spacer
spacer

SAS results for UniProt accession no. P0AG51

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P0AG51 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P0AG51 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 24 unique sequences (including 13 consensus sequences) giving 332 sequence matches in all. The 71 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P0AG51 -----------------------------------------------------------maktik    50S ribosomal protein L30 OS=Escherichia coli (strain K12)  ...
1vs6:Y*------------------------------------------------------------aktik×90 Crystal structure of the bacterial ribosome from  ...
1p85:X*--------------------------------------------------------------tik×4  Real space refined coordinates of the 50s subunit fitted  ...
1kc9:X*---------------------------------------------------------------mk×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y --------------------------------------------------------------kle    Atomic model of the immature 50s subunit from bacillus  ...
4dhc:3 -------------------------------------------------------------prlk    Crystal structure of yaej bound to the 70s ribosome
2hgj:2*-------------------------------------------------------------prlk×3  Crystal structure of the 70s thermus thermophilus ribosome  ...
2xqe:3*------------------------------------------------------------mprlk×15 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
3hux:3*-------------------------------------------------------------prlk×5  Structure of ef-p bound to the 70s ribosome; this file  ...
3kir:3*------------------------------------------------------------mprlk×10 Structure of rele nuclease bound to the 70s ribosome  ...
3tve:X*-------------------------------------------------------------prlk×25 Crystal structure analysis of ribosomal decoding. This  ...
4jux:3*------------------------------------------------------------mprlk×7  Crystal structure of the ribosome bound to elongation  ...
1bxy:A*------------------------------------------------------------mprlk×65 Crystal structure of ribosomal protein l30 from thermus  ...
1twv:O -----------------------------------------------------------------    Model structure of the t. Thermophilus 70s ribosome,50s  ...
3j21:Y*-----------------------------------------------------------mak-la×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3vr5:H -------tykigvvgdkdsvspfrlfgfdvqhtkteirktidemakneygviyiteqcanlvpet    Crystal structure of nucleotide-free enterococcus hirae  ...
3aon:B mtykigvvgdkdsvspfrlfgfdvqhgttkteirktidemakneygviyiteqcanlvpetiery    Crystal structure of the central axis (ntpd-ntpg) in the  ...
3vr4:H*-tykigvvgdkdsvspfrlfgfdvqhgttkteirktidemakneygviyiteqcanlvpetiery×2  Crystal structure of enterococcus hirae v1-atpase [ev1]
4g35:A -----------------------------------------------------------eddlyr    Mcl-1 in complex with a biphenyl cross-linked noxa peptide.
2img:A -----------------------------------------------------gvqppnfswvlp    Crystal structure of dual specificity protein phosphatase  ...
4erc:A ----------------------------------------------------mgvqppnfswvlp    Structure of vhz bound to metavanadate

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P0AG51 itqtrsaigrlpkhkatllglglrrightveredtpairgminavsf---mvkvee---------    50S ribosomal protein L30 OS=Escherichia coli (strain K12)  ...
1vs6:Y*itqtrsaigrlpkhkatllglglrrightveredtpairgminavsf---mvkvee---------×90 Crystal structure of the bacterial ribosome from  ...
1p85:X*itqtrsaigrlpkhkatllglglrrightveredtpairgminavsf---mvkvee---------×4  Real space refined coordinates of the 50s subunit fitted  ...
1kc9:X*iklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkh---llevqe---------×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y itlkrsvigrpedqrvtvrtlglkktnqtvvhednaairgminkvsh---lvsvke---------    Atomic model of the immature 50s subunit from bacillus  ...
4dhc:3 vklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvah---lvrvevv--------    Crystal structure of yaej bound to the 70s ribosome
2hgj:2*vklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvah---lvrvevve-------×3  Crystal structure of the 70s thermus thermophilus ribosome  ...
2xqe:3*vklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvah---lvrvevv--------×15 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
3hux:3*vklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvah---lvrvevve-------×5  Structure of ef-p bound to the 70s ribosome; this file  ...
3kir:3*vklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvah---lvrvevv--------×10 Structure of rele nuclease bound to the 70s ribosome  ...
3tve:X*vklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvah---lvrvevve-------×25 Crystal structure analysis of ribosomal decoding. This  ...
4jux:3*vklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvah---lvrvevv--------×7  Crystal structure of the ribosome bound to elongation  ...
1bxy:A*vklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvah---lvrvevve-------×65 Crystal structure of ribosomal protein l30 from thermus  ...
1twv:O vklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvah---lvrv-----------    Model structure of the t. Thermophilus 70s ribosome,50s  ...
3j21:Y*virirgrvnvkrpvrdtlamlrlhrvnhcvivddtpsylgmlqkakd---yitwgeinaetlakl×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3vr5:H ierykpaiilipshqgtl-gigleeiqnsvekavgqn----------------------------    Crystal structure of nucleotide-free enterococcus hirae  ...
3aon:B kgqltpaiilipshqgtl-gigleeiqnsvekavgqn----------------------------    Crystal structure of the central axis (ntpd-ntpg) in the  ...
3vr4:H*kgqltpaiilipshqgtl-gigleeiqnsvekavgqnil--------------------------×2  Crystal structure of enterococcus hirae v1-atpase [ev1]
4g35:A qsleiisrylreqatgrraletlrrvgdgvqrnhetafqgmlrkksfsrvmvhvfkdgvtnwgri    Mcl-1 in complex with a biphenyl cross-linked noxa peptide.
2img:A grlaglalprlpahyqflldlgvrhlvsltergpphsdscpgltlhr---lripdfcppapdqid    Crystal structure of dual specificity protein phosphatase  ...
4erc:A grlaglalprlpahyqflldlgvrhlvsltergpphsdscpgltlhr---lripdfcppapdqid    Structure of vhz bound to metavanadate

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P0AG51 -----------------------------------------------------------------    50S ribosomal protein L30 OS=Escherichia coli (strain K12)  ...
1vs6:Y*-----------------------------------------------------------------×90 Crystal structure of the bacterial ribosome from  ...
1p85:X*-----------------------------------------------------------------×4  Real space refined coordinates of the 50s subunit fitted  ...
1kc9:X*-----------------------------------------------------------------×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y -----------------------------------------------------------------    Atomic model of the immature 50s subunit from bacillus  ...
4dhc:3 -----------------------------------------------------------------    Crystal structure of yaej bound to the 70s ribosome
2hgj:2*-----------------------------------------------------------------×3  Crystal structure of the 70s thermus thermophilus ribosome  ...
2xqe:3*-----------------------------------------------------------------×15 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
3hux:3*-----------------------------------------------------------------×5  Structure of ef-p bound to the 70s ribosome; this file  ...
3kir:3*-----------------------------------------------------------------×10 Structure of rele nuclease bound to the 70s ribosome  ...
3tve:X*-----------------------------------------------------------------×25 Crystal structure analysis of ribosomal decoding. This  ...
4jux:3*-----------------------------------------------------------------×7  Crystal structure of the ribosome bound to elongation  ...
1bxy:A*-----------------------------------------------------------------×65 Crystal structure of ribosomal protein l30 from thermus  ...
1twv:O -----------------------------------------------------------------    Model structure of the t. Thermophilus 70s ribosome,50s  ...
3j21:Y*irkrgrlignkpvtdeyvkeklgmtieefaqkvvngemslkdlpnlkpvfrlhpprggfrgskkr×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3vr5:H -----------------------------------------------------------------    Crystal structure of nucleotide-free enterococcus hirae  ...
3aon:B -----------------------------------------------------------------    Crystal structure of the central axis (ntpd-ntpg) in the  ...
3vr4:H*-----------------------------------------------------------------×2  Crystal structure of enterococcus hirae v1-atpase [ev1]
4g35:A vtlisfgafvakhlksvnqesfieplaetitdvlvrtkrdwlvkqrgwdgfveffhvq-------    Mcl-1 in complex with a biphenyl cross-linked noxa peptide.
2img:A rfvqivdeanargeavgvhcalgfgrtgtmlacylvkerglaagdaiaeirrlrpgsietyeqek    Crystal structure of dual specificity protein phosphatase  ...
4erc:A rfvqivdeanargeavgvhcalgfgrtgtmlacylvkerglaagdaiaeirrlrpgsietyeqek    Structure of vhz bound to metavanadate

           2         2        
           0         1        
       67890123456789012345678                                              Protein name
       ----+---------+--------                                              ------------
P0AG51 -----------------------                                              50S ribosomal protein L30 OS=Escherichia coli (strain K12)  ...
1vs6:Y*-----------------------                                          ×90 Crystal structure of the bacterial ribosome from  ...
1p85:X*-----------------------                                          ×4  Real space refined coordinates of the 50s subunit fitted  ...
1kc9:X*-----------------------                                          ×25 Crystal structure of the large ribosomal subunit from  ...
3j3v:Y -----------------------                                              Atomic model of the immature 50s subunit from bacillus  ...
4dhc:3 -----------------------                                              Crystal structure of yaej bound to the 70s ribosome
2hgj:2*-----------------------                                          ×3  Crystal structure of the 70s thermus thermophilus ribosome  ...
2xqe:3*-----------------------                                          ×15 The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
3hux:3*-----------------------                                          ×5  Structure of ef-p bound to the 70s ribosome; this file  ...
3kir:3*-----------------------                                          ×10 Structure of rele nuclease bound to the 70s ribosome  ...
3tve:X*-----------------------                                          ×25 Crystal structure analysis of ribosomal decoding. This  ...
4jux:3*-----------------------                                          ×7  Crystal structure of the ribosome bound to elongation  ...
1bxy:A*-----------------------                                          ×65 Crystal structure of ribosomal protein l30 from thermus  ...
1twv:O -----------------------                                              Model structure of the t. Thermophilus 70s ribosome,50s  ...
3j21:Y*sfkeggalgyrgekinelierml                                          ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3vr5:H -----------------------                                              Crystal structure of nucleotide-free enterococcus hirae  ...
3aon:B -----------------------                                              Crystal structure of the central axis (ntpd-ntpg) in the  ...
3vr4:H*-----------------------                                          ×2  Crystal structure of enterococcus hirae v1-atpase [ev1]
4g35:A -----------------------                                              Mcl-1 in complex with a biphenyl cross-linked noxa peptide.
2img:A avfqfyqrtk-------------                                              Crystal structure of dual specificity protein phosphatase  ...
4erc:A avfqfyqrtk-------------                                              Structure of vhz bound to metavanadate

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P0AG51. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 59 - - P0AG51 50S ribosomal protein L30 OS=Escherichia coli (strain K12) GN=rpmD PE=1 SV=2
2. 360 100.0% 58 58 563.3 2.1e-24 1vs6:Y * Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
3. " " " " " "  = 1vs8:Y *
Crystal structure of the bacterial ribosome from escherichia complex with the antibiotic kasugamyin at 3.5a resolution. Contains the 50s subunit of one 70s ribosome. The entire cr structure contains two 70s ribosomes and is described in re
4. " " " " " "  = 1vt2:Z *
Crystal structure of the e. Coli ribosome bound to cem-101. Contains the 50s subunit of the second 70s ribosome.
5. " " " " " "  = 2aw4:Y *
Crystal structure of the bacterial ribosome from escherichia 3.5 a resolution. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib is described in remark 400.
6. " " " " " "  = 2awb:Y *
Crystal structure of the bacterial ribosome from escherichia 3.5 a resolution. This file contains the 50s subunit of the 70s ribosome. The entire crystal structure contains two 70s and is described in remark 400.
7. " " " " " "  = 2i2t:Z *
Crystal structure of ribosome with messenger RNA and the anticodon stem-loop of p-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
8. " " " " " "  = 2i2v:Z *
Crystal structure of ribosome with messenger RNA and the anticodon stem-loop of p-site tRNA. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
9. " " " " " "  = 2j28:Y *
Model of e. Coli srp bound to 70s rncs
10. " " " " " "  = 2qam:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with neomycin. This file contains the 50s subunit of the first 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
11. " " " " " "  = 2qao:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with neomycin. This file contains the 50s subunit of the second 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
12. " " " " " "  = 2qba:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin. This file contains the 50s subunit of the first 70s ribosome, with gentamicin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
13. " " " " " "  = 2qbc:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin. This file contains the 50s subunit of the second 70s ribosome, with gentamicin bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
14. " " " " " "  = 2qbe:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
15. " " " " " "  = 2qbg:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
16. " " " " " "  = 2qbi:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin and ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with gentamicin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
17. " " " " " "  = 2qbk:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with gentamicin and ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with gentamicin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
18. " " " " " "  = 2qov:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin. This file contains the 50s subunit of the first 70s ribosome. The entire crystal structure contains two 70s ribosomes.
19. " " " " " "  = 2qox:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin. This file contains the 50s subunit of the second 70s ribosome. The entire crystal structure contains two 70s ribosomes.
20. " " " " " "  = 2qoz:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin and neomycin. This file contains the 50s subunit of the first 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes.
21. " " " " " "  = 2qp1:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with spectinomycin and neomycin. This file contains the 50s subunit of the second 70s ribosome, with neomycin bound. The entire crystal structure contains two 70s ribosomes.
22. " " " " " "  = 2rdo:Y *
50s subunit with ef-g(gdpnp) and rrf bound
23. " " " " " "  = 2vhm:Y *
Structure of pdf binding helix in complex with the ribosome (part 1 of 4)
24. " " " " " "  = 2vhn:Y *
Structure of pdf binding helix in complex with the ribosome. (Part 2 of 4)
25. " " " " " "  = 2wwq:2 *
E.Coli 70s ribosome stalled during translation of tnac leader peptide. This file contains the 50s, the p-site tRNA and the tnac leader peptide (part 2 of 2).
26. " " " " " "  = 2z4l:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with paromomycin and ribosome recycling factor (rrf). This file contains the 50s subunit of the first 70s ribosome, with paromomycin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
27. " " " " " "  = 2z4n:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with paromomycin and ribosome recycling factor (rrf). This file contains the 50s subunit of the second 70s ribosome, with paromomycin and rrf bound. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
28. " " " " " "  = 3bbx:Y *
The hsp15 protein fitted into the low resolution cryo-em map 50s.Nc-tRNA.Hsp15 complex
29. " " " " " "  = 3df2:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with hygromycin b. This file contains the 50s subunit of the first 70s ribosome. The entire crystal structure contains two 70s ribosomes.
30. " " " " " "  = 3df4:Y *
Crystal structure of the bacterial ribosome from escherichia coli in complex with hygromycin b. This file contains the 50s subunit of the second 70s ribosome. The entire crystal structure contains two 70s ribosomes.
31. " " " " " "  = 3e1b:R *
Structure of the 50s subunit of e. Coli ribosome in pre-acco state
32. " " " " " "  = 3e1d:R *
Structure of the 50s subunit of e. Coli ribosome in post-acc state
33. " " " " " "  = 3fik:Z *
Ternary complex-bound e.Coli 70s ribosome. This entry consis 50s subunit.
34. " " " " " "  = 3i1n:Z *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
35. " " " " " "  = 3i1p:Z *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
36. " " " " " "  = 3i1r:Z *
Crystal structure of the e. Coli 70s ribosome in an intermed of ratcheting
37. " " " " " "  = 3i1t:Z *
Crystal structure of the e. Coli 70s ribosome in an intermed of ratcheting
38. " " " " " "  = 3i20:Z *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
39. " " " " " "  = 3i22:Z *
Crystal structure of the e. Coli 70s ribosome in an intermediate state of ratcheting
40. " " " " " "  = 3iy9:Y *
Leishmania tarentolae mitochondrial large ribosomal subunit model
41. " " " " " "  = 3izt:a *
Structural insights into cognate vs. Near-cognate discrimina during decoding. This entry contains the large subunit of a programmed with a near-cognate codon.
42. " " " " " "  = 3izu:a *
Structural insights into cognate vs. Near-cognate discrimina during decoding. This entry contains the large subunit of a programmed with a cognate codon
43. " " " " " "  = 3j01:Z *
Structure of the ribosome-secye complex in the membrane envi
44. " " " " " "  = 3j0t:1 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class2 of the six classes)
45. " " " " " "  = 3j0w:1 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 4a of the six classes)
46. " " " " " "  = 3j0y:1 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 4b of the six classes)
47. " " " " " "  = 3j11:1 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 3 of the six classes)
48. " " " " " "  = 3j12:1 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 5 of the six classes)
49. " " " " " "  = 3j14:1 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 6 of the six classes)
50. " " " " " "  = 3j19:Z *
Structure of the bacterial ribosome complexed by tmrna-smpb during translocation and mld-loading (50s subunit)
51. " " " " " "  = 3j37:3 *
Tetracycline resistance protein tet(o) bound to the ribosome
52. " " " " " "  = 3j4x:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic pre- translocation state (pre1b, 50s subunit)
53. " " " " " "  = 3j50:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (pre2, 50s subunit)
54. " " " " " "  = 3j51:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (pre3, 50s subunit)
55. " " " " " "  = 3j52:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic pre- translocation state (pre1a, 50s subunit)
56. " " " " " "  = 3j54:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre4, 50s subunit)
57. " " " " " "  = 3j56:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre5a, 50s subunit)
58. " " " " " "  = 3j58:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in hybrid pre- translocation state (pre5b, 50s subunit)
59. " " " " " "  = 3j5a:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in classic post translocation state (post1, 50s subunit)
60. " " " " " "  = 3j5c:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post2a, 50s subunit)
61. " " " " " "  = 3j5e:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post2b, 50s subunit)
62. " " " " " "  = 3j5g:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post3a, 50s subunit)
63. " " " " " "  = 3j5i:Z *
E. Coli 70s-fmetval-trnaval-trnafmet complex in intermediate translocation state (post3b, 50s subunit)
64. " " " " " "  = 3j5k:Z *
E. Coli 70s-fmetval-trnaval post-translocation complex (post subunit)
65. " " " " " "  = 3j5o:Z *
Visualization of two trnas trapped in transit during ef-g-me translocation (50s subunit)
66. " " " " " "  = 3j5u:2 *
Structure of the ribosome with elongation factor g trapped i translocation state (pre-translocation 70s tRNA structure, subunit)
67. " " " " " "  = 3j5w:3 *
Structure of the ribosome with elongation factor g trapped i translocation state (pre-translocation 70s tRNA Ef-g struct subunit)
68. " " " " " "  = 3kcr:Z *
Ribosome-secy complex. This entry 3kcr contains 50s ribosomal subnit. The 30s ribosomal subunit can be found in PDB entry 3kc4
69. " " " " " "  = 3oas:Z *
Crystal structure of the e. Coli ribosome bound to telithrom file contains the 50s subunit of the second 70s ribosome.
70. " " " " " "  = 3oat:Z *
Crystal structure of the e. Coli ribosome bound to telithrom file contains the 50s subunit of the first 70s ribosome wit telithromycin bound.
71. " " " " " "  = 3ofc:Z *
Crystal structure of the e. Coli ribosome bound to chloramph this file contains the 50s subunit of the first 70s ribosom chloramphenicol bound.
72. " " " " " "  = 3ofd:Z *
Crystal structure of the e. Coli ribosome bound to chloramph this file contains the 50s subunit of the second 70s riboso
73. " " " " " "  = 3ofq:Z *
Crystal structure of the e. Coli ribosome bound to erythromy file contains the 50s subunit of the second 70s ribosome.
74. " " " " " "  = 3ofr:Z *
Crystal structure of the e. Coli ribosome bound to erythromy file contains the 50s subunit of the first 70s ribosome wit erthromycin bound.
75. " " " " " "  = 3ofz:Z *
Crystal structure of the e. Coli ribosome bound to clindamyc file contains the 50s subunit of the first 70s ribosome bou clindamycin.
76. " " " " " "  = 3og0:Z *
Crystal structure of the e. Coli ribosome bound to clindamyc file contains the 50s subunit of the second 70s ribosome.
77. " " " " " "  = 3orb:Z *
Crystal structure of the e. Coli ribosome bound to cem-101. Contains the 50s subunit of the first 70s ribosome bound to
78. " " " " " "  = 3r8s:Z *
Structures of the bacterial ribosome in classical and hybrid tRNA binding
79. " " " " " "  = 3r8t:Z *
Structures of the bacterial ribosome in classical and hybrid tRNA binding
80. " " " " " "  = 3sgf:3 *
Crystal structure of release factor rf3 trapped in the gtp s rotated conformation of the ribosome
81. " " " " " "  = 3uos:3 *
Crystal structure of release factor rf3 trapped in the gtp s rotated conformation of the ribosome (without viomycin)
82. " " " " " "  = 4gar:Z *
Allosteric control of the ribosome by small-molecule antibio
83. " " " " " "  = 4gau:Z *
Allosteric control of the ribosome by small-molecule antibio
84. " " " " " "  = 4kix:Z *
Control of ribosomal subunit rotation by elongation factor g
85. " " " " " "  = 4kiz:Z *
Control of ribosomal subunit rotation by elongation factor g
86. " " " " " "  = 4kj1:Z *
Control of ribosomal subunit rotation by elongation factor g
87. " " " " " "  = 4kj3:Z *
Control of ribosomal subunit rotation by elongation factor g
88. " " " " " "  = 4kj5:Z *
Control of ribosomal subunit rotation by elongation factor g
89. " " " " " "  = 4kj7:Z *
Control of ribosomal subunit rotation by elongation factor g
90. " " " " " "  = 4kj9:Z *
Control of ribosomal subunit rotation by elongation factor g
91. " " " " " "  = 4kjb:Z *
Control of ribosomal subunit rotation by elongation factor g
92. 349 100.0% 56 56 546.8 1.7e-23 1p85:X * Real space refined coordinates of the 50s subunit fitted int resolution cryo-em map of the ef-g.Gtp state of e. Coli 70s
93. " " " " " "  = 1p86:X *
Real space refined coordinates of the 50s subunit fitted int resolution cryo-em map of the initiation-like state of e. C ribosome
94. " " " " " "  = 2gya:X *
Structure of the 50s subunit of a pre-translocational e. Coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-em map emd-1056
95. " " " " " "  = 2gyc:X *
Structure of the 50s subunit of a secm-stalled e. Coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-em map emd-1143
96. 158 45.5% 55 55 256.2 2.6e-07 1kc9:X * Crystal structure of the large ribosomal subunit from deinococcus radiodurans
97. " " " " " "  = 1kpj:X *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
98. " " " " " "  = 1lnr:X *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
99. " " " " " "  = 1nkw:X *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
100. " " " " " "  = 1nwx:X *
Complex of the large ribosomal subunit from deinococcus radiodurans with abt-773
101. " " " " " "  = 1nwy:X *
Complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin
102. " " " " " "  = 1pnu:X *
Crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. This file, 1pnu, contains only molecules of the 50s ribosomal subunit. The 30s subunit, mRNA, p-site tRNA, and a-site tRNA are in the PDB file 1pns.
103. " " " " " "  = 1pny:X *
Crystal structure of the wild type ribosome from e. Coli, 50s subunit of 70s ribosome. This file, 1pny, contains only molecules of the 50s ribosomal subunit. The 30s subunit is in the PDB file 1pnx.
104. " " " " " "  = 1sm1:X *
Complex of the large ribosomal subunit from deinococcus radi with quinupristin and dalfopristin
105. " " " " " "  = 1vor:Z *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
106. " " " " " "  = 1vou:Z *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
107. " " " " " "  = 1vow:Z *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
108. " " " " " "  = 1voy:Z *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
109. " " " " " "  = 1vp0:Z *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
110. " " " " " "  = 1xbp:X *
Inhibition of peptide bond formation by pleuromutilins: the structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with tiamulin
111. " " " " " "  = 2zjp:W *
Thiopeptide antibiotic nosiheptide bound to the large riboso subunit of deinococcus radiodurans
112. " " " " " "  = 2zjq:W *
Interaction of l7 with l11 induced by microccocin binding to deinococcus radiodurans 50s subunit
113. " " " " " "  = 2zjr:W *
Refined native structure of the large ribosomal subunit (50s) from deinococcus radiodurans
114. " " " " " "  = 3cf5:W *
Thiopeptide antibiotic thiostrepton bound to the large ribos subunit of deinococcus radiodurans
115. " " " " " "  = 3dll:W *
The oxazolidinone antibiotics perturb the ribosomal peptidyl-transferase center and effect tRNA positioning
116. " " " " " "  = 3pio:W *
Crystal structure of the synergistic antibiotic pair lankamy lankacidin in complex with the large ribosomal subunit
117. " " " " " "  = 3pip:W *
Crystal structure of the synergistic antibiotic pair lankamy lankacidin in complex with the large ribosomal subunit
118. " " " " " "  = 4io9:W *
Crystal structure of compound 4d bound to large ribosomal su (50s) from deinococcus radiodurans
119. " " " " " "  = 4ioa:W *
Crystal structure of compound 4e bound to large ribosomal su (50s) from deinococcus radiodurans
120. " " " " " "  = 4ioc:W *
Crystal structure of compound 4f bound to large ribosomal su (50s) from deinococcus radiodurans
121. 157 49.1% 55 56 254.6 3.3e-07 3j3v:Y Atomic model of the immature 50s subunit from bacillus subti i-a)
122. 141 44.4% 54 58 230.0 7.6e-06 4dhc:3 Crystal structure of yaej bound to the 70s ribosome
123. 141 44.4% 54 59 229.9 7.7e-06 2hgj:2 * Crystal structure of the 70s thermus thermophilus ribosome s the 16s 3'-end mimicks mRNA e and p codons. This entry 2hgj 50s ribosomal subunit. The 30s ribosomal subunit can be fou entry 2hgi.
124. " " " " " "  = 2hgq:2 *
Crystal structure of the 70s thermus thermophilus ribosome w translocated and rotated shine-dalgarno duplex. This entry contains 50s ribosomal subunit. The 30s ribosomal subunit c found in PDB entry 2hgp.
125. " " " " " "  = 2hgu:2 *
70s t.Th. Ribosome functional complex with mRNA and e- and p trnas at 4.5a. This entry 2hgu contains 50s ribosomal subun 30s ribosomal subunit can be found in PDB entry 2hgr.
126. 141 44.4% 54 59 229.9 7.7e-06 2xqe:3 * The structure of ef-tu and aminoacyl-tRNA bound to the 70s ribosome with a gtp analog
127. " " " " " "  = 2xtg:3 *
tRNA tranlocation on the 70s ribosome: the pre- translocational translocation intermediate ti(pre)
128. " " " " " "  = 2xux:3 *
tRNA translocation on the 70s ribosome: the post- translocational translocation intermediate ti(post)
129. " " " " " "  = 2y0v:3 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
130. " " " " " "  = 2y0x:3 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
131. " " " " " "  = 2y0z:3 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
132. " " " " " "  = 2y11:3 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
133. " " " " " "  = 2y13:3 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
134. " " " " " "  = 2y15:3 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a cognate codon on the 70s ribosome.
135. " " " " " "  = 2y17:3 *
Ef-tu complex 3
136. " " " " " "  = 2y19:3 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
137. " " " " " "  = 3d5b:3 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of one 70s ribosome. The enti structure contains two 70s ribosomes as described in remark
138. " " " " " "  = 3d5d:3 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of the second 70s ribosome. T crystal structure contains two 70s ribosomes as described i 400.
139. " " " " " "  = 3f1f:3 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of o ribosome. The entire crystal structure contains two 70s rib described in remark 400.
140. " " " " " "  = 3f1h:3 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of t 70s ribosome. The entire crystal structure contains two 70s as described in remark 400.
141. 141 44.4% 54 59 229.9 7.7e-06 3hux:3 * Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule i.
142. " " " " " "  = 3i8f:X *
Elongation complex of the 70s ribosome with three trnas and entry 3i8f contains 50s ribosomal subunit. The 30s ribosoma can be found in PDB entry 3i8g. Molecule b in the same asym unit is deposited as 3i8g (30s) and 3i8f (50s).
143. " " " " " "  = 3i8i:X *
Elongation complex of the 70s ribosome with three trnas and entry 3i8i contains 50s ribosomal subnit. The 30s ribosomal can be found in PDB entry 3i8h. Molecule a in the same asym unit is deposited as 3i8f (50s) and 3i8g (30s).
144. " " " " " "  = 3i9c:X *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9c contains 50s ribosomal subunit of molecule b. The 30s subunit can be found in PDB entry 3i9b. Molecule a in the s asymmetric unit is deposited as 3i9d (30s) and 3i9e (50s)
145. " " " " " "  = 3i9e:X *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9e contains 50s ribosomal subunit of molecule a. The 30s subunit can be found in PDB entry 3i9d. Molecule b in the s asymmetric unit is deposited as 3i9b (30s) and 3i9c (50s)
146. 141 44.4% 54 59 229.9 7.7e-06 3kir:3 * Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 2 of 4)
147. " " " " " "  = 3kit:3 *
Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 4 of 4)
148. " " " " " "  = 3kiw:3 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 2 of 4)
149. " " " " " "  = 3kiy:3 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 4 of 4)
150. " " " " " "  = 3mrz:Z *
Recognition of the amber stop codon by release factor rf1. T 3mrz contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3ms0. Molecule a in the same asymmetric deposited as 3mr8 (50s) and 3ms1 (30s).
151. " " " " " "  = 3ms1:Z *
Recognition of the amber stop codon by release factor rf1. T 3ms1 contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3mr8. Molecule b in the same asymmetric deposited as 3mrz (50s) and 3ms0 (30s).
152. " " " " " "  = 3pyo:Z *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the first 70s ribosome.
153. " " " " " "  = 3pyr:Z *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the second 70s ribosome.
154. " " " " " "  = 3pyt:Z *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the first 70s ribosome.
155. " " " " " "  = 3pyv:Z *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the second 70s ribosome.
156. 141 44.4% 54 59 229.9 7.7e-06 3tve:X * Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-leu complex
157. " " " " " "  = 3tvh:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-leu complex
158. " " " " " "  = 3uxq:3 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
159. " " " " " "  = 3uxr:3 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
160. " " " " " "  = 3uye:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
161. " " " " " "  = 3uyg:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
162. " " " " " "  = 3uz1:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex with paromomycin
163. " " " " " "  = 3uz2:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-leu complex with paromomycin.
164. " " " " " "  = 3uz8:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-tyr complex.
165. " " " " " "  = 3uz9:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-tyr complex.
166. " " " " " "  = 3uzf:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex
167. " " " " " "  = 3uzh:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex.
168. " " " " " "  = 3uzk:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex with paromomycin
169. " " " " " "  = 3uzn:X *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex with paromomycin
170. " " " " " "  = 3v23:3 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
171. " " " " " "  = 3v25:3 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 2nd ribosom asu
172. " " " " " "  = 3v27:3 *
Crystal structure of hpf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
173. " " " " " "  = 3v29:3 *
Crystal structure of hpf bound to the 70s ribosome. This ent contains the 50s subunit of the 2nd molecule in the asu.
174. " " " " " "  = 3v2d:3 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 1st ribosom asu
175. " " " " " "  = 3v2f:3 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 2nd ribosom asu
176. " " " " " "  = 4dha:3 *
Crystal structure of yaej bound to the 70s ribosome
177. " " " " " "  = 4g5l:X *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule a.
178. " " " " " "  = 4g5n:X *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule b.
179. " " " " " "  = 4g5u:X *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule a.
180. " " " " " "  = 4g5w:X *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule b.
181. 141 44.4% 54 59 229.9 7.7e-06 4jux:3 * Crystal structure of the ribosome bound to elongation factor guanosine triphosphatase state (this file contains the 50s
182. " " " " " "  = 4k0m:3 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
183. " " " " " "  = 4k0q:3 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
184. " " " " " "  = 4kfi:3 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the a subunit
185. " " " " " "  = 4kfl:3 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the b subunit
186. " " " " " "  = 4l6j:Z *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the first 70s ribosome.
187. " " " " " "  = 4l6l:Z *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the second 70s ribosome
188. 141 44.4% 54 60 229.8 7.8e-06 1bxy:A * Crystal structure of ribosomal protein l30 from thermus thermophilus at 1.9 a resolution: conformational flexibility of the molecule.
189. " " " " " "  = 1giy:X *
Crystal structure of the ribosome at 5.5 a resolution. This file, 1giy, contains the 50s ribosome subunit. The 30s ribosome subunit, three tRNA, and mRNA molecules are in the file 1gix
190. " " " " " "  = 1ml5:x *
Structure of the e. Coli ribosomal termination complex with factor 2
191. " " " " " "  = 1vs9:X *
Crystal structure of a 70s ribosome-tRNA complex reveals functional interactions and rearrangements. This file, 1vs9, contains the 50s ribosome subunit. 30s ribosome subunit is in the file 2i1c
192. " " " " " "  = 1vsa:X *
Crystal structure of a 70s ribosome-tRNA complex reveals fun interactions and rearrangements. This file, 1vsa, contains ribosome subunit. 30s ribosome subunit is in the file 2ow8
193. " " " " " "  = 1vsp:X *
Interactions and dynamics of the shine-dalgarno helix in the ribosome. This file, 1vsp, contains the 50s ribosome subuni ribosome subunit is in the file 2qnh
194. " " " " " "  = 1yl3:X *
Crystal structure of 70s ribosome with thrs operator and trn subunit. The coordinates for the small subunit are in the p 1yl4.
195. " " " " " "  = 2b66:3 *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400
196. " " " " " "  = 2b9n:3 *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400.
197. " " " " " "  = 2b9p:3 *
50s ribosomal subunit from a crystal structure of the riboso complex with trnas and mRNA with a stop codon in the a-site file contains the 50s subunit from a crystal structure of t ribosome in complex with trnas and mRNA with a stop codon i site and is described in remark 400.
198. " " " " " "  = 2j01:3 *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 2 of 4). This file contains the 50s subunit from molecule i.
199. " " " " " "  = 2j03:3 *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50s subunit from molecule ii.
200. " " " " " "  = 2jl6:3 *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 2 of 4). This file contains the 50s subunit.
201. " " " " " "  = 2jl8:3 *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 4 of 4). This file contains the 50s subunit.
202. " " " " " "  = 2v47:3 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 2 of 4). This file contains the 50s subunit for molecule 1.
203. " " " " " "  = 2v49:3 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 4 of 4). This file contains the 50s subunit of molecule 2.
204. " " " " " "  = 2wdi:3 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule i.
205. " " " " " "  = 2wdj:3 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule ii.
206. " " " " " "  = 2wdl:3 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule i.
207. " " " " " "  = 2wdn:3 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule ii.
208. " " " " " "  = 2wh2:3 *
Insights into translational termination from the structure of rf2 bound to the ribosome
209. " " " " " "  = 2wh4:3 *
Insights into translational termination from the structure of rf2 bound to the ribosome
210. " " " " " "  = 2wrj:3 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state (part 2 of 4).
211. " " " " " "  = 2wrl:3 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state. (Part 4 of 4).
212. " " " " " "  = 2wro:3 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 2 of 4).
213. " " " " " "  = 2wrr:3 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 4 of 4).
214. " " " " " "  = 2x9s:3 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
215. " " " " " "  = 2x9u:3 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
216. " " " " " "  = 2xg0:3 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 2 of 4)
217. " " " " " "  = 2xg2:3 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 4 of 4)
218. " " " " " "  = 3fin:3 *
T. Thermophilus 70s ribosome in complex with mRNA, trnas and tu.Gdp.Kirromycin ternary complex, fitted to a 6.4 a cryo-e this file contains the 50s subunit.
219. " " " " " "  = 3huz:3 *
Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule ii.
220. " " " " " "  = 3kni:3 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule i
221. " " " " " "  = 3knk:3 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule ii.
222. " " " " " "  = 3knm:3 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule i.
223. " " " " " "  = 3kno:3 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule ii
224. " " " " " "  = 3oh5:3 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
225. " " " " " "  = 3oh7:3 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
226. " " " " " "  = 3ohj:3 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
227. " " " " " "  = 3ohk:3 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
228. " " " " " "  = 3ohz:3 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
229. " " " " " "  = 3oi1:3 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
230. " " " " " "  = 3oi3:3 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
231. " " " " " "  = 3oi5:3 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
232. " " " " " "  = 3v6w:3 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit
233. " " " " " "  = 3v6x:3 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit
234. " " " " " "  = 3zn9:3 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
235. " " " " " "  = 3zne:3 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
236. " " " " " "  = 3zvp:3 *
Crystal structure of the hybrid state of ribosome in complex the guanosine triphosphatase release factor 3
237. " " " " " "  = 4abs:3 *
Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin w 70s ribosome
238. " " " " " "  = 4b8g:3 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
239. " " " " " "  = 4b8i:3 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
240. " " " " " "  = 4btd:3 *
Thermus thermophilus ribosome
241. " " " " " "  = 4byc:3 *
Structure of thermus thermophilus 50s ribosome
242. " " " " " "  = 4bye:3 *
Structure of thermus thermophilus 50s ribosome
243. " " " " " "  = 4ejb:3 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit.
244. " " " " " "  = 4ejc:3 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit.
245. " " " " " "  = 4kbu:3 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit a. The full asymmetric unit contains PDB entries 4kbt (30s subunit a), 4kbv (30s subuni 4kbw (50s subunit b).
246. " " " " " "  = 4kbw:3 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit b. The full asymmetric unit contains PDB entries 4kbv (30s subunit b), 4kbt (30s subuni 4kbu (50s subunit a).
247. " " " " " "  = 4kcz:3 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state.T contains the 50s ribosomal subunit a. The 30s subunit a can in 4kcy. Molecule b in the same asymmetric unit is deposite (30s) and 4kd2 (50s).G1 50s ribosomal subunit i
248. " " " " " "  = 4kd2:3 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains the 50s ribosomal subunit b. The 30s subunit b can in 4kd0. Molecule a in the same asymmetric unit is deposite (30s) and 4kcz (50s).
249. " " " " " "  = 4kd9:3 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kd8. Molecule b in the same asymmetric uni deposited as 4kda (30s) and 4kdb (50s).
250. " " " " " "  = 4kdb:3 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kda. Molecule a in the same asymmetric uni deposited as 4kd8 (30s) and 4kd9 (50s).
251. " " " " " "  = 4kdh:3 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kdg. Molecule b in the same asymmetric uni deposited as 4kdj (30s) and 4kdk (50s).
252. " " " " " "  = 4kdk:3 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kdj. Molecule a in the same asymmetric uni deposited as 4kdg (30s) and 4kdh (50s).
253. 127 43.1% 51 51 209.5 0.00011 1twv:O Model structure of the t. Thermophilus 70s ribosome,50s subunit of 70s ribosome. This file, 1twv, contains only molecules of the 50s ribosomal subunit. The 30s subunit is in the PDB file 1twt.
254. 75 33.3% 48 155 123.7 6.4 3j21:Y * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
255. " " " " " "  = 3j44:Y *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
256. 73 40.6% 32 94 123.7 6.4 3vr5:H Crystal structure of nucleotide-free enterococcus hirae v1-a [ev1(l)]
257. 72 43.3% 30 101 121.7 8.2 3aon:B Crystal structure of the central axis (ntpd-ntpg) in the cat portion of enterococcus hirae v-type sodium atpase
258. 72 43.3% 30 102 121.7 8.3 3vr4:H * Crystal structure of enterococcus hirae v1-atpase [ev1]
259. " " " " " "  = 3vr6:H *
Crystal structure of amp-pnp bound enterococcus hirae v1-atp
260. 71 43.8% 32 129 118.7 12 4g35:A Mcl-1 in complex with a biphenyl cross-linked noxa peptide.
261. 70 46.2% 26 149 116.3 16 2img:A Crystal structure of dual specificity protein phosphatase 23 from homo sapiens in complex with ligand malate ion
262. 70 46.2% 26 150 116.3 16 4erc:A Structure of vhz bound to metavanadate

Number of sequences: 262

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 71 24.6% 61 203 116.0 17 1m0u:A Crystal structure of the drosophila glutathione s-transferas complex with glutathione
2. 70 29.3% 58 215 114.2 22 4is2:A Crystal structure of the apo form of a 3alpha-hydroxysteroid dehydrogenase (baia2) associated with secondary bile acid s from clostridium scindens vpi12708 at 1.90 a resolution
3. 65 33.3% 57 126 109.7 38 3hhq:A Crystal structure of apo dut1p from saccharomyces cerevisiae
4. 65 26.4% 53 154 108.5 45 1ffk:T * Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
5. " " " " " "  = 1jj2:V *
Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
6. " " " " " "  = 1k73:X *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
7. " " " " " "  = 1k8a:X *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
8. " " " " " "  = 1k9m:X *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
9. " " " " " "  = 1kc8:X *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
10. " " " " " "  = 1kd1:X *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
11. " " " " " "  = 1kqs:V *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
12. " " " " " "  = 1m1k:X *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
13. " " " " " "  = 1m90:X *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
14. " " " " " "  = 1n8r:X *
Structure of large ribosomal subunit in complex with virginiamycin m
15. " " " " " "  = 1nji:X *
Structure of chloramphenicol bound to the 50s ribosomal subunit
16. " " " " " "  = 1q7y:X *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
17. " " " " " "  = 1q81:X *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
18. " " " " " "  = 1q82:X *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
19. " " " " " "  = 1q86:X *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
20. " " " " " "  = 1qvf:V *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
21. " " " " " "  = 1qvg:V *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
22. " " " " " "  = 1s72:W *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
23. " " " " " "  = 1vq4:W *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
24. " " " " " "  = 1vq5:W *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
25. " " " " " "  = 1vq6:W *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
26. " " " " " "  = 1vq7:W *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
27. " " " " " "  = 1vq8:W *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
28. " " " " " "  = 1vq9:W *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
29. " " " " " "  = 1vqk:W *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
30. " " " " " "  = 1vql:W *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
31. " " " " " "  = 1vqm:W *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
32. " " " " " "  = 1vqn:W *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1vqo:W *
The structure of ccpmn bound to the large ribosomal subunit marismortui
34. " " " " " "  = 1vqp:W *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
35. " " " " " "  = 1w2b:V *
Trigger factor ribosome binding domain in complex with 50s
36. " " " " " "  = 1yhq:W *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
37. " " " " " "  = 1yi2:W *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
38. " " " " " "  = 1yij:W *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
39. " " " " " "  = 1yit:W *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
40. " " " " " "  = 1yj9:W *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
41. " " " " " "  = 1yjn:W *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
42. " " " " " "  = 1yjw:W *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
43. " " " " " "  = 2otj:W *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
44. " " " " " "  = 2otl:W *
Girodazole bound to the large subunit of haloarcula marismor
45. " " " " " "  = 2qa4:W *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
46. " " " " " "  = 2qex:W *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
47. " " " " " "  = 3cc2:W *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
48. " " " " " "  = 3cc4:W *
Co-crystal structure of anisomycin bound to the 50s ribosoma
49. " " " " " "  = 3cc7:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
50. " " " " " "  = 3cce:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
51. " " " " " "  = 3ccj:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
52. " " " " " "  = 3ccl:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
53. " " " " " "  = 3ccm:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
54. " " " " " "  = 3ccq:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
55. " " " " " "  = 3ccr:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
56. " " " " " "  = 3ccs:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
57. " " " " " "  = 3ccu:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
58. " " " " " "  = 3ccv:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
59. " " " " " "  = 3cd6:W *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
60. " " " " " "  = 3cma:W *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
61. " " " " " "  = 3cme:W *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
62. " " " " " "  = 3cpw:V *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
63. " " " " " "  = 3cxc:V *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
64. " " " " " "  = 3g4s:W *
Co-crystal structure of tiamulin bound to the large ribosoma
65. " " " " " "  = 3g6e:W *
Co-crystal structure of homoharringtonine bound to the large subunit
66. " " " " " "  = 3g71:W *
Co-crystal structure of bruceantin bound to the large riboso subunit
67. " " " " " "  = 3i55:W *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
68. " " " " " "  = 3i56:W *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
69. " " " " " "  = 3ow2:V *
Crystal structure of enhanced macrolide bound to 50s ribosom
70. " " " " " "  = 4adx:W *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
71. " " " " " "  = 4hub:W *
The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins

Number of sequences: 71

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer