spacer
spacer

SAS results for UniProt accession no. Q0JJA0

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. Q0JJA0 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q0JJA0 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 34 unique sequences (including 9 consensus sequences) giving 56 sequence matches in all. The 20 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q0JJA0 -----------------------------------------------------------------   60S ribosomal protein L18a OS=Oryza sativa subsp. japonica  ...
3iz5:S*-----------------------------------------------------------------×5 Localization of the large subunit ribosomal proteins into a  ...
3j3b:S -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3u5e:S*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:S -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
4a18:X*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:S -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
4kl6:A -----------------------------------------------------------------   Crystal structure of dimeric form of npudnae intein
2qpw:A -----------------------------------------------------------------   Methyltransferase domain of human pr domain-containing  ...
3j3a:J*-----------------------------------------------------------------×4 Structure of the human 40s ribosomal proteins
4w23:J*-----------------------------------------------------------------×2 Structure of the 80s mammalian ribosome bound to eef2 (this  ...
2jv0:A -----------------------------------------------------------------   Set domain of riz1 tumor suppressor (prdm2)
3j38:J -----------------------------------------------------------------   Structure of the d. Melanogaster 40s ribosomal proteins
3j60:J -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3iz6:C -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3bmx:A*-asaskraidanqivnrmsldeklgqmlmpdfrnwqkegesspqaltkmndevaslvkkyqfggi×2 Beta-n-hexosaminidase (ybbd) from bacillus subtilis
3lk6:A ---askraidanqivnrmsldeklgqmlmpdfrnwqkegesspqaltkmndevaslvkkyqfggi   Beta-n-hexosaminidase n318d mutant (ybbd_n318d) from bacillu
3nvd:A -asaskraidanqivnrmsldeklgqmlmpdfrnwqkegesspqaltkmndevaslvkkyqfggi   Structure of ybbd in complex with pugnac
4gyj:A easaskraidanqivnrmsldeklgqmlmpdfrnwqkegesspqaltkmndevaslvkkyqfggi   Crystal structure of mutant (d318n) bacillus subtilus  ...
4gyk:A --saskraidanqivnrmsldeklgqmlmpdfrnwqkegesspqaltkmndevaslvkkyqfggi   Crystal structure of mutant (d318n) bacillus subtilus  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q0JJA0 -----------------------------------------------------------------   60S ribosomal protein L18a OS=Oryza sativa subsp. japonica  ...
3iz5:S*-----------------------------------------------------------------×5 Localization of the large subunit ribosomal proteins into a  ...
3j3b:S -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3u5e:S*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:S -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
4a18:X*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:S -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
4kl6:A -----------------------------------------------------------------   Crystal structure of dimeric form of npudnae intein
2qpw:A -----------------------------------------------------------------   Methyltransferase domain of human pr domain-containing  ...
3j3a:J*-----------------------------------------------------------------×4 Structure of the human 40s ribosomal proteins
4w23:J*-----------------------------------------------------------------×2 Structure of the 80s mammalian ribosome bound to eef2 (this  ...
2jv0:A -----------------------------------------------------------------   Set domain of riz1 tumor suppressor (prdm2)
3j38:J -----------------------------------------------------------------   Structure of the d. Melanogaster 40s ribosomal proteins
3j60:J -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3iz6:C -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3bmx:A*ilfaenvkttkqtvqltddyqkaspkiplmlsidqeggivtrlgegtnfpgnmalgaarsrinay×2 Beta-n-hexosaminidase (ybbd) from bacillus subtilis
3lk6:A ilfaenvkttkqtvqltddyqkaspkiplmlsidqeggivtrlgegtnfpgnmalgaarsrinay   Beta-n-hexosaminidase n318d mutant (ybbd_n318d) from bacillu
3nvd:A ilfaenvkttkqtvqltddyqkaspkiplmlsidqeggivtrlgegtnfpgnmalgaarsrinay   Structure of ybbd in complex with pugnac
4gyj:A ilfaenvkttkqtvqltddyqkaspkiplmlsidqeggivtrlgegtnfpgnmalgaarsrinay   Crystal structure of mutant (d318n) bacillus subtilus  ...
4gyk:A ilfaenvkttkqtvqltddyqkaspkiplmlsidqeggivtrlgegtnfpgnmalgaarsrinay   Crystal structure of mutant (d318n) bacillus subtilus  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q0JJA0 -----------------------------------------------------------------   60S ribosomal protein L18a OS=Oryza sativa subsp. japonica  ...
3iz5:S*-----------------------------------------------------------------×5 Localization of the large subunit ribosomal proteins into a  ...
3j3b:S -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3u5e:S*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:S -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
4a18:X*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:S -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
4kl6:A -----------------------------------------------------------------   Crystal structure of dimeric form of npudnae intein
2qpw:A -----------------------------------------------------------------   Methyltransferase domain of human pr domain-containing  ...
3j3a:J*-----------------------------------------------------------------×4 Structure of the human 40s ribosomal proteins
4w23:J*-----------------------------------------------------------------×2 Structure of the 80s mammalian ribosome bound to eef2 (this  ...
2jv0:A -----------------------------------------------------------------   Set domain of riz1 tumor suppressor (prdm2)
3j38:J -----------------------------------------------------------------   Structure of the d. Melanogaster 40s ribosomal proteins
3j60:J -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3iz6:C -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3bmx:A*qtgsiigkelsalgintdfspvvdinnnpdnpvigvrsfssnreltsrlglytmkglqrqdiasa×2 Beta-n-hexosaminidase (ybbd) from bacillus subtilis
3lk6:A qtgsiigkelsalgintdfspvvdinnnpdnpvigvrsfssnreltsrlglytmkglqrqdiasa   Beta-n-hexosaminidase n318d mutant (ybbd_n318d) from bacillu
3nvd:A qtgsiigkelsalgintdfspvvdinnnpdnpvigvrsfssnreltsrlglytmkglqrqdiasa   Structure of ybbd in complex with pugnac
4gyj:A qtgsiigkelsalgintdfspvvdinnnpdnpvigvrsfssnreltsrlglytmkglqrqdiasa   Crystal structure of mutant (d318n) bacillus subtilus  ...
4gyk:A qtgsiigkelsalgintdfspvvdinnnpdnpvigvrsfssnreltsrlglytmkglqrqdiasa   Crystal structure of mutant (d318n) bacillus subtilus  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q0JJA0 -----------------------------------------------------------------   60S ribosomal protein L18a OS=Oryza sativa subsp. japonica  ...
3iz5:S*-----------------------------------------------------------------×5 Localization of the large subunit ribosomal proteins into a  ...
3j3b:S -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3u5e:S*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:S -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
4a18:X*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:S -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
4kl6:A -----------------------------------------------------------------   Crystal structure of dimeric form of npudnae intein
2qpw:A -----------------------------------------------------------------   Methyltransferase domain of human pr domain-containing  ...
3j3a:J*-----------------------------------------------------------------×4 Structure of the human 40s ribosomal proteins
4w23:J*-----------------------------------------------------------------×2 Structure of the 80s mammalian ribosome bound to eef2 (this  ...
2jv0:A -----------------------------------------------------------------   Set domain of riz1 tumor suppressor (prdm2)
3j38:J -----------------------------------------------------------------   Structure of the d. Melanogaster 40s ribosomal proteins
3j60:J -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3iz6:C -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3bmx:A*lkhfpghgdtdvdshyglplvshgqerlrevelypfqkaidagadmvmtahvqfpafddttyksk×2 Beta-n-hexosaminidase (ybbd) from bacillus subtilis
3lk6:A lkhfpghgdtdvdshyglplvshgqerlrevelypfqkaidagadmvmtahvqfpafddttyksk   Beta-n-hexosaminidase n318d mutant (ybbd_n318d) from bacillu
3nvd:A lkhfpghgdtdvdshyglplvshgqerlrevelypfqkaidagadmvmtahvqfpafddttyksk   Structure of ybbd in complex with pugnac
4gyj:A lkhfpghgdtdvdshyglplvshgqerlrevelypfqkaidagadmvmtahvqfpafddttyksk   Crystal structure of mutant (d318n) bacillus subtilus  ...
4gyk:A lkhfpghgdtdvdshyglplvshgqerlrevelypfqkaidagadmvmtahvqfpafddttyksk   Crystal structure of mutant (d318n) bacillus subtilus  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q0JJA0 -----------------------------------------------------------------   60S ribosomal protein L18a OS=Oryza sativa subsp. japonica  ...
3iz5:S*-----------------------------------------------------------------×5 Localization of the large subunit ribosomal proteins into a  ...
3j3b:S -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3u5e:S*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:S -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
4a18:X*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:S -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3j39:Z -----------------------------------------------------------rkimkq   Structure of the d. Melanogaster 60s ribosomal proteins
4kl6:A --------------------------------------------------------------gga   Crystal structure of dimeric form of npudnae intein
2qpw:A -----------------------------------------------------------------   Methyltransferase domain of human pr domain-containing  ...
3j3a:J*-----------------------------------------------------------------×4 Structure of the human 40s ribosomal proteins
4w23:J*-----------------------------------------------------------------×2 Structure of the 80s mammalian ribosome bound to eef2 (this  ...
2jv0:A -----------------------------------------------------------------   Set domain of riz1 tumor suppressor (prdm2)
3j38:J -----------------------------------------------------------------   Structure of the d. Melanogaster 40s ribosomal proteins
3j60:J -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3iz6:C -----------------------------------------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3bmx:A*ldgsdilvpatlskkvmtgllrqemgfngvivtdalnmkaiadhfgqeeavvmavkagvdialmp×2 Beta-n-hexosaminidase (ybbd) from bacillus subtilis
3lk6:A ldgsdilvpatlskkvmtgllrqemgfngvivtnalnmkaiadhfgqeeavvmavkagvdialmp   Beta-n-hexosaminidase n318d mutant (ybbd_n318d) from bacillu
3nvd:A ldgsdilvpatlskkvmtgllrqemgfngvivtdalnmkaiadhfgqeeavvmavkagvdialmp   Structure of ybbd in complex with pugnac
4gyj:A ldgsdilvpatlskkvmtgllrqemgfngvivtnalnmkaiadhfgqeeavvmavkagvdialmp   Crystal structure of mutant (d318n) bacillus subtilus  ...
4gyk:A ldgsdilvpatlskkvmtgllrqemgfngvivtnalnmkaiadhfgqeeavvmavkagvdialmp   Crystal structure of mutant (d318n) bacillus subtilus  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q0JJA0 -------------------mgafrfhqyqvvgrglptptdehpkiy---rmklwatnevrakskf   60S ribosomal protein L18a OS=Oryza sativa subsp. japonica  ...
3iz5:S*-------------------mgafrfhqyqvvgrglptptdehpkiy---rmklwatnevrakskf×5 Localization of the large subunit ribosomal proteins into a  ...
3j3b:S -----------------kasgtlr--eykvvgrclptpkchtpply---rmrifapnhvvaksrf   Structure of the human 60s ribosomal proteins
3u5e:S*---------------------mahfkeyqvigrrlptesvpepklf---rmrifasneviaksry×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:S ----------------------gllkeyevvgrklpsekepqtply---kmrifapdnivaksrf   Structure of the d. Melanogaster 60s ribosomal proteins
4a18:X*--------vrkaaqepkddtlqmkvrqyvvsaarlpieqgtkpeil---qmrvfardevhaktkf×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:S -------------------mvrphlrhycvvgretpseknpqptvy---kfevfapnfvvaksrf   High-resolution cryo-electron microscopy structure of the  ...
3j39:Z gkivivlsgryagrkaiivkthddgtpekpfghalvagidryprkv---tkkm-gknklkkkskv   Structure of the d. Melanogaster 60s ribosomal proteins
4kl6:A lsyeteiltveygllpigkivekriectvysvdnngniytqpvaqw---hdrgeqevfeycledg   Crystal structure of dimeric form of npudnae intein
2qpw:A ----------nqnttepvaatetlaevpehvlrglpeevrlfpsavdktrigvwatkpilkgkkf   Methyltransferase domain of human pr domain-containing  ...
3j3a:J*-------------------------wvcrktyvtprrpfeksrldq---elkligeyglrnkrev×4 Structure of the human 40s ribosomal proteins
4w23:J*--------------------pvarswvcrktyvtprrpfeksrldq---elkligeyglrnkrev×2 Structure of the 80s mammalian ribosome bound to eef2 (this  ...
2jv0:A -------gsmdqnttepvaatetlaevpehvlrglpeevrlfpsavdktrigvwatkpilkgkkf   Set domain of riz1 tumor suppressor (prdm2)
3j38:J ------------------------gripsvfsktyvtprrpyekarldqelkiigeyglrnkrev   Structure of the d. Melanogaster 40s ribosomal proteins
3j60:J ------------------mpraprtysktystkkprrpyekerlda---elklvgeyglrckrel   Localization of the small subunit ribosomal proteins into a  ...
3iz6:C ------------------mpraprtysktystkkprrpyekerlda---elklvgeyglrckrel   Localization of the small subunit ribosomal proteins into a  ...
3bmx:A*asvtslkeeqkfarviqalkeavkngdipeqqinnsveriislkik---rgmyparnsdstkek-×2 Beta-n-hexosaminidase (ybbd) from bacillus subtilis
3lk6:A asvtslkeeqkfarviqalkeavkngdipeqqinnsveriislkik---rgmyparnsdstkek-   Beta-n-hexosaminidase n318d mutant (ybbd_n318d) from bacillu
3nvd:A asvtslkeeqkfarviqalkeavkngdipeqqinnsveriislkik---rgmyparnsdstkek-   Structure of ybbd in complex with pugnac
4gyj:A asvtslkeeqkfarviqalkeavkngdipeqqinnsveriislkik---rgmyparnsdstkek-   Crystal structure of mutant (d318n) bacillus subtilus  ...
4gyk:A asvtslkeeqkfarviqalkeavkngdipeqqinnsveriislkik---rgmyparnsdstkek-   Crystal structure of mutant (d318n) bacillus subtilus  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q0JJA0 wyflrklkkvkksngqilaineifek-n------pttikn--ygiwlryqs-rtgyhnmy-keyr   60S ribosomal protein L18a OS=Oryza sativa subsp. japonica  ...
3iz5:S*wyflrklkkvkksngqilaineifek-n------pttikn--ygiwlryqs-rtgyhnmy-keyr×5 Localization of the large subunit ribosomal proteins into a  ...
3j3b:S wyfvsqlkkmkkssgeivycgqvfek-s------plrvkn--fgiwlryds-rsgthnmy-reyr   Structure of the human 60s ribosomal proteins
3u5e:S*wyflqklhkvkkasgeivsinqinea-h------ptkvkn--fgvwvryds-rsgthnmy-keir×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:S wyflrqlkkfkkttgeivsikqvyet-s------pvkikn--fgiwlryds-rsgthnmy-reyr   Structure of the d. Melanogaster 60s ribosomal proteins
4a18:X*wynmrklnkikrsqgrilsvneiyek-s------lntvkt--ygivlkyqs-rtaihnmy-keyr×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:S wrmmreknkvksthgdvlsc-kvvkd-r------klaarn--ysvdiayysqrcgythmv-kefr   High-resolution cryo-electron microscopy structure of the  ...
3j39:Z kpflkslnynhlmptrytahdisfekls------pkdlkdpvkrkthrfqt-rvkfesvy-kegk   Structure of the d. Melanogaster 60s ribosomal proteins
4kl6:A sliratkdhkfmvdgqmlpideifer-e------ldlmrn--pgikiatrk-ylgkqnvy-digv   Crystal structure of dimeric form of npudnae intein
2qpw:A gpfvgdkkkrsqvknnvy-mwevyyp-nlgwmcidatdpe--kgnwlryvn-wacsgeeq-nlfp   Methyltransferase domain of human pr domain-containing  ...
3j3a:J*wrvkftlakirkaarelltlde---k-d------prrlfe--gnallrrlv-rigvldeg-kmkl×4 Structure of the human 40s ribosomal proteins
4w23:J*wrvkftlakirkaarelltlde---k-d------prrlfe--gnallrrlv-rigvldeg-kmkl×2 Structure of the 80s mammalian ribosome bound to eef2 (this  ...
2jv0:A gpfvgdkkkrsqvknnvy-mwevyyp-nlgwmcidatdpe--kgnwlryvn-wacsgeeq-nlfp   Set domain of riz1 tumor suppressor (prdm2)
3j38:J wrvkyalakirkaarelltlde---k-d------ekrlfq--gnallrrlv-rigvldes-rmkl   Structure of the d. Melanogaster 40s ribosomal proteins
3j60:J wrvqyalsrirnnarhlltld---ek-n------prrife--geallrrmn-ryglladg-qnkl   Localization of the small subunit ribosomal proteins into a  ...
3iz6:C wrvqyalsrirnnarhlltld---ek-n------prrife--geallrrmn-ryglladg-qnkl   Localization of the small subunit ribosomal proteins into a  ...
3bmx:A*---iakakkivgskqhlkaekklaek-a------vtvlkn--eqhtlpfkp-kkgsrilivapye×2 Beta-n-hexosaminidase (ybbd) from bacillus subtilis
3lk6:A ---iakakkivgskqhlkaekklaek-a------vtvlkn--eqhtlpfkp-kkgsrilivapye   Beta-n-hexosaminidase n318d mutant (ybbd_n318d) from bacillu
3nvd:A ---iakakkivgskqhlkaekklaek-a------vtvlkn--eqhtlpfkp-kkgsrilivapye   Structure of ybbd in complex with pugnac
4gyj:A ---iakakkivgskqhlkaekklaek-a------vtvlkn--eqhtlpfkp-kkgsrilivapye   Crystal structure of mutant (d318n) bacillus subtilus  ...
4gyk:A ---iakakkivgskqhlkaekklaek-a------vtvlkn--eqhtlpfkp-kkgsrilivapye   Crystal structure of mutant (d318n) bacillus subtilus  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q0JJA0 dttlngaveqmytemasrhrvrfpciqiiktatvhfkl-ckrdntkqfhksdikfplvyrkvrpp   60S ribosomal protein L18a OS=Oryza sativa subsp. japonica  ...
3iz5:S*dttlngaveqmytemasrhrvrfpciqiiktatvhfkl-ckrdntkqfhksdikfplvyrkvrpp×5 Localization of the large subunit ribosomal proteins into a  ...
3j3b:S dlttagavtqcyrdmgarhrarahsiqimkveeiaask-crrpavkqfhdskikfplphrvlr--   Structure of the human 60s ribosomal proteins
3u5e:S*dvsrvaavetlyqdmaarhrarfrsihilkvaeiektadvkrqyvkqfltkdlkfplphr-----×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:S dltvggavtqcyrdmgarhrarahsiqiikvdsipaak-trrvhvkqfhdskikfplvqrvhhkg   Structure of the d. Melanogaster 60s ribosomal proteins
4a18:X*dvslngavsqliqdmagnhraqpdtiqiirtatlepkd-ikrpatlamrnaalkfpivktihrps×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:S dvckagavsqayndlasrhraryhnievlgvksipnhe-vrrlnvaqfhphnlsfpllqrrvkap   High-resolution cryo-electron microscopy structure of the  ...
3j39:Z nkwffqklrf-------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
4kl6:A erdhnfalkngfiasna------------------------------------------------   Crystal structure of dimeric form of npudnae intein
2qpw:A leinraiyyktlkpiapgeellvwyngednpei--------------------------------   Methyltransferase domain of human pr domain-containing  ...
3j3a:J*dyilglkiedf---lerrlqtqvfklglaksih-harv-lirqrhirvrkqvvnipsfi--vrld×4 Structure of the human 40s ribosomal proteins
4w23:J*dyilglkiedf---lerrlqtqvfklglaksih-harv-lirqrhirvrkqvvnipsfi--vrld×2 Structure of the 80s mammalian ribosome bound to eef2 (this  ...
2jv0:A leinraiyyktlkpiapgeellvwyxgednpeiaaaie-eerasar-------------------   Set domain of riz1 tumor suppressor (prdm2)
3j38:J dyvlglkiedf---lerrlqtqvfklglaksih-harv-lirqrhirvrkqvvnipsfv--vrld   Structure of the d. Melanogaster 40s ribosomal proteins
3j60:J dyvlaltvenflarrlqtlvfkagmaksihharvlirq-rhirvgrqivnipsfmvrvesekhid   Localization of the small subunit ribosomal proteins into a  ...
3iz6:C dyvlaltvenflarrlqtlvfkagmaksihharvlirq-rhirvgrqivnipsfmvrvesekhid   Localization of the small subunit ribosomal proteins into a  ...
3bmx:A*eqt--asieqtihdlikrkkikpvslskmnfasqvf----ktehekqvkeadyiitgsyvvkndp×2 Beta-n-hexosaminidase (ybbd) from bacillus subtilis
3lk6:A eqt--asieqtihdlikrkkikpvslskmnfasqvf----ktehekqvkeadyiitgsyvvkndp   Beta-n-hexosaminidase n318d mutant (ybbd_n318d) from bacillu
3nvd:A eqt--asieqtihdlikrkkikpvslskmnfasqvf----ktehekqvkeadyiitgsyvvkndp   Structure of ybbd in complex with pugnac
4gyj:A eqt--asieqtihdlikrkkikpvslskmnfasqvf----ktehekqvkeadyiitgsyvvkndp   Crystal structure of mutant (d318n) bacillus subtilus  ...
4gyk:A eqt--asieqtihdlikrkkikpvslskmnfasqvf----ktehekqvkeadyiitgsyvvkndp   Crystal structure of mutant (d318n) bacillus subtilus  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q0JJA0 trk-----lkttfkasrpnlfm-------------------------------------------   60S ribosomal protein L18a OS=Oryza sativa subsp. japonica  ...
3iz5:S*trk-----lkt------------------------------------------------------×5 Localization of the large subunit ribosomal proteins into a  ...
3j3b:S -rq-----hkprfttkrpntff-------------------------------------------   Structure of the human 60s ribosomal proteins
3u5e:S*vqk-----stktfsykrpstfy-------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:S nrk-----l-fsfrkprtyfq--------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
4a18:X*ekk-----yrtvykatrpttf--------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:S -rk-----drvifvkknskravva-----------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
4kl6:A -----------------------------------------------------------------   Crystal structure of dimeric form of npudnae intein
2qpw:A -----------------------------------------------------------------   Methyltransferase domain of human pr domain-containing  ...
3j3a:J*sqkhidfslrspygggrpgrvkrknakkgqggagag-----------------------------×4 Structure of the human 40s ribosomal proteins
4w23:J*sqkhidfslrspygggrpgrvkrknakkgqggag-------------------------------×2 Structure of the 80s mammalian ribosome bound to eef2 (this  ...
2jv0:A -----------------------------------------------------------------   Set domain of riz1 tumor suppressor (prdm2)
3j38:J sqkhidfslkspfgggrpgrvkrknlkknqg----------------------------------   Structure of the d. Melanogaster 40s ribosomal proteins
3j60:J fsl-----tspfgggppgrvkrknqkkasgggg--------------------------------   Localization of the small subunit ribosomal proteins into a  ...
3iz6:C fsl-----tspfgggppgrvkrknqkkasggggdgeeedee------------------------   Localization of the small subunit ribosomal proteins into a  ...
3bmx:A*vvn-----dgviddtisdsskwatvfpravmkaalqhnkpfvlmslrnpydaanfeeakaliavy×2 Beta-n-hexosaminidase (ybbd) from bacillus subtilis
3lk6:A vvn-----dgviddtisdsskwatvfpravmkaalqhnkpfvlmslrnpydaanfeeakaliavy   Beta-n-hexosaminidase n318d mutant (ybbd_n318d) from bacillu
3nvd:A vvn-----dgviddtisdsskwatvfpravmkaalqhnkpfvlmslrnpydaanfeeakaliavy   Structure of ybbd in complex with pugnac
4gyj:A vvn-----dgviddtisdsskwatvfpravmkaalqhnkpfvlmslrnpydaanfeeakaliavy   Crystal structure of mutant (d318n) bacillus subtilus  ...
4gyk:A vvn-----dgviddtisdsskwatvfpravmkaalqhnkpfvlmslrnpydaanfeeakaliavy   Crystal structure of mutant (d318n) bacillus subtilus  ...

           5         6         6         6         6         6      
           9         0         1         2         3         4      
       6789012345678901234567890123456789012345678901234567890123456       Protein name
       ----+---------+---------+---------+---------+---------+------       ------------
Q0JJA0 -------------------------------------------------------------       60S ribosomal protein L18a OS=Oryza sativa subsp. japonica  ...
3iz5:S*-------------------------------------------------------------    ×5 Localization of the large subunit ribosomal proteins into a  ...
3j3b:S -------------------------------------------------------------       Structure of the human 60s ribosomal proteins
3u5e:S*-------------------------------------------------------------    ×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:S -------------------------------------------------------------       Structure of the d. Melanogaster 60s ribosomal proteins
4a18:X*-------------------------------------------------------------    ×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:S -------------------------------------------------------------       High-resolution cryo-electron microscopy structure of the  ...
3j39:Z -------------------------------------------------------------       Structure of the d. Melanogaster 60s ribosomal proteins
4kl6:A -------------------------------------------------------------       Crystal structure of dimeric form of npudnae intein
2qpw:A -------------------------------------------------------------       Methyltransferase domain of human pr domain-containing  ...
3j3a:J*-------------------------------------------------------------    ×4 Structure of the human 40s ribosomal proteins
4w23:J*-------------------------------------------------------------    ×2 Structure of the 80s mammalian ribosome bound to eef2 (this  ...
2jv0:A -------------------------------------------------------------       Set domain of riz1 tumor suppressor (prdm2)
3j38:J -------------------------------------------------------------       Structure of the d. Melanogaster 40s ribosomal proteins
3j60:J -------------------------------------------------------------       Localization of the small subunit ribosomal proteins into a  ...
3iz6:C -------------------------------------------------------------       Localization of the small subunit ribosomal proteins into a  ...
3bmx:A*gfkgyangrylqpnipagvmaifgqakpkgtlpvdipsvtkpgntlyplgyglniktgrpl    ×2 Beta-n-hexosaminidase (ybbd) from bacillus subtilis
3lk6:A gfkgyangrylqpnipagvmaifgqakpkgtlpvdipsvtkpgntlyplgyglniktgrpl       Beta-n-hexosaminidase n318d mutant (ybbd_n318d) from bacillu
3nvd:A gfkgyangrylqpnipagvmaifgqakpkgtlpvdipsvtkpgntlyplgyglniktgrpl       Structure of ybbd in complex with pugnac
4gyj:A gfkgyangrylqpnipagvmaifgqakpkgtlpvdipsvtkpgntlyplgyglniktgrpl       Crystal structure of mutant (d318n) bacillus subtilus  ...
4gyk:A gfkgyangrylqpnipagvmaifgqakpkgtlpvdipsvtkpgntlyplgyglniktgrpl       Crystal structure of mutant (d318n) bacillus subtilus  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q0JJA0. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 178 - - Q0JJA0 60S ribosomal protein L18a OS=Oryza sativa subsp. japonica GN=Os01g0752300 PE=1 SV=1
2. 1139 100.0% 167 167 1529.4 3.3e-78 3iz5:S * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
3. " " " " " "  = 3izc:S *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
4. " " " " " "  = 3izr:S *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
5. " " " " " "  = 3izs:S *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
6. " " " " " "  = 3j61:S *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
7. 624 52.3% 176 175 840.5 7.7e-40 3j3b:S Structure of the human 60s ribosomal proteins
8. 584 50.3% 173 172 787.1 7.2e-37 3u5e:S * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
9. " " " " " "  = 3u5i:S *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
10. " " " " " "  = 4b6a:S *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
11. " " " " " "  = 4byn:S *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
12. " " " " " "  = 4byu:S *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
13. 576 49.4% 168 173 776.4 2.9e-36 3j39:S Structure of the d. Melanogaster 60s ribosomal proteins
14. 559 49.1% 173 188 753.1 5.7e-35 4a18:X * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
15. " " " " " "  = 4a19:X *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
16. " " " " " "  = 4a1b:X *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
17. " " " " " "  = 4a1d:X *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
18. 399 36.4% 165 179 539.5 4.5e-23 3zf7:S High-resolution cryo-electron microscopy structure of the tr brucei ribosome
19. 94 27.0% 89 134 133.5 1.9 3j39:Z Structure of the d. Melanogaster 60s ribosomal proteins
20. 91 37.8% 37 136 129.4 3.1 4kl6:A Crystal structure of dimeric form of npudnae intein
21. 86 28.4% 81 147 122.2 7.9 2qpw:A Methyltransferase domain of human pr domain-containing protein 2
22. 87 21.2% 151 182 122.2 7.9 3j3a:J * Structure of the human 40s ribosomal proteins
23. " " " " " "  = 4kzx:J *
Rabbit 40s ribosomal subunit in complex with eif1.
24. " " " " " "  = 4kzy:J *
Rabbit 40s ribosomal subunit in complex with eif1 and eif1a.
25. " " " " " "  = 4kzz:J *
Rabbit 40s ribosomal subunit in complex with mRNA, initiator eif1a
26. 87 21.2% 151 185 122.1 8 4w23:J * Structure of the 80s mammalian ribosome bound to eef2 (this contains the small ribosomal subunit)
27. " " " " " "  = 4w28:J *
Structure of the translating mammalian ribosome-sec61 comple entry contains the small ribosomal subunit)
28. 86 28.4% 81 162 121.5 8.6 2jv0:A Set domain of riz1 tumor suppressor (prdm2)
29. 82 20.3% 172 181 115.5 18 3j38:J Structure of the d. Melanogaster 40s ribosomal proteins
30. 82 25.6% 78 187 115.3 19 3j60:J Localization of the small subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
31. 82 25.6% 78 195 115.1 20 3iz6:C Localization of the small subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
32. 87 24.0% 125 617 114.5 21 3bmx:A * Beta-n-hexosaminidase (ybbd) from bacillus subtilis
33. " " " " " "  = 3cqm:A *
Structure of ybbd in complex with pugnac
34. 87 24.0% 125 615 114.5 21 3lk6:A Beta-n-hexosaminidase n318d mutant (ybbd_n318d) from bacillu
35. 87 24.0% 125 617 114.5 21 3nvd:A Structure of ybbd in complex with pugnac
36. 87 24.0% 125 618 114.5 21 4gyj:A Crystal structure of mutant (d318n) bacillus subtilus family glycoside hydrolase (nagz) in complex with glcnac-murnac (s p1)
37. 87 24.0% 125 616 114.5 21 4gyk:A Crystal structure of mutant (d318n) bacillus subtilus family glycoside hydrolase (nagz) in complex with glcnac-murnac (s p1211)

Number of sequences: 37

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 80 30.9% 55 190 112.6 27 3j3a:H * Structure of the human 40s ribosomal proteins
2. " " " " " "  = 4kzx:H *
Rabbit 40s ribosomal subunit in complex with eif1.
3. " " " " " "  = 4kzy:H *
Rabbit 40s ribosomal subunit in complex with eif1 and eif1a.
4. " " " " " "  = 4kzz:H *
Rabbit 40s ribosomal subunit in complex with mRNA, initiator eif1a
5. 80 30.9% 55 189 112.6 27 4w23:H * Structure of the 80s mammalian ribosome bound to eef2 (this contains the small ribosomal subunit)
6. " " " " " "  = 4w28:H *
Structure of the translating mammalian ribosome-sec61 comple entry contains the small ribosomal subunit)
7. 81 28.4% 74 282 111.4 31 3l23:A Crystal structure of sugar phosphate isomerase/epimerase (yp_001303399.1) from parabacteroides distasonis atcc 8503 resolution
8. 75 26.1% 46 88 110.7 34 4gdk:A * Crystal structure of human atg12~atg5 conjugate in complex w terminal fragment of atg16l1
9. " " " " " "  = 4gdl:A *
Crystal structure of human atg12~atg5 conjugate in complex w terminal fragment of atg16l1
10. " " " " " "  = 4naw:A *
Crystal structure of human atg12~atg5-atg16n in complex with fragment of atg3
11. 82 23.0% 152 415 110.3 36 2pbi:A The multifunctional nature of gbeta5/rgs9 revealed from its structure
12. 77 20.7% 121 175 109.1 42 2r6t:B Structure of a r132k variant pduo-type atp:co(i)rrinoid adenosyltransferase from lactobacillus reuteri complexed with atp
13. 80 22.1% 113 383 108.1 48 2hfb:A Crystal structure of selenomethionine-labelled rafe from str pneumoniae
14. 80 22.1% 113 385 108.1 48 2i58:A Crystal structure of rafe from streptococcus pneumoniae comp raffinose
15. 82 24.4% 90 591 108.1 48 4a5a:A Crystal structure of the c258s/c268s variant of toxoplasma g nucleoside triphosphate diphosphohydrolase 3 (ntpdase3) in with magnesium and amppnp
16. 80 22.1% 113 391 108.0 49 2heu:A Atomic resolution structure of apo-form of rafe from streptococcus pneumoniae
17. 80 22.1% 113 388 108.0 48 2hq0:A Structure of rafe from streptococcus pneumoniae
18. 82 24.4% 90 594 108.0 48 4a57:A Crystal structure of toxoplasma gondii nucleoside triphospha diphosphohydrolase 3 (ntpdase3)
19. 82 24.4% 90 593 108.0 48 4a59:A Crystal structure of toxoplasma gondii nucleoside triphospha diphosphohydrolase 3 (ntpdase3) in complex with amp
20. 79 25.2% 107 321 107.9 49 2jii:A Structure of vaccinia related kinase 3

Number of sequences: 20

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer