy:5 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 4 of 4)
281. 93 35.8% 53 54 158.1 0.079 1twv:P Model structure of the t. Thermophilus 70s ribosome,50s subunit of 70s ribosome. This file, 1twv, contains only molecules of the 50s ribosomal subunit. The 30s subunit is in the PDB file 1twt.
282. 78 29.6% 54 55 134.8 1.6 3j3v:0 * Atomic model of the immature 50s subunit from bacillus subti i-a)
283. " " " " " "  = 3j3w:0 *
Atomic model of the immature 50s subunit from bacillus subti ii-a)
284. 69 31.2% 48 52 121.2 8.9 3d5b:5 * Structural basis for translation termination on the 70s ribo file contains the 50s subunit of one 70s ribosome. The enti structure contains two 70s ribosomes as described in remark
285. " " " " " "  = 3d5d:5 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of the second 70s ribosome. T crystal structure contains two 70s ribosomes as described i 400.
286. " " " " " "  = 3f1f:5 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of o ribosome. The entire crystal structure contains two 70s rib described in remark 400.
287. " " " " " "  = 3f1h:5 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of t 70s ribosome. The entire crystal structure contains two 70s as described in remark 400.
288. " " " " " "  = 3mrz:2 *
Recognition of the amber stop codon by release factor rf1. T 3mrz contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3ms0. Molecule a in the same asymmetric deposited as 3mr8 (50s) and 3ms1 (30s).
289. " " " " " "  = 3ms1:2 *
Recognition of the amber stop codon by release factor rf1. T 3ms1 contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3mr8. Molecule b in the same asymmetric deposited as 3mrz (50s) and 3ms0 (30s).
290. " " " " " "  = 3pyo:2 *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the first 70s ribosome.
291. " " " " " "  = 3pyr:2 *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the second 70s ribosome.
292. " " " " " "  = 3pyt:2 *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the first 70s ribosome.
293. " " " " " "  = 3pyv:2 *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the second 70s ribosome.
294. " " " " " "  = 4kfi:5 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the a subunit
295. " " " " " "  = 4kfl:5 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the b subunit
296. " " " " " "  = 4l6j:2 *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the first 70s ribosome.
297. " " " " " "  = 4l6l:2 *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the second 70s ribosome
298. 70 33.3% 33 346 112.4 28 3ct9:A Crystal structure of a putative zinc peptidase (np_812461.1) bacteroides thetaiotaomicron vpi-5482 at 2.31 a resolution
299. 66 46.7% 30 148 110.9 34 2jy9:A Nmr structure of putative tRNA hydrolase domain from salmonella typhimurium. Northeast structural genomics consortium target str220
300. 67 27.5% 40 262 109.3 41 3j3b:E Structure of the human 60s ribosomal proteins

Number of sequences: 300

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer