spacer
spacer

SAS results for UniProt accession no. P0CX27

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA   to metal
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P0CX27 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P0CX27 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 27 unique sequences (including 9 consensus sequences) giving 110 sequence matches in all. The 8 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P0CX27 -----------------------------------------------------------------    60S ribosomal protein L42-A OS=Saccharomyces cerevisiae  ...
3izc:r*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:F*-----------------------------------------------------------------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3jyw:Z -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:1*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3iz5:r*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:o -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:o -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:4 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3zf7:t -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
4a18:C*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3kjr:A -----yegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnvvi    Crystal structure of dihydrofolate reductase/thymidylate  ...
3k2h:A syegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnvvifgrk    Co-crystal structure of dihydrofolate reductase/thymidylate  ...
3nrr:A nsyegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnvvifgr    Co-crystal structure of dihydrofolate reductase-thymidylate  ...
3ve2:A -----------------------------------------------------------------    The 2.1 angstrom crystal structure of transferrin binding  ...
3j38:e -----------------------------------------------------------------    Structure of the d. Melanogaster 40s ribosomal proteins
1yvo:A -----------------------------------------------------------------    Hypothetical acetyltransferase from p.Aeruginosa pa01
2bl1:A -----------------------------------------------------------------    Crystal structure of a putative phosphinothricin  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P0CX27 -----------------------------------------------------------------    60S ribosomal protein L42-A OS=Saccharomyces cerevisiae  ...
3izc:r*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:F*-----------------------------------------------------------------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3jyw:Z -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:1*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3iz5:r*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:o -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:o -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:4 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3zf7:t -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
4a18:C*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3kjr:A fgrktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifilggsfly    Crystal structure of dihydrofolate reductase/thymidylate  ...
3k2h:A tyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifilggsflykevl    Co-crystal structure of dihydrofolate reductase/thymidylate  ...
3nrr:A ktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifilggsflykev    Co-crystal structure of dihydrofolate reductase-thymidylate  ...
3ve2:A ------------------dqggygfamrlkrrnwypgaeesevklnesdweatglptkpkelpkr    The 2.1 angstrom crystal structure of transferrin binding  ...
3j38:e -----------------------------------------------------------------    Structure of the d. Melanogaster 40s ribosomal proteins
1yvo:A -----------------------------------------------------------------    Hypothetical acetyltransferase from p.Aeruginosa pa01
2bl1:A -----------------------------------------------------------------    Crystal structure of a putative phosphinothricin  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P0CX27 -----------------------------------------------------------------    60S ribosomal protein L42-A OS=Saccharomyces cerevisiae  ...
3izc:r*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:F*-----------------------------------------------------------------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3jyw:Z -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:1*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3iz5:r*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:o -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:o -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:4 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3zf7:t -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
4a18:C*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3kjr:A kevldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfviyerkpfdqllm    Crystal structure of dihydrofolate reductase/thymidylate  ...
3k2h:A dnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfviyerkdckppfdqllm    Co-crystal structure of dihydrofolate reductase/thymidylate  ...
3nrr:A ldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfviyerkddppfdqllm    Co-crystal structure of dihydrofolate reductase-thymidylate  ...
3ve2:A qksviekvetdgdsdiysspyltpqpknqatghenfqyvysgwfykhaasekdfsnkkiksgddg    The 2.1 angstrom crystal structure of transferrin binding  ...
3j38:e -----------------------------------------------------------------    Structure of the d. Melanogaster 40s ribosomal proteins
1yvo:A ----------------------sirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfd    Hypothetical acetyltransferase from p.Aeruginosa pa01
2bl1:A ---------------------asirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfd    Crystal structure of a putative phosphinothricin  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P0CX27 ---mvnvpktrktyckgktcrkhtqhkvtqykagka--slfaqgkrrydrk----qsgfggqtkp    60S ribosomal protein L42-A OS=Saccharomyces cerevisiae  ...
3izc:r*---mvnvpktrktyckgktcrkhtqhkvtqykagka--slfaqgkrrydrk----qsgfggqtkp×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*----vnvpktrktyckgktcrkhtqhkvtqykagka--slfaqgkrrydrk----qsgfggqtkp×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:F*----vnvpktrktyckgktcrkhtqhkvtqykagka--slfaqgkrrydrk----qsgfggqtkp×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3jyw:Z ----vnvpktrktyckgktcrkhtqhkvtqykagka--slfaqgkrrydrk----qsgfggqtkp    Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:1*----vnvpktrktyckgktcrkhtqhkvtqykagka--slfaqgkrrydrk----qsgfggqtkp×2  Structure of the translating 80s ribosome from yeast,  ...
3iz5:r*---mvnvpktkktycknkecrkhtlhkvtqykkgkd--slsaqgkrrydrk----qsgyggqtkp×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:o ----vnvpktrrtfc--kkcgkhqphkvtqykkgkd--slyaqgkrrydrk----qsgyggqtkp    Structure of the human 60s ribosomal proteins
3j39:o ---mvnvpkqrrtfck--kckvhklhkvtqykkske--rkgaqgrrrydrk----qqgfggqtkp    Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:4 ----vnvpktrrtfck--kcgkhqphkvtqykkgkd--slyaqgkrrydrk----qsgyggqtkp    Structure of a mammalian ribosomal 60s subunit within an  ...
3zf7:t ----vnypkkkkmhcpdercnahksfkvvqykagka--rlyargkrrydrk----qsgyggqtkp    High-resolution cryo-electron microscopy structure of the  ...
4a18:C*----vqvpktrktyc--kkcnshtnhkvsqykkske--sthaqgrrrydmk----qsgfggqtkp×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:j*----mkypkqirtycp--fckkhtihkvervkkrpr--selsagqrrfrri----lkgyggfprp×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1ffk:Z*----mqmprrfntycp--hcnehqehevekvrsgrq--tgmkwidrqrern-----sgigndgk-×68 Crystal structure of the large ribosomal subunit from  ...
3kjr:A tgtdisvpkpkyvacpgvrirnheef---qyldila--dvlshgvlkpnrtgtdayskfgyqmrf    Crystal structure of dihydrofolate reductase/thymidylate  ...
3k2h:A tgtdisvpkpkyvacpgvrirnheef---qyldila--dvlshgvlkpnrtgtdayskfgyqmrf    Co-crystal structure of dihydrofolate reductase/thymidylate  ...
3nrr:A tgtdisvpkpkyvacpgvrirnheef---qyldila--dvlshgvlkpnrtgtdayskfgyqmrf    Co-crystal structure of dihydrofolate reductase-thymidylate  ...
3ve2:A yifyhgekpsrqlpasgkviykgvwhfvtdtkkgqdfreiiqpskkqgdr-----ysgfsgdgse    The 2.1 angstrom crystal structure of transferrin binding  ...
3j38:e ----vhgslaragkvkgqtpkvekqek-kkkktgra--krriqynrrfvnf----vqgfgrrrgp    Structure of the d. Melanogaster 40s ribosomal proteins
1yvo:A trarqgypilvasdaagevlgyasygdwrpfegfrg--tvehsvyvrddqr----gkglgvqllq    Hypothetical acetyltransferase from p.Aeruginosa pa01
2bl1:A ararqgypilvasdaagevlgyasygdwrpfegfrg--tvehsvyvrddqr----gkglgvqllq    Crystal structure of a putative phosphinothricin  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P0CX27 vfhkka---k--ttkkvvlr------lecvk--c-ktraq-ltlkrckhfelggekkqkgqalqf    60S ribosomal protein L42-A OS=Saccharomyces cerevisiae  ...
3izc:r*vfhkka---k--ttkkvvlr------lecvk--c-ktraq-ltlkrckhfelggekkqkgqalqf×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*vfhkka---k--ttkkvvlr------lecvk--c-ktraq-ltlkrckhfelggekkqkgqalqf×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:F*vfhkka---k--ttkkvvlr------lecvk--c-ktraq-ltlkrckhfelgge----------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3jyw:Z vfhkka---k--ttkkvvlr------lecvk--c-ktraq-ltlkrckhfel-------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:1*vfhkka---k--ttkkvvlr------lecvk--c-ktraq-ltlkrckhfe--------------×2  Structure of the translating 80s ribosome from yeast,  ...
3iz5:r*vfhkka---k--ttkkivlk------lqcqs--c-khysq-hpikrckhfeiggdkkgkgtslf-×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:o ifrkka---k--ttkkivlr------lecvepnc-rskrm-laikrckhfelggdkkrkgqviqf    Structure of the human 60s ribosomal proteins
3j39:o ifrkka---k--ttkkivlr------mecte--c-kyrkq-tplkrckhfelggdkkrkgqmiqf    Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:4 ifrkka---k--ttkkivlr------lecvepnc-rskrm-laikrckhfel-------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3zf7:t ifhkka---k--ttkkivlk------lqcsn--c-ksiiq-nvlkrtkhfelndkkktgnkdptw    High-resolution cryo-electron microscopy structure of the  ...
4a18:C*ifrkka---k--ttkkvalk------fdctt--c-ktkrv-ipikrcktivfmditqikkakvnk×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:j*kpegre---k--pvkkldlr------frcte--cgkahtr-grgfrvkkfelveg----------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1ffk:Z*-fskvpggdk--ptkktdlk------yrcge--c-gkahl-regwragrlefqe-----------×68 Crystal structure of the large ribosomal subunit from  ...
3kjr:A dlsrsf---pllttkkvalrsiieellwfik--g-stngndllaknvriwelngrrdfldkngft    Crystal structure of dihydrofolate reductase/thymidylate  ...
3k2h:A dlsrsf---pllttkkvalrsiieellwfik--g-stngndllaknvriwelngrrdfldkngft    Co-crystal structure of dihydrofolate reductase/thymidylate  ...
3nrr:A dlsrsf---pllttkkvalrsiieellwfik--g-stngndllaknvriwelngrrdfldkngft    Co-crystal structure of dihydrofolate reductase-thymidylate  ...
3ve2:A eysnkn---e--stlkddhe------gygft--s-nlevd-fgnkkltgklirnnasldkhttqy    The 2.1 angstrom crystal structure of transferrin binding  ...
3j38:e nans-------------------------------------------------------------    Structure of the d. Melanogaster 40s ribosomal proteins
1yvo:A aliera---r--aqglhvm-------vaaie--s-gnaas-iglhrrlgfeisgqmpqvgqkfgr    Hypothetical acetyltransferase from p.Aeruginosa pa01
2bl1:A aliera---r--aqglhvm-------vaaie--s-gnaas-iglhrrlgfeisgqmpqvgqkfgr    Crystal structure of a putative phosphinothricin  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P0CX27 -----------------------------------------------------------------    60S ribosomal protein L42-A OS=Saccharomyces cerevisiae  ...
3izc:r*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:F*-----------------------------------------------------------------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3jyw:Z -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:1*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3iz5:r*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:o -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:o -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:4 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3zf7:t -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
4a18:C*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3kjr:A dreehdlgpiygfqwrhfgaeyldmhadytgkgidqlaeiinriktnpndrrlivcswnvsdlkk    Crystal structure of dihydrofolate reductase/thymidylate  ...
3k2h:A dreehdlgpiygfqwrhfgaeyldmhadytgkgidqlaeiinriktnpndrrlivcswnvsdlkk    Co-crystal structure of dihydrofolate reductase/thymidylate  ...
3nrr:A dreehdlgpiygfqwrhfgaeyldmhadytgkgidqlaeiinriktnpndrrlivcswnvsdlkk    Co-crystal structure of dihydrofolate reductase-thymidylate  ...
3ve2:A ysldaqitgnrfngtatatdkkenetklhpfvsdssslsggffgpqgeelgfrflsddqkvavvg    The 2.1 angstrom crystal structure of transferrin binding  ...
3j38:e -----------------------------------------------------------------    Structure of the d. Melanogaster 40s ribosomal proteins
1yvo:A wldltfmqlnldptrsap-----------------------------------------------    Hypothetical acetyltransferase from p.Aeruginosa pa01
2bl1:A wldltfmqlnldptrsap-----------------------------------------------    Crystal structure of a putative phosphinothricin  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P0CX27 -----------------------------------------------------------------    60S ribosomal protein L42-A OS=Saccharomyces cerevisiae  ...
3izc:r*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:F*-----------------------------------------------------------------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3jyw:Z -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:1*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3iz5:r*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:o -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:o -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:4 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3zf7:t -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
4a18:C*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3kjr:A malppchcffqfyvsdnklscmmhqrscdlglgvpfniasysiltamvaqvcglglgefvhnlad    Crystal structure of dihydrofolate reductase/thymidylate  ...
3k2h:A malppchcffqfyvsdnklscmmhqrscdlglgvpfniasysiltamvaqvcglglgefvhnlad    Co-crystal structure of dihydrofolate reductase/thymidylate  ...
3nrr:A malppchcffqfyvsdnklscmmhqrscdlglgvpfniasysiltamvaqvcglglgefvhnlad    Co-crystal structure of dihydrofolate reductase-thymidylate  ...
3ve2:A saktkdkklttvldaveltlndkkiknldnfsnaaqlvvdgimipllpkeftrkfehtpetktye    The 2.1 angstrom crystal structure of transferrin binding  ...
3j38:e -----------------------------------------------------------------    Structure of the d. Melanogaster 40s ribosomal proteins
1yvo:A -----------------------------------------------------------------    Hypothetical acetyltransferase from p.Aeruginosa pa01
2bl1:A -----------------------------------------------------------------    Crystal structure of a putative phosphinothricin  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P0CX27 -----------------------------------------------------------------    60S ribosomal protein L42-A OS=Saccharomyces cerevisiae  ...
3izc:r*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:F*-----------------------------------------------------------------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3jyw:Z -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:1*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3iz5:r*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:o -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:o -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:4 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3zf7:t -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
4a18:C*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3kjr:A ahiyvdhvdavttqiariphpfprlrlnpdirniedftiddivvedyvshppipmamsa------    Crystal structure of dihydrofolate reductase/thymidylate  ...
3k2h:A ahiyvdhvdavttqiariphpfprlrlnpdirniedftiddivvedyvshppipmamsa------    Co-crystal structure of dihydrofolate reductase/thymidylate  ...
3nrr:A ahiyvdhvdavttqiariphpfprlrlnpdirniedftiddivvedyvshppipmamsa------    Co-crystal structure of dihydrofolate reductase-thymidylate  ...
3ve2:A vevccsnlnylkygmltrkveqsmflqgertdekeiptdqnvvyrgswyghiangtswsgnasdk    The 2.1 angstrom crystal structure of transferrin binding  ...
3j38:e -----------------------------------------------------------------    Structure of the d. Melanogaster 40s ribosomal proteins
1yvo:A -----------------------------------------------------------------    Hypothetical acetyltransferase from p.Aeruginosa pa01
2bl1:A -----------------------------------------------------------------    Crystal structure of a putative phosphinothricin  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P0CX27 -----------------------------------------------------------------    60S ribosomal protein L42-A OS=Saccharomyces cerevisiae  ...
3izc:r*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:F*-----------------------------------------------------------------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3jyw:Z -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:1*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3iz5:r*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:o -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:o -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:4 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3zf7:t -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
4a18:C*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3kjr:A -----------------------------------------------------------------    Crystal structure of dihydrofolate reductase/thymidylate  ...
3k2h:A -----------------------------------------------------------------    Co-crystal structure of dihydrofolate reductase/thymidylate  ...
3nrr:A -----------------------------------------------------------------    Co-crystal structure of dihydrofolate reductase-thymidylate  ...
3ve2:A eggnraeftvnfadkkitgkltaentftiegmiqgngfegtaktaesgfdldpkayitdakvkgg    The 2.1 angstrom crystal structure of transferrin binding  ...
3j38:e -----------------------------------------------------------------    Structure of the d. Melanogaster 40s ribosomal proteins
1yvo:A -----------------------------------------------------------------    Hypothetical acetyltransferase from p.Aeruginosa pa01
2bl1:A -----------------------------------------------------------------    Crystal structure of a putative phosphinothricin  ...

           5         6         6       
           9         0         1       
       67890123456789012345678901234567                                     Protein name
       ----+---------+---------+-------                                     ------------
P0CX27 --------------------------------                                     60S ribosomal protein L42-A OS=Saccharomyces cerevisiae  ...
3izc:r*--------------------------------                                 ×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*--------------------------------                                 ×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:F*--------------------------------                                 ×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3jyw:Z --------------------------------                                     Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:1*--------------------------------                                 ×2  Structure of the translating 80s ribosome from yeast,  ...
3iz5:r*--------------------------------                                 ×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:o --------------------------------                                     Structure of the human 60s ribosomal proteins
3j39:o --------------------------------                                     Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:4 --------------------------------                                     Structure of a mammalian ribosomal 60s subunit within an  ...
3zf7:t --------------------------------                                     High-resolution cryo-electron microscopy structure of the  ...
4a18:C*--------------------------------                                 ×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:j*--------------------------------                                 ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1ffk:Z*--------------------------------                                 ×68 Crystal structure of the large ribosomal subunit from  ...
3kjr:A --------------------------------                                     Crystal structure of dihydrofolate reductase/thymidylate  ...
3k2h:A --------------------------------                                     Co-crystal structure of dihydrofolate reductase/thymidylate  ...
3nrr:A --------------------------------                                     Co-crystal structure of dihydrofolate reductase-thymidylate  ...
3ve2:A fygpkaeelggwfaypgassatvvfgakrqqp                                     The 2.1 angstrom crystal structure of transferrin binding  ...
3j38:e --------------------------------                                     Structure of the d. Melanogaster 40s ribosomal proteins
1yvo:A --------------------------------                                     Hypothetical acetyltransferase from p.Aeruginosa pa01
2bl1:A --------------------------------                                     Crystal structure of a putative phosphinothricin  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P0CX27. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 106 - - P0CX27 60S ribosomal protein L42-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL42A PE=1 SV=1
2. 718 100.0% 106 106 1024.4 4.4e-50 3izc:r * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
3. " " " " " "  = 3izs:r *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
4. 711 100.0% 105 105 1014.6 1.5e-49 3u5e:o * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
5. " " " " " "  = 3u5i:o *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
6. " " " " " "  = 4b6a:o *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
7. " " " " " "  = 4byn:o *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
8. " " " " " "  = 4byu:o *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
9. 646 100.0% 95 95 923.2 1.9e-44 3j0l:F * Core of mammalian 80s pre-ribosome in complex with trnas fit 9.8a cryo-em map: classic pre state 1
10. " " " " " "  = 3j0o:F *
Core of mammalian 80s pre-ribosome in complex with trnas fit 9a cryo-em map: classic pre state 2
11. " " " " " "  = 3o58:f *
Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
12. " " " " " "  = 3o5h:f *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
13. 624 100.0% 92 92 892.3 1e-42 3jyw:Z Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
14. 619 100.0% 91 91 885.3 2.5e-42 1k5y:1 * Structure of the translating 80s ribosome from yeast, obtained by docking atomic models for RNA and protein components into a 15a cryo-em map. This file 1k5y contains the 60s ribosomal subunit. The file 1k5x contains the 40s ribosomal subunit, the p-site bound tRNA and the mRNA codon.
15. " " " " " "  = 1s1i:Z *
Structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 a cryo-em map. This file, 1s1i, contains 60s subunit. The 40s ribosomal subunit is in file 1s1h.
16. 561 76.9% 104 105 802.6 9.9e-38 3iz5:r * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
17. " " " " " "  = 3izr:r *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
18. " " " " " "  = 3j61:o *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
19. 544 72.9% 107 105 778.6 2.2e-36 3j3b:o Structure of the human 60s ribosomal proteins
20. 521 69.8% 106 104 746.1 1.4e-34 3j39:o Structure of the d. Melanogaster 60s ribosomal proteins
21. 475 73.4% 94 92 681.7 5.4e-31 2zkr:4 Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
22. 446 64.9% 97 105 640.1 1.1e-28 3zf7:t High-resolution cryo-electron microscopy structure of the tr brucei ribosome
23. 410 67.0% 88 103 589.3 7.6e-26 4a18:C * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
24. " " " " " "  = 4a19:C *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
25. " " " " " "  = 4a1b:C *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
26. " " " " " "  = 4a1d:C *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
27. 203 38.9% 90 94 297.2 1.4e-09 3j21:j * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
28. " " " " " "  = 3j44:j *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
29. 121 30.4% 79 92 181.4 0.004 1ffk:Z * Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
30. " " " " " "  = 1jj2:2 *
Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
31. " " " " " "  = 1k73:4 *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
32. " " " " " "  = 1k8a:4 *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1k9m:4 *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
34. " " " " " "  = 1kc8:4 *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
35. " " " " " "  = 1kd1:4 *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
36. " " " " " "  = 1kqs:2 *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
37. " " " " " "  = 1m1k:4 *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
38. " " " " " "  = 1m90:4 *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
39. " " " " " "  = 1n8r:4 *
Structure of large ribosomal subunit in complex with virginiamycin m
40. " " " " " "  = 1nji:4 *
Structure of chloramphenicol bound to the 50s ribosomal subunit
41. " " " " " "  = 1q7y:4 *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
42. " " " " " "  = 1q81:4 *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
43. " " " " " "  = 1q82:4 *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
44. " " " " " "  = 1q86:4 *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
45. " " " " " "  = 1qvf:2 *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
46. " " " " " "  = 1qvg:2 *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
47. " " " " " "  = 1s72:3 *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
48. " " " " " "  = 1vq4:3 *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
49. " " " " " "  = 1vq5:3 *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
50. " " " " " "  = 1vq6:3 *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
51. " " " " " "  = 1vq7:3 *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
52. " " " " " "  = 1vq8:3 *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
53. " " " " " "  = 1vq9:3 *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
54. " " " " " "  = 1vqk:3 *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
55. " " " " " "  = 1vql:3 *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
56. " " " " " "  = 1vqm:3 *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
57. " " " " " "  = 1vqn:3 *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
58. " " " " " "  = 1vqo:3 *
The structure of ccpmn bound to the large ribosomal subunit marismortui
59. " " " " " "  = 1vqp:3 *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
60. " " " " " "  = 1w2b:2 *
Trigger factor ribosome binding domain in complex with 50s
61. " " " " " "  = 1yhq:3 *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
62. " " " " " "  = 1yi2:3 *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
63. " " " " " "  = 1yij:3 *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
64. " " " " " "  = 1yit:3 *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
65. " " " " " "  = 1yj9:3 *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
66. " " " " " "  = 1yjn:3 *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
67. " " " " " "  = 1yjw:3 *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
68. " " " " " "  = 2otj:3 *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
69. " " " " " "  = 2otl:3 *
Girodazole bound to the large subunit of haloarcula marismor
70. " " " " " "  = 2qa4:3 *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
71. " " " " " "  = 2qex:3 *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
72. " " " " " "  = 3cc2:3 *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
73. " " " " " "  = 3cc4:3 *
Co-crystal structure of anisomycin bound to the 50s ribosoma
74. " " " " " "  = 3cc7:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
75. " " " " " "  = 3cce:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
76. " " " " " "  = 3ccj:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
77. " " " " " "  = 3ccl:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
78. " " " " " "  = 3ccm:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
79. " " " " " "  = 3ccq:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
80. " " " " " "  = 3ccr:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
81. " " " " " "  = 3ccs:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
82. " " " " " "  = 3ccu:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
83. " " " " " "  = 3ccv:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
84. " " " " " "  = 3cd6:3 *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
85. " " " " " "  = 3cma:3 *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
86. " " " " " "  = 3cme:3 *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
87. " " " " " "  = 3cpw:2 *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
88. " " " " " "  = 3cxc:2 *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
89. " " " " " "  = 3g4s:3 *
Co-crystal structure of tiamulin bound to the large ribosoma
90. " " " " " "  = 3g6e:3 *
Co-crystal structure of homoharringtonine bound to the large subunit
91. " " " " " "  = 3g71:3 *
Co-crystal structure of bruceantin bound to the large riboso subunit
92. " " " " " "  = 3i55:3 *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
93. " " " " " "  = 3i56:3 *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
94. " " " " " "  = 3ow2:2 *
Crystal structure of enhanced macrolide bound to 50s ribosom
95. " " " " " "  = 4adx:3 *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
96. " " " " " "  = 4hub:3 *
The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
97. 88 28.4% 109 498 119.2 12 3kjr:A Crystal structure of dihydrofolate reductase/thymidylate syn babesia bovis determined using slipchip based microfluidics
98. 88 28.4% 109 503 119.1 12 3k2h:A Co-crystal structure of dihydrofolate reductase/thymidylate from babesia bovis with dump, pemetrexed and NADP
99. 88 28.4% 109 503 119.1 12 3nrr:A Co-crystal structure of dihydrofolate reductase-thymidylate from babesia bovis with dump, raltitrexed and NADP
100. 83 30.2% 63 514 119.0 12 3ve2:A The 2.1 angstrom crystal structure of transferrin binding pr (tbpb) from serogroup b m982 neisseria meningitidis
101. 71 32.7% 49 58 113.1 25 3j38:e Structure of the d. Melanogaster 40s ribosomal proteins
102. 73 26.2% 61 169 110.5 35 1yvo:A Hypothetical acetyltransferase from p.Aeruginosa pa01
103. 73 26.2% 61 170 110.5 35 2bl1:A Crystal structure of a putative phosphinothricin acetyltransferase (pa4866) from pseudomonas aeruginosa pac1

Number of sequences: 103

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 73 26.2% 61 169 110.5 35 2j8n:A Structure of p. Aeruginosa acetyltransferase pa4866 solved at room temperature
2. 73 26.2% 61 170 110.5 35 2j8r:A Structure of p. Aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine
3. 73 26.2% 61 171 110.4 36 2j8m:A Structure of p. Aeruginosa acetyltransferase pa4866
4. 72 28.1% 64 144 109.9 38 3zf7:b High-resolution cryo-electron microscopy structure of the tr brucei ribosome
5. 76 26.7% 75 452 109.8 39 3n5m:A Crystals structure of a bacillus anthracis aminotransferase
6. 71 26.0% 73 112 109.7 39 3mkz:A Structure of sopb(155-272)-18mer complex, p21 form
7. 71 26.0% 73 115 109.6 40 3mkw:B * Structure of sopb(155-272)-18mer complex, i23 form
8. " " " " " "  = 3mky:B *
Structure of sopb(155-323)-18mer DNA complex, i23 form

Number of sequences: 8

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer