spacer
spacer

SAS results for UniProt accession no. P05745

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P05745 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P05745 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 12 unique sequences (including 4 consensus sequences) giving 22 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05745 -----------------------------------------------------------------   60S ribosomal protein L36-A OS=Saccharomyces cerevisiae  ...
3u5e:i*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:k*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:i -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3iz5:k*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:Q*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j39:i -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:m -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
2r77:A yfqgiptiselkkdriiphvfpndkidlnvdlfisfkagkevnhgnvldiagtgsvprnikfsee   Crystal structure of phosphatidylethanolamine-binding  ...
4ni9:C -----------------------------------------------------------------   Crystal structure of human interleukin 6 in complex with a  ...
1zns:A -----------------------------------------------------------------   Crystal structure of n-cole7/12-bp DNA/zn complex
2qjw:A -----------------------------------------------------------------   Crystal structure of a putative hydrolase of the alpha/beta  ...
4ni9:A -----------------------------------------------------------------   Crystal structure of human interleukin 6 in complex with a  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P05745 ----------------------------mtvktgiaig-lnkgkkvtsm-----tp---a-pki-   60S ribosomal protein L36-A OS=Saccharomyces cerevisiae  ...
3u5e:i*-----------------------------tvktgiaig-lnkgkkvtsm-----tp---a-pki-×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:k*-------------------------------------------------------------pki-×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:i ----------------------------malrypmavg-lnkghkvtkn-----vs---k-prh-   Structure of the human 60s ribosomal proteins
3iz5:k*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:Q*-------------------------------akgqavg-inkgfittql-----ek---klqkh-×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j39:i ----------------------------mavryelaig-lnkghktskirnvkytg---d-kkv-   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:m ---------------------aatkreapvprtgiiag-fnkgykttrr-----ar---r-pss-   High-resolution cryo-electron microscopy structure of the  ...
2r77:A ppdgycfvlfmvdpdypsrlrpdgkeyihwvvsgiktkelikgtqkncv-----ti---l-pyvg   Crystal structure of phosphatidylethanolamine-binding  ...
4ni9:C ------------------rqpltsseridkqiryildg-isalrketnn-----ln---l-pkm-   Crystal structure of human interleukin 6 in complex with a  ...
1zns:A ----------------------pgkatgkgkpvnnkwl-nnagkdlgsp-----vpdria-nkl-   Crystal structure of n-cole7/12-bp DNA/zn complex
2qjw:A --------------------------gmsrghcilahg-fesgpdalkv-----ta---l-aev-   Crystal structure of a putative hydrolase of the alpha/beta  ...
4ni9:A ----------------phrqpltsseridkqiryildg-isalrketnl-----n----l-pkm-   Crystal structure of human interleukin 6 in complex with a  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05745 -s--yk--kga-----asnrtkfv----rslvre-----iaglspyerrlidlir--n---sgek   60S ribosomal protein L36-A OS=Saccharomyces cerevisiae  ...
3u5e:i*-s--yk--kga-----asnrtkfv----rslvre-----iaglspyerrlidlir--n---sgek×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:k*-s--yk--kga-----asnrtkfv----rslvre-----iaglspyerrlidlir--n---sgek×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:i -s--rr--rgr-----ltkhtkfv----rdmire-----vcgfapyerramellk--v---skdk   Structure of the human 60s ribosomal proteins
3iz5:k*----------------gtkrvhfv----rnlire-----vagfapyekritellk--v---gkdk×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:Q*-savqr--kgk-----lgkrvalv----rqvire-----vtgfapyekriielik--a---gsak×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j39:i -k--gl--rgsrlkniqtrhtkfm----rdlvre-----vvghapyekrtmellk--v---skdk   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:m -n--dr--yal-----phkklrav----kaiisd-----lvgfspmerrvqellr--v---gkdk   High-resolution cryo-electron microscopy structure of the  ...
2r77:A ps--ik--kgt-----glhrisfi----islikeedkdnitglphygekyitrvk--f---nnye   Crystal structure of phosphatidylethanolamine-binding  ...
4ni9:C -a--ek--dgc-----fqsgfnee----tclvki-----itgllefevyl-eylq--nrfessee   Crystal structure of human interleukin 6 in complex with a  ...
1zns:A -r--dkefksf-----ddfrkkfw----eevskd-----pelskqfsrnnndrmkvgk---apkt   Crystal structure of n-cole7/12-bp DNA/zn complex
2qjw:A -a--er--lgw-----therpdftdldarrdlgq-----lgdvrgrlqrlleiar--a---atek   Crystal structure of a putative hydrolase of the alpha/beta  ...
4ni9:A -a--ek--dgc-----fqsgfnee----tclvki-----itgllefevyl-eylq--nrfessee   Crystal structure of human interleukin 6 in complex with a  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P05745 ---rarkv--akkrlgsftrak---akveemnni-iaasrrh-----------------------   60S ribosomal protein L36-A OS=Saccharomyces cerevisiae  ...
3u5e:i*---rarkv--akkrlgsftrak---akveemnni-iaasrrh-----------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:k*---rarkv--akkrlgsftrak---akveemnni-iaasrrh-----------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:i ---ralkf--ikkrvgthirak---rkreelsnv-laamrkaaak--------------------   Structure of the human 60s ribosomal proteins
3iz5:k*---ralkv--akrklgthkrak---kkreemssv-lrkmrsagggagdkkk--------------×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:Q*dskkatki--arkrlgthrrak---vkkalleea-vraqrk------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j39:i ---ralkf--lkrrlgthirak---rkreelsni-ltqlrkaqth--------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:m ---ralkf--ckkrlgsikaakkrrakveealrq-qtkk--------------------------   High-resolution cryo-electron microscopy structure of the  ...
2r77:A ---svhni--aqinnmkivgyn---wcqie-----------------------------------   Crystal structure of phosphatidylethanolamine-binding  ...
4ni9:C ---qaravqmstkvliqflqkk---aittpdptt-naslltklqaqnqwlqdmtthlilrsfkef   Crystal structure of human interleukin 6 in complex with a  ...
1zns:A ---rtqdv--sgkrt-sfelhe---ekvydmdnisvvtpkrhidihr------------------   Crystal structure of n-cole7/12-bp DNA/zn complex
2qjw:A ---gpvvl--agsslgsyiaaq---vslqvptra-lflmvpptkmgplpaldaaavpisivhawh   Crystal structure of a putative hydrolase of the alpha/beta  ...
4ni9:A ---qaravqmstkvliqflqkk---apttnasll-tklqaqnqwlqdmtthlilrsfkeflqssl   Crystal structure of human interleukin 6 in complex with a  ...

                2         2         2         3       
                7         8         9         0       
       12345678901234567890123456789012345678901234567                     Protein name
       ---------+---------+---------+---------+-------                     ------------
P05745 -----------------------------------------------                     60S ribosomal protein L36-A OS=Saccharomyces cerevisiae  ...
3u5e:i*-----------------------------------------------                  ×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:k*-----------------------------------------------                  ×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:i -----------------------------------------------                     Structure of the human 60s ribosomal proteins
3iz5:k*-----------------------------------------------                  ×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:Q*-----------------------------------------------                  ×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j39:i -----------------------------------------------                     Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:m -----------------------------------------------                     High-resolution cryo-electron microscopy structure of the  ...
2r77:A -----------------------------------------------                     Crystal structure of phosphatidylethanolamine-binding  ...
4ni9:C lqsslralrqm------------------------------------                     Crystal structure of human interleukin 6 in complex with a  ...
1zns:A -----------------------------------------------                     Crystal structure of n-cole7/12-bp DNA/zn complex
2qjw:A delipaadviawaqarsarlllvddghrlgahvqaasrafaellqsl                     Crystal structure of a putative hydrolase of the alpha/beta  ...
4ni9:A ralrqm-----------------------------------------                     Crystal structure of human interleukin 6 in complex with a  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P05745. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 100 - - P05745 60S ribosomal protein L36-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL36A PE=1 SV=3
2. 608 100.0% 99 99 793.6 3.2e-37 3u5e:i * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
3. " " " " " "  = 3u5i:i *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
4. " " " " " "  = 4b6a:i *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
5. " " " " " "  = 4byn:i *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
6. " " " " " "  = 4byu:i *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
7. 476 100.0% 77 77 625.6 7.2e-28 3izc:k * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
8. " " " " " "  = 3izs:k *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
9. 318 46.5% 99 103 421.4 1.7e-16 3j3b:i Structure of the human 60s ribosomal proteins
10. 220 47.7% 65 77 297.2 1.4e-09 3iz5:k * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
11. " " " " " "  = 3izr:k *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
12. " " " " " "  = 3j61:i *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
13. 218 38.0% 100 102 293.2 2.4e-09 4a18:Q * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
14. " " " " " "  = 4a19:Q *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
15. " " " " " "  = 4a1b:Q *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
16. " " " " " "  = 4a1d:Q *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
17. 253 41.3% 109 113 291.3 3e-09 3j39:i Structure of the d. Melanogaster 60s ribosomal proteins
18. 203 40.4% 89 107 273.7 2.9e-08 3zf7:m High-resolution cryo-electron microscopy structure of the tr brucei ribosome
19. 88 28.8% 80 190 123.1 7 2r77:A Crystal structure of phosphatidylethanolamine-binding protei pfl0955c, from plasmodium falciparum
20. 79 30.9% 81 148 112.9 26 4ni9:C Crystal structure of human interleukin 6 in complex with a m nucleotide aptamer (somamer sl1025), form 2
21. 76 27.8% 97 118 110.2 36 1zns:A Crystal structure of n-cole7/12-bp DNA/zn complex
22. 76 20.9% 86 176 108.1 48 2qjw:A Crystal structure of a putative hydrolase of the alpha/beta superfamily (xcc1541) from xanthomonas campestris pv. Campe 1.35 a resolution
23. 75 30.9% 81 144 107.9 49 4ni9:A Crystal structure of human interleukin 6 in complex with a m nucleotide aptamer (somamer sl1025), form 2

Number of sequences: 23

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer