spacer
spacer

SAS results for UniProt accession no. P05747

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P05747 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P05747 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 11 unique sequences (including 3 consensus sequences) giving 19 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05747 -----------------------------------------------------------------   60S ribosomal protein L29 OS=Saccharomyces cerevisiae  ...
3u5e:b*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:b -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j61:b -----------------------------------------------------------------   Localization of the large subunit ribosomal proteins into a  ...
4a18:T*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j39:b -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:d*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3zf7:d -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
1xvh:A -----------------------------------------------------------------   Crystal structure of the staphylococcus aureus protein  ...
4kjm:A -----------------------------------------------------------------   Crystal structure of the staphylococcus aureus protein  ...
2gli:A etdcrwdgcsqefdsqeqlvhhinsehihgerkefvchwggcsrelrpfkaqymlvvhmrrhtge   Five-finger gli/DNA complex
3zey:T ------------------------------kaevtvrtsqfkvnkllnrkqfvvevnhpgwcgtv   High-resolution cryo-electron microscopy structure of the  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P05747 ------------------------------------------maksknhtahnqtrkahrngikk   60S ribosomal protein L29 OS=Saccharomyces cerevisiae  ...
3u5e:b*-------------------------------------------aksknhtahnqtrkahrngikk×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:b -------------------------------------------aksknhtthnqsrkwhrngikk   Structure of the human 60s ribosomal proteins
3j61:b -------------------------------------------aksknhtahnqsykahkngikk   Localization of the large subunit ribosomal proteins into a  ...
4a18:T*-------------------------------------------aksknstnknqiskshrngikk×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j39:b -------------------------------------------aksknhtnhnqnkkahrngikr   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:d*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3zf7:d -------------------------------------------aksknhtnhnqsrknhrngikp   High-resolution cryo-electron microscopy structure of the  ...
1xvh:A --------------------tmgnlqtaindksgtlasqnfldadeqkrnaynqavsaaetilnt   Crystal structure of the staphylococcus aureus protein  ...
4kjm:A ------------------tstmgnlqtaindksgtlasqnfldadeqkrnaynqavsaaetilnt   Crystal structure of the staphylococcus aureus protein  ...
2gli:A kphkctfegcrksysrlenlkthlrshtgekpymcehegcskafsnasdrakhqnr-thsn--ek   Five-finger gli/DNA complex
3zey:T paklirnrlaslykvadenqisvfgfktkfgggkttgfgliyddlaamkriepnyrka-rlgmgk   High-resolution cryo-electron microscopy structure of the  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05747 p-ktykyp--slkg------vdpkfrr--nhkhalhgtakalaaakk------------------   60S ribosomal protein L29 OS=Saccharomyces cerevisiae  ...
3u5e:b*p-ktykyp--slkg------vdpkfrr--nhkhalhgtakalaaakk------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:b p-rsqrye--slkg------vdpkflr--nmrfakkhnkkglkkmqannakamsaraeaikalvk   Structure of the human 60s ribosomal proteins
3j61:b p-krhrqt--stkg------mdpkflr--nqrysrkhnkksgeaese------------------   Localization of the large subunit ribosomal proteins into a  ...
4a18:T*p-kdhrhi--stkg------vnprflr--nrrraikndpsikksknlekkvnke-----------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j39:b p-lrkrhe--stlg------mdvkfli--nqryarkgnlsreesvkryneriasqkgkpkpvtl-   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:d*-----------------------kfrr--nhkhalhgtakalaaakk------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3zf7:d plplymyn--skrggwlpalvntrrvrknnqkaalkarrerlaahqaaqk---------------   High-resolution cryo-electron microscopy structure of the  ...
1xvh:A a-ktaveq--alnn------vn-------nakhalngt-qnlnnakqaaitaingasdlnqkqkd   Crystal structure of the staphylococcus aureus protein  ...
4kjm:A a-ktaveq--alnn------vn-------nakhalngt-qnlnnakqaaitaingasdlnqkqkd   Crystal structure of the staphylococcus aureus protein  ...
2gli:A p-yvcklpgctkry------tdpsslr--khvktvhg----------------------------   Five-finger gli/DNA complex
3zey:T k-kl---p--arks------v--kerr--nrnkkirgkakgkmqtkkk-----------------   High-resolution cryo-electron microscopy structure of the  ...

           2         2         2  
           0         1         2  
       678901234567890123456789012                                         Protein name
       ----+---------+---------+--                                         ------------
P05747 ---------------------------                                         60S ribosomal protein L29 OS=Saccharomyces cerevisiae  ...
3u5e:b*---------------------------                                      ×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:b pk-------------------------                                         Structure of the human 60s ribosomal proteins
3j61:b ---------------------------                                         Localization of the large subunit ribosomal proteins into a  ...
4a18:T*---------------------------                                      ×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j39:b ---------------------------                                         Structure of the d. Melanogaster 60s ribosomal proteins
3izc:d*---------------------------                                      ×2 Localization of the large subunit ribosomal proteins into a  ...
3zf7:d ---------------------------                                         High-resolution cryo-electron microscopy structure of the  ...
1xvh:A alkaqangaqrvsnaqdvqhnatelnt                                         Crystal structure of the staphylococcus aureus protein  ...
4kjm:A alkaqangaqrvsnaqdvqhnatelnt                                         Crystal structure of the staphylococcus aureus protein  ...
2gli:A ---------------------------                                         Five-finger gli/DNA complex
3zey:T ---------------------------                                         High-resolution cryo-electron microscopy structure of the  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P05747. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 59 - - P05747 60S ribosomal protein L29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL29 PE=1 SV=3
2. 387 100.0% 58 58 589.8 7.1e-26 3u5e:b * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
3. " " " " " "  = 3u5i:b *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
4. " " " " " "  = 4b6a:b *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
5. " " " " " "  = 4byn:b *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
6. " " " " " "  = 4byu:b *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
7. 236 66.0% 53 78 364.1 2.6e-13 3j3b:b Structure of the human 60s ribosomal proteins
8. 218 59.6% 52 58 339.2 6.5e-12 3j61:b Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
9. 186 58.7% 46 65 291.0 3.1e-09 4a18:T * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
10. " " " " " "  = 4a19:T *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
11. " " " " " "  = 4a1b:T *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
12. " " " " " "  = 4a1d:T *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
13. 182 48.3% 58 75 284.2 7.4e-09 3j39:b Structure of the d. Melanogaster 60s ribosomal proteins
14. 142 100.0% 22 22 232.2 5.9e-06 3izc:d * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
15. " " " " " "  = 3izs:d *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
16. 151 50.0% 64 70 228.3 9.7e-06 3zf7:d High-resolution cryo-electron microscopy structure of the tr brucei ribosome
17. 68 32.8% 58 120 112.4 28 1xvh:A Crystal structure of the staphylococcus aureus protein (np_6 domain 3912-4037) similar to streptococcal adhesins emb and ebha/ebhb.
18. 68 32.8% 58 122 112.3 28 4kjm:A Crystal structure of the staphylococcus aureus protein (np_6 domain 3912-4037) similar to streptococcal adhesins emb and
19. 67 34.9% 43 155 109.4 41 2gli:A Five-finger gli/DNA complex
20. 66 41.3% 46 131 108.9 43 3zey:T High-resolution cryo-electron microscopy structure of the tr brucei ribosome

Number of sequences: 20

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer