spacer
spacer

SAS results for UniProt accession no. P49167

Sequence annotated by structure
>

Key:
Sec. struc: By homology
  Helix Strand  

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

 

FASTA alignment for UniProt accession no. P49167 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P49167 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 34 unique sequences (including 8 consensus sequences) giving 48 sequence matches in all. The 17 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P49167 -----------------------------------------------------------------   60S ribosomal protein L38 OS=Saccharomyces cerevisiae  ...
3izc:n*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:k*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:k -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:k -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:n*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
3zf7:p -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
4a18:P*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3bbo:Q -----------------------------------------------------------------   Homology model for the spinach chloroplast 50s subunit  ...
2kpo:A*-----------------------------------------------------------------×2 Solution nmr structure of de novo designed rossmann 2x2  ...
3j39:d -----------------------------------------------------inevvtrectih   Structure of the d. Melanogaster 60s ribosomal proteins
3frw:A -----------------------------------irteevdhlfeailclknkeecytffedvc   Crystal structure of putative trpr protein from ruminococcus
2kj8:A ------------------------------------ssnnnsfsaiykewyehkkqvwsvgyate   Nmr structure of fragment 87-196 from the putative phage  ...
4a0n:A ------qpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkelegwep   Crystal structure of survivin bound to the phosphorylated  ...
1e31:A tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkelegwep   Survivin dimer h. Sapiens
1f3h:A tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdmaqcffcfkelegwep   X-ray crystal structure of the human anti-apoptotic protein  ...
3uef:A tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkelegwep   Crystal structure of human survivin bound to histone h3 (c2  ...
3uig:A tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkelegwep   Crystal structure of human survivin in complex with t3  ...
3uih:A tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkelegwep   Crystal structure of human survivin in complex with  ...
3uii:A tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfkelegwep   Crystal structure of human survivin in complex with h3(1-10)
3uij:A tlppawqpflkdhristfknwpflegcactpermaeagfihcptenepdlaqcffcfyelegwep   Crystal structure of human survivin k62y/h80w mutant in  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P49167 -------------mareitdik--qfleltr----r----advktatv-kinkklnka--gkpfr   60S ribosomal protein L38 OS=Saccharomyces cerevisiae  ...
3izc:n*-------------mareitdik--qfleltr----r----advktatv-kinkklnka--gkpfr×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:k*--------------areitdik--qfleltr----r----advktatv-kinkklnka--gkpfr×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:k --------------prkieeik--dflltar----r----kdaksvki-kknkd-----------   Structure of the human 60s ribosomal proteins
3j39:k -------------mpreikevk--dflnkar----r----sdaravki-kkn----------p-t   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:n*-------------mpkqiheik--dflltar----r----kdarsvri-krtkd-----------×3 Localization of the large subunit ribosomal proteins into a  ...
3zf7:p --------------preiknlk--eflaics----r----kdarcvkv-khnpkv----------   High-resolution cryo-electron microscopy structure of the  ...
4a18:P*--------------pkeitdik--kfmklwq----------nkkvvyv-ktnkri----------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3bbo:Q --------------------------kaktr----r----edrtarhv-rirkkve----gtper   Homology model for the spinach chloroplast 50s subunit  ...
2kpo:A*----------mllyvliisndk--klieear----kmaekanlelrtv-ktedelkky--leefr×2 Solution nmr structure of de novo designed rossmann 2x2  ...
3j39:d lakrvhnigfkkrapraikeir--kfae------------remgttdv-ridtrlnkhiwskgir   Structure of the d. Melanogaster 60s ribosomal proteins
3frw:A tinellslsqrfevakmltdkr--tyldise----k----tgastatisrvnrslnyg--ndgye   Crystal structure of putative trpr protein from ruminococcus
2kj8:A lakmfdddilpiiggleiqdiepmqllevir----r----fedrgame-rankarrrc--gevfr   Nmr structure of fragment 87-196 from the putative phage  ...
4a0n:A dddpieehkkhssgcaflsvkk--qfeeltlgeflk----ldrerakn-kiaketnnk--kkefe   Crystal structure of survivin bound to the phosphorylated  ...
1e31:A dddpieehkkhssgcaflsvkk--qfeeltlgeflk----ldrerakn-kiaketnnk--kkefe   Survivin dimer h. Sapiens
1f3h:A dddpieehkkhssgcaflsvkk--qfeeltlgeflk----ldrerakn-kiaketnnk--kkefe   X-ray crystal structure of the human anti-apoptotic protein  ...
3uef:A dddpieehkkhssgcaflsvkk--qfeeltlgeflk----ldrerakn-kiaketnnk--kkefe   Crystal structure of human survivin bound to histone h3 (c2  ...
3uig:A dddpieehkkhssgcaflsvkk--qfeeltlgeflk----ldrerakn-kiaketnnk--kkefe   Crystal structure of human survivin in complex with t3  ...
3uih:A dddpieehkkhssgcaflsvkk--qfeeltlgeflk----ldrerakn-kiaketnnk--kkefe   Crystal structure of human survivin in complex with  ...
3uii:A dddpieehkkhssgcaflsvkk--qfeeltlgeflk----ldrerakn-kiaketnnk--kkefe   Crystal structure of human survivin in complex with h3(1-10)
3uij:A dddpieehkkwssgcaflsvkk--qfeeltlgeflk----ldrerakn-kiaketnnk--kkefe   Crystal structure of human survivin k62y/h80w mutant in  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P49167 qtkfkvrgssslytlvinda--gkakkliqslpptlkvnrl------------------------   60S ribosomal protein L38 OS=Saccharomyces cerevisiae  ...
3izc:n*qtkfkvrgssslytlvinda--gkakkliqslpptlkvnrl------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:k*qtkfkvrgssslytlvinda--gkakkliqslpptlkvnrl------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:k nvkfkvrcsrylytlvitdk--ekaeklkqslppglavkelk-----------------------   Structure of the human 60s ribosomal proteins
3j39:k ntkfkircsrflytlvvqdk--ekadkikqslppglqvkevk-----------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:n*avkfkvrcskylytlcvfda--dkanklkqslppgltvqev------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
3zf7:p -tkfkvrcsrhlytlvmadk--kkadkiersihpsvkkitvtsrshankntpsk-----------   High-resolution cryo-electron microscopy structure of the  ...
4a18:P*-tkfklrgkkylytfktadp--kiakgikdaipatyskiei------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3bbo:Q prlcvfrsnkhlyvqvidds--kmhtlasastmqksiseeldysssptievakkvgeviasacle   Homology model for the spinach chloroplast 50s subunit  ...
2kpo:A*kesqnik----vlilvsndeeldkakelaqkmeidvrtrkvtspdeakrwikefseeggslehhh×2 Solution nmr structure of de novo designed rossmann 2x2  ...
3j39:d stpfrirvrlarrrnddeds--pnklytyvtyvpvstfknlqtenvessdd--------------   Structure of the d. Melanogaster 60s ribosomal proteins
3frw:A mvfsrmkeket------------------------------------------------------   Crystal structure of putative trpr protein from ruminococcus
2kj8:A yaivtgrakynpapdladam--kgyrkknlehhhhhh----------------------------   Nmr structure of fragment 87-196 from the putative phage  ...
4a0n:A etakkvrraieqlaam-------------------------------------------------   Crystal structure of survivin bound to the phosphorylated  ...
1e31:A etakkvrraieqlaa--------------------------------------------------   Survivin dimer h. Sapiens
1f3h:A etakkvrraieqlaa--------------------------------------------------   X-ray crystal structure of the human anti-apoptotic protein  ...
3uef:A etakkvrraieqlaa--------------------------------------------------   Crystal structure of human survivin bound to histone h3 (c2  ...
3uig:A etakkvrraieqla---------------------------------------------------   Crystal structure of human survivin in complex with t3  ...
3uih:A etakkvrraieqlaa--------------------------------------------------   Crystal structure of human survivin in complex with  ...
3uii:A etakkvrraieqla---------------------------------------------------   Crystal structure of human survivin in complex with h3(1-10)
3uij:A etakkvrraieqlaa--------------------------------------------------   Crystal structure of human survivin k62y/h80w mutant in  ...

           2         2         2        
           0         1         2        
       678901234567890123456789012345678                                   Protein name
       ----+---------+---------+--------                                   ------------
P49167 ---------------------------------                                   60S ribosomal protein L38 OS=Saccharomyces cerevisiae  ...
3izc:n*---------------------------------                                ×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:k*---------------------------------                                ×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:k ---------------------------------                                   Structure of the human 60s ribosomal proteins
3j39:k ---------------------------------                                   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:n*---------------------------------                                ×3 Localization of the large subunit ribosomal proteins into a  ...
3zf7:p ---------------------------------                                   High-resolution cryo-electron microscopy structure of the  ...
4a18:P*---------------------------------                                ×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3bbo:Q kgitkvafdrggypyhgrvkaladaarekglqf                                   Homology model for the spinach chloroplast 50s subunit  ...
2kpo:A*hhh------------------------------                                ×2 Solution nmr structure of de novo designed rossmann 2x2  ...
3j39:d ---------------------------------                                   Structure of the d. Melanogaster 60s ribosomal proteins
3frw:A ---------------------------------                                   Crystal structure of putative trpr protein from ruminococcus
2kj8:A ---------------------------------                                   Nmr structure of fragment 87-196 from the putative phage  ...
4a0n:A ---------------------------------                                   Crystal structure of survivin bound to the phosphorylated  ...
1e31:A ---------------------------------                                   Survivin dimer h. Sapiens
1f3h:A ---------------------------------                                   X-ray crystal structure of the human anti-apoptotic protein  ...
3uef:A ---------------------------------                                   Crystal structure of human survivin bound to histone h3 (c2  ...
3uig:A ---------------------------------                                   Crystal structure of human survivin in complex with t3  ...
3uih:A ---------------------------------                                   Crystal structure of human survivin in complex with  ...
3uii:A ---------------------------------                                   Crystal structure of human survivin in complex with h3(1-10)
3uij:A ---------------------------------                                   Crystal structure of human survivin k62y/h80w mutant in  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P49167. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 78 - - P49167 60S ribosomal protein L38 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL38 PE=1 SV=1
2. 478 100.0% 78 78 690.3 1.8e-31 3izc:n * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
3. " " " " " "  = 3izs:n *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
4. 471 100.0% 77 77 680.5 6.3e-31 3u5e:k * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
5. " " " " " "  = 3u5i:k *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
6. " " " " " "  = 4b6a:k *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
7. " " " " " "  = 4byn:k *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
8. " " " " " "  = 4byu:k *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
9. 190 50.0% 76 69 212.5 7.4e-05 3j3b:k Structure of the human 60s ribosomal proteins
10. 188 44.9% 78 70 208.1 0.00013 3j39:k Structure of the d. Melanogaster 60s ribosomal proteins
11. 173 43.6% 78 69 198.3 0.00045 3iz5:n * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
12. " " " " " "  = 3izr:n *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
13. " " " " " "  = 3j61:k *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
14. 158 43.1% 72 81 169.0 0.019 3zf7:p High-resolution cryo-electron microscopy structure of the tr brucei ribosome
15. 124 38.6% 70 66 141.9 0.63 4a18:P * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
16. " " " " " "  = 4a19:P *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
17. " " " " " "  = 4a1b:P *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
18. " " " " " "  = 4a1d:P *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
19. 78 37.8% 45 122 121.2 8.9 3bbo:Q Homology model for the spinach chloroplast 50s subunit fitte cryo-em map of the 70s chlororibosome
20. 77 26.2% 80 110 120.4 9.9 2kpo:A * Solution nmr structure of de novo designed rossmann 2x2 fold northeast structural genomics consortium target or16
21. " " " " " "  = 2lv8:A *
Solution nmr structure de novo designed rossmann 2x2 fold pr northeast structural genomics consortium (nesg) target or16
22. 75 34.8% 46 111 117.5 14 3j39:d Structure of the d. Melanogaster 60s ribosomal proteins
23. 74 30.3% 33 94 117.1 15 3frw:A Crystal structure of putative trpr protein from ruminococcus
24. 73 39.5% 38 118 114.3 22 2kj8:A Nmr structure of fragment 87-196 from the putative phage integrase ints of e. Coli: northeast structural genomics consortium target er652a, psi-2
25. 73 42.9% 42 131 113.7 23 4a0n:A Crystal structure of survivin bound to the phosphorylated n- terminal tail of histone h3
26. 73 42.9% 42 136 113.5 24 1e31:A Survivin dimer h. Sapiens
27. 73 42.9% 42 136 113.5 24 1f3h:A X-ray crystal structure of the human anti-apoptotic protein survivin
28. 73 42.9% 42 136 113.5 24 3uef:A Crystal structure of human survivin bound to histone h3 (c2 group).
29. 73 42.9% 42 135 113.5 24 3uig:A Crystal structure of human survivin in complex with t3 phosp h3(1-15) peptide
30. 73 42.9% 42 136 113.5 24 3uih:A Crystal structure of human survivin in complex with smac/dia peptide
31. 73 42.9% 42 135 113.5 24 3uii:A Crystal structure of human survivin in complex with h3(1-10)
32. 73 42.9% 42 136 113.5 24 3uij:A Crystal structure of human survivin k62y/h80w mutant in comp smac/diablo(1-15) peptide

Number of sequences: 32

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 73 42.9% 42 135 113.5 24 3uik:A Crystal structure of human survivin mutant k62y/h80w in comp h3(1-10) peptide
2. 73 42.9% 42 136 113.5 24 4a0i:A * Crystal structure of survivin bound to the n-terminal tail of hsgo1
3. " " " " " "  = 4a0j:A *
Crystal structure of survivin bound to the phosphorylated n- terminal tail of histone h3
4. 73 42.9% 42 137 113.4 24 2qfa:A * Crystal structure of a survivin-borealin-incenp core complex
5. " " " " " "  = 2raw:A *
Crystal structure of the borealin-survivin complex
6. 73 42.9% 42 138 113.4 24 3uec:A Crystal structure of human survivin bound to histone h3 phos on threonine-3.
7. 73 42.9% 42 137 113.4 24 3ued:A Crystal structure of human survivin bound to histone h3 phos on threonine-3 (c2 space group).
8. 73 42.9% 42 137 113.4 24 3uee:A * Crystal structure of human survivin k62a mutant bound to n-t histone h3
9. " " " " " "  = 3ueg:A *
Crystal structure of human survivin k62a mutant
10. 73 42.9% 42 137 113.4 24 3ueh:A Crystal structure of human survivin h80a mutant
11. 73 42.9% 42 137 113.4 24 3uei:A Crystal structure of human survivin e65a mutant
12. 71 32.7% 55 94 112.9 26 1x4m:A Solution structure of kh domain in far upstream element binding protein 1
13. 75 29.8% 57 248 112.6 27 3ftp:A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reduc burkholderia pseudomallei at 2.05 a resolution
14. 76 25.7% 70 320 112.5 27 3u5z:B Structure of t4 bacteriophage clamp loader bound to the t4 c primer-template DNA, and atp analog
15. 76 25.7% 70 319 112.5 27 3u60:B Structure of t4 bacteriophage clamp loader bound to open cla and atp analog
16. 74 28.6% 42 282 110.4 36 1nzt:A Solution structure of the lpxc deacetylase of lipid a biosynthesis from aquifex aeolicus with a bound substrate- analog inhibitor, tu-514
17. 74 31.6% 79 319 109.7 39 3clu:D Crystal structure of the r236k mutant from methylophilus methylotrophus etf

Number of sequences: 17

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer