spacer
spacer

SAS results for UniProt accession no. Q02326

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. Q02326 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q02326 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 33 unique sequences (including 10 consensus sequences) giving 59 sequence matches in all. The 23 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q02326 -----------------------------------------------------------------   60S ribosomal protein L6-A OS=Saccharomyces cerevisiae  ...
3izc:G*-----------------------------------------------------------------×4 Localization of the large subunit ribosomal proteins into a  ...
3u5i:E*-----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3u5e:E -----------------------------------------------------------------   The structure of the eukaryotic ribosome at 3.0 a  ...
3iz5:G*---------------------------------------maptskmalgikrasrshtyhrrglw×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:E*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:E vkkgnlkakkpkkgkphcsrnpvlvrgigrysrsamysrkamykrkysaakskvekkkkekvlat   Structure of the human 60s ribosomal proteins
3j39:E ------------------------------------kgkkhpvnsylkggilryskaqmykrral   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:v -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
2joy:A -----------------------------------------------------------------   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
2kds:A -----------------------------------------------------------------   Structure of ribosomal protein l14e from sulfolobus solfatar
3j21:5*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2mhd:A -----------------------------------------------------------------   Nmr structure of the hypothetical protein bacuni_03114 from  ...
4a18:N*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:Z -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3iz5:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j61:Z -----------------------------------------------------------------   Localization of the large subunit ribosomal proteins into a  ...
2xnf:A ------------------------------------------------------msvsnkllaws   The mediator med25 activator interaction domain: structure  ...
2l23:A ---------------------------------------------------mgqqsvsnkllaws   Nmr structure of the acid (activator interacting domain) of  ...
2l6u:A ------------------------------------------mghhhhhhshgqqsvsnkllaws   Solution nmr structure of med25(391-543) comprising the  ...
2ky6:A -------------------------------------------------gefgqqsvsnkllaws   Structure of arc92vbd/med25acid

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q02326 ---------------msaqkapkwypsedvaa--lkktrkaarp-----qk--lraslvpgtvli   60S ribosomal protein L6-A OS=Saccharomyces cerevisiae  ...
3izc:G*---------------msaqkapkwypsedvaa--lkktrkaarp-----qk--lraslvpgtvli×4 Localization of the large subunit ribosomal proteins into a  ...
3u5i:E*----------------saqkapkwypsedvaa--lkktrkaarp-----qk--lraslvpgtvli×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3u5e:E ----------------saqkapkwypsedvaa--lkktrkaarp-----qk--lraslvpgtvli   The structure of the eukaryotic ribosome at 3.0 a  ...
3iz5:G*aikakhggalpkaekpaaiaepkfypaddvkp--rtvstrkphp-----tk--lrstitpgtvli×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:E*-------argpagknrgvskiskwykaddeatpfhrrqlkkata-----tk--lrndiapgtvli×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:E vtkpvggdknggtrvvklrkmpryyptedvpr---kllshgkkpfsqhvrk--lrasitpgtili   Structure of the human 60s ribosomal proteins
3j39:E yrlkdkkspvvekakvpikkskasyptktfvk--krpskanfse-----hkrntrrnltpgtvli   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:v --------------------paatkkavekka--kkvsrkspey-----st--vrksckpgtiai   High-resolution cryo-electron microscopy structure of the  ...
2joy:A ------------------------------------------------------mpaievgricv   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
2kds:A -------------------------------------------------------paievgricv   Structure of ribosomal protein l14e from sulfolobus solfatar
3j21:5*--------------------------------------------------------aidvgriav×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2mhd:A -----------------------------------------gde-----dd--kveipqlvgkwi   Nmr structure of the hypothetical protein bacuni_03114 from  ...
4a18:N*------------------------------------------------------akflkygrvvi×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:Z ------------------------------------------------------gkfmkpgkvvl   Structure of the human 60s ribosomal proteins
3iz5:a*-----------------------------------------------------mvkflkpgkavi×2 Localization of the large subunit ribosomal proteins into a  ...
3j61:Z -----------------------------------------------------mvkflkpgkavi   Localization of the large subunit ribosomal proteins into a  ...
2xnf:A gvlewqekpkpasvdantkltrslpcqvyvnh--genlkteqwp-----qk--limqlipqqllt   The mediator med25 activator interaction domain: structure  ...
2l23:A gvlewqekpkpasvdantkltrslpcqvyvnh--genlkteqwp-----qk--limqlipqqllt   Nmr structure of the acid (activator interacting domain) of  ...
2l6u:A gvlewqekpkpasvdantkltrslpcqvyvnh--genlkteqwp-----qk--limqlipqqllt   Solution nmr structure of med25(391-543) comprising the  ...
2ky6:A gvlewqekpkpasvdantkltrslpcqvyvnh--genlkteqwp-----qk--limqlipqqllt   Structure of arc92vbd/med25acid

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q02326 llagrfrgkrvvylkhledn-t-------lli-sg----pfkvng-vplrrvnaryvia-tstkv   60S ribosomal protein L6-A OS=Saccharomyces cerevisiae  ...
3izc:G*llagrfrgkrvvylkhledn-t-------lli-sg----pfkvng-vplrrvnaryvia-tstkv×4 Localization of the large subunit ribosomal proteins into a  ...
3u5i:E*llagrfrgkrvvylkhledn-t-------lli-sg----pfkvng-vplrrvnaryvia-tstkv×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3u5e:E llagrfrgkrvvylkhledn-t-------lli-sg----pfkvng-vplrrvnaryvia-tstkv   The structure of the eukaryotic ribosome at 3.0 a  ...
3iz5:G*llagrymgkrvvflkqlqsg-l-------lli-tg----pfking-vpirrvnqayvia-tstkv×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:E*llagrfrgkrvvflkqlksg-l-------llv-tg----pykvng-vplkrvnqaytls-tstkv×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:E iltgrhrgkrvvflkqlasg-l-------llv-tg----plvlnr-vplrrthqkfvia-tstki   Structure of the human 60s ribosomal proteins
3j39:E llagrhqgkrvvllkvlasg-l-------llv-tg----pfalns-cplrrvsqryvig-tsskv   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:v ilagrfrgrravilkqlpkngp-------lvi-sg----pmkysg-vpirridsryiia-tstrv   High-resolution cryo-electron microscopy structure of the  ...
2joy:A kvkgreagskcvivdiiddn-f-------vlv-tg----pkditg-vkrrrvnilhlep-tdkki   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
2kds:A kvkgreagskcvivdiiddn-f-------vlv-tg----pkditg-vkrrrvnilhlep-tdkki   Structure of ribosomal protein l14e from sulfolobus solfatar
3j21:5*viagrragqkvvvvdiidkn-f-------vlv-tg----a-glnk-vkrrrmnikhiep-lpqki×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2mhd:A vkepvlqddfvtcytfnadk-t-------yevytg----splsng-vpfr---gtyiis-ldekl   Nmr structure of the hypothetical protein bacuni_03114 from  ...
4a18:N*llqgrfagkkavivkssedg-tkdrkfghvlv-ag----verspk-kvtkrmgskkiqkrtsvkp×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:Z vlagrysgrkavivkniddg-tsdrpyshalv-agidryprkvtaamgkkkiakrskik-sfvkv   Structure of the human 60s ribosomal proteins
3iz5:a*llqgrfagrkavivrvfeeg-t-------rdr-py----ghclva-glakypkkvirkd-sakkt×2 Localization of the large subunit ribosomal proteins into a  ...
3j61:Z llqgrfagrkavivrvfeeg-t-------rdr-py----ghclva-glakypkkvirkd-sakkt   Localization of the large subunit ribosomal proteins into a  ...
2xnf:A tlgplfrnsrmvqfhftnkd-l-------esl-kg----lyrimg-ngfagcvhfphta-pcevr   The mediator med25 activator interaction domain: structure  ...
2l23:A tlgplfrnsrmvqfhftnkd-l-------esl-kg----lyrimg-ngfagcvhfphta-pcevr   Nmr structure of the acid (activator interacting domain) of  ...
2l6u:A tlgplfrnsrmvqfhftnkd-l-------esl-kg----lyrimg-ngfagcvhfphta-pcevr   Solution nmr structure of med25(391-543) comprising the  ...
2ky6:A tlgplfrnsrmvqfhftnkd-l-------esl-kg----lyrimg-ngfagcvhfphta-pcevr   Structure of arc92vbd/med25acid

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q02326 -----------sve-gvn-------v-ek--fn-ve-yfake-----kltkkekk--eanlfp--   60S ribosomal protein L6-A OS=Saccharomyces cerevisiae  ...
3izc:G*-----------sve-gvn-------v-ek--fn-ve-yfake-----kltkkekk--eanlfp--×4 Localization of the large subunit ribosomal proteins into a  ...
3u5i:E*-----------sve-gvn-------v-ek--fn-ve-yfake-----k-----------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3u5e:E -----------sve-gvn-------v-ek--fn-ve-yfake-----------------------   The structure of the eukaryotic ribosome at 3.0 a  ...
3iz5:G*-----------dis-kvn-------v-qk--fd-dk-yfare-----kktrakkt--egelfesd×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:E*-----------dlt-gvn-------t-ak--fe-dd-yfgre-----karknhknlfkaelte--×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:E -----------dis-nvk-------i-pk--hl-tdayfkkk-----klrkprhq--egeifd--   Structure of the human 60s ribosomal proteins
3j39:E -----------dlg-afk-------vpeh--ln-da-yfrrl-----k-akkdkktgeadifa--   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:v -----------dlt-gvd-------t-sa--it-pe-ifkre-----k-----------------   High-resolution cryo-electron microscopy structure of the  ...
2joy:A -----------diqkgasdeevkkkl-ee--sn-lt-eymke-----kikirmpt--l-------   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
2kds:A -----------diqkgasdeevkkkl-ee--sn-lt-eymke-----kikirmpt--l-------   Structure of ribosomal protein l14e from sulfolobus solfatar
3j21:5*-----------dip-rga-------s-de--ev-ra-aleka-----gisla-------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2mhd:A ------------ik-lyd-------k-ee--hc-te-qyhil-----kltskemk--wenasp--   Nmr structure of the hypothetical protein bacuni_03114 from  ...
4a18:N*-----------fik-yvn-------l-nh--imptr-ysvkelcdfkelvkedki--knnaks--×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:Z ynynhlmptrysvd--ip-------l-dktvvn-kd-vfrdp-----alkrkarr--eakvkf--   Structure of the human 60s ribosomal proteins
3iz5:a*-----------akk-srv-------k-cf--lk-lv-nfthl-----mptrytld--vdlkev--×2 Localization of the large subunit ribosomal proteins into a  ...
3j61:Z -----------akk-srv-------k-cf--lk-lv-nfthl-----mptrytld--vdlkev--   Localization of the large subunit ribosomal proteins into a  ...
2xnf:A -----------vlm-lly-------s-sk--kk-if-mglip-----ydqsgfvn--girqvi--   The mediator med25 activator interaction domain: structure  ...
2l23:A -----------vlm-lly-------s-sk--kk-if-mglip-----ydqsgfvn--girqvi--   Nmr structure of the acid (activator interacting domain) of  ...
2l6u:A -----------vlm-lly-------s-sk--kk-if-mglip-----ydqsgfvn--girqvi--   Solution nmr structure of med25(391-543) comprising the  ...
2ky6:A -----------vlm-lly-------s-sk--kk-if-mglip-----ydqsgfvn--girqvi--   Structure of arc92vbd/med25acid

                2         2         2         3         3         3   
                7         8         9         0         1         2   
       123456789012345678901234567890123456789012345678901234567890123     Protein name
       ---------+---------+---------+---------+---------+---------+---     ------------
Q02326 eqqnk-ei--kae-rvedqkvvdkaliaeikktp---llkq---ylsasfslkngdkphmlkf     60S ribosomal protein L6-A OS=Saccharomyces cerevisiae  ...
3izc:G*eqqnk-ei--kae-rvedqkvvdkaliaeikktp---llkq---ylsasfslkngdkphmlkf  ×4 Localization of the large subunit ribosomal proteins into a  ...
3u5i:E*------ei--kae-rvedqkvvdkaliaeikktp---llkq---ylsasfslkngdkphmlkf  ×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3u5e:E ------ei--kae-rvedqkvvdkaliaeikktp---llkq---ylsasfslkngdkphmlkf     The structure of the eukaryotic ribosome at 3.0 a  ...
3iz5:G*keatk-nl--pdf-kkddqkvidaelikaidavp---dlkn---ylgarfslrdgdkphemtf  ×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:E*eqkkk-eterkna-rkqdqqavdtpllaavkkve---flkn---ylaskftlnnndrphemkf  ×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:E tekekyei--teq-rkidqkavdsqilpkikaip---qlqg---ylrsvfaltngiyphklvf     Structure of the human 60s ribosomal proteins
3j39:E akker-fv--pneqrkkdqkevdaallkvikahpegkffak---ylqnmfalhssqyphrmrf     Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:v ----k-ev--sde-raqlqnaidtaliqaikkdp---lgkemagylhsvftikpgdaphrlkw     High-resolution cryo-electron microscopy structure of the  ...
2joy:A ---------------------------------------------------------------     Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
2kds:A ---------------------------------------------------------------     Structure of ribosomal protein l14e from sulfolobus solfatar
3j21:5*---------------------------------------------------------------  ×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2mhd:A kdgns-dk--rle-kynd---------------------------------------------     Nmr structure of the hypothetical protein bacuni_03114 from  ...
4a18:N*evrdt--l--kkv-fvekyrtinpeeksashtkf---ffsk---lrf----------------  ×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:Z eeryk-tg--knk-wffqklrf-----------------------------------------     Structure of the human 60s ribosomal proteins
3iz5:a*aagpd----------------------------------------------------------  ×2 Localization of the large subunit ribosomal proteins into a  ...
3j61:Z aagpd-al--atr-dkkvaacksakarledrfkt---gknr---wfftklrf-----------     Localization of the large subunit ribosomal proteins into a  ...
2xnf:A tnleh-hh--hhh--------------------------------------------------     The mediator med25 activator interaction domain: structure  ...
2l23:A tnhkq-vq--le---------------------------------------------------     Nmr structure of the acid (activator interacting domain) of  ...
2l6u:A tn-------------------------------------------------------------     Solution nmr structure of med25(391-543) comprising the  ...
2ky6:A tnhkq-vq--qqk-le-----------------------------------------------     Structure of arc92vbd/med25acid

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q02326. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 176 - - Q02326 60S ribosomal protein L6-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL6A PE=1 SV=2
2. 1109 100.0% 176 176 1410.3 1.4e-71 3izc:G * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
3. " " " " " "  = 3izs:G *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
4. " " " " " "  = 3o58:F *
Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
5. " " " " " "  = 3o5h:F *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
6. 942 89.7% 175 157 896.0 6.2e-43 3u5i:E * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
7. " " " " " "  = 4b6a:E *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
8. " " " " " "  = 4byn:E *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
9. " " " " " "  = 4byu:E *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
10. 934 89.1% 175 156 887.2 1.9e-42 3u5e:E The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
11. 600 52.5% 177 219 764.9 1.3e-35 3iz5:G * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
12. " " " " " "  = 3izr:G *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
13. " " " " " "  = 3j61:E *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
14. 567 51.1% 178 190 724.0 2.4e-33 4a18:E * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
15. " " " " " "  = 4a19:E *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
16. " " " " " "  = 4a1b:E *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
17. " " " " " "  = 4a1d:E *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
18. 486 45.0% 180 262 619.5 1.6e-27 3j3b:E Structure of the human 60s ribosomal proteins
19. 402 41.8% 182 228 514.1 1.2e-21 3j39:E Structure of the d. Melanogaster 60s ribosomal proteins
20. 404 44.5% 164 158 388.6 1.1e-14 3zf7:v High-resolution cryo-electron microscopy structure of the tr brucei ribosome
21. 131 28.9% 83 96 176.7 0.0073 2joy:A Nmr structure of 50s ribosomal protein l14e from sulfolobus solfataricus: northeast structural genomics consortium target ssr105
22. 131 28.9% 83 95 176.7 0.0072 2kds:A Structure of ribosomal protein l14e from sulfolobus solfatar
23. 105 28.1% 57 81 144.9 0.43 3j21:5 * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
24. " " " " " "  = 3j44:5 *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
25. 99 30.4% 79 110 135.3 1.5 2mhd:A Nmr structure of the hypothetical protein bacuni_03114 from bacteroides uniformis atcc 8492
26. 109 28.3% 120 143 134.9 1.5 4a18:N * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
27. " " " " " "  = 4a19:N *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
28. " " " " " "  = 4a1b:N *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
29. " " " " " "  = 4a1d:N *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
30. 105 27.3% 121 135 131.5 2.4 3j3b:Z Structure of the human 60s ribosomal proteins
31. 87 44.8% 29 99 120.8 9.4 3iz5:a * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
32. " " " " " "  = 3izr:a *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
33. 87 44.8% 29 136 118.8 12 3j61:Z Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
34. 86 29.8% 47 159 116.6 16 2xnf:A The mediator med25 activator interaction domain: structure a cooperative binding of vp16 subdomains
35. 86 29.8% 47 161 116.5 16 2l23:A Nmr structure of the acid (activator interacting domain) of mediator med25 protein
36. 86 29.8% 47 163 116.4 17 2l6u:A Solution nmr structure of med25(391-543) comprising the acti interacting domain (acid) of human mediator subuniti 25. No structural genomics consortium target hr6188a
37. 86 29.8% 47 166 116.3 17 2ky6:A Structure of arc92vbd/med25acid

Number of sequences: 37

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 86 25.7% 105 197 115.2 19 2e9x:D The crystal structure of human gins core complex
2. 86 25.7% 105 196 115.2 19 2q9q:B The crystal structure of full length human gins complex
3. 84 25.7% 105 161 113.9 23 2eho:A Crystal structure of human gins complex
4. 80 29.5% 78 77 113.5 24 4adx:7 The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
5. 84 25.7% 105 190 112.9 26 2eho:E Crystal structure of human gins complex
6. 81 22.9% 118 135 111.3 32 3u5e:Z * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
7. " " " " " "  = 3u5i:Z *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
8. " " " " " "  = 4b6a:Z *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
9. " " " " " "  = 4byn:Z *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
10. " " " " " "  = 4byu:Z *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
11. 80 25.0% 92 124 110.5 35 1k78:A * Pax5(1-149)+ets-1(331-440)+DNA
12. " " " " " "  = 1mdm:A *
Inhibited fragment of ets-1 and paired domain of pax5 bound to DNA
13. 86 25.5% 153 465 109.8 39 2du3:B Crystal structure of archaeoglobus fulgidus o-phosphoseryl- tRNA synthetase complexed with trnacys and o-phosphoserine
14. 86 25.5% 153 466 109.7 39 2du4:A Crystal structure of archaeoglobus fulgidus o-phosphoseryl- tRNA synthetase complexed with trnacys
15. 83 22.3% 112 259 109.7 39 2xzm:W * Crystal structure of the eukaryotic 40s ribosomal subunit in complex with initiation factor 1. This file contains the 40s subunit and initiation factor for molecule 1
16. " " " " " "  = 2xzn:W *
Crystal structure of the eukaryotic 40s ribosomal subunit in complex with initiation factor 1. This file contains the 40s subunit and initiation factor for molecule 2
17. " " " " " "  = 4bpe:W *
The crystal structure of the eukaryotic 40s ribosomal subuni complex with eif1 and eif1a - complex 1
18. " " " " " "  = 4bpn:W *
The crystal structure of the eukaryotic 40s ribosomal subuni complex with eif1 and eif1a - complex 2
19. " " " " " "  = 4bpo:W *
The crystal structure of the eukaryotic 40s ribosomal subuni complex with eif1 and eif1a - complex 3
20. " " " " " "  = 4bpp:W *
The crystal structure of the eukaryotic 40s ribosomal subuni complex with eif1 and eif1a - complex 4
21. 86 25.5% 153 534 108.9 43 2du3:A Crystal structure of archaeoglobus fulgidus o-phosphoseryl- tRNA synthetase complexed with trnacys and o-phosphoserine
22. 84 28.7% 108 412 108.0 49 3gty:X Promiscuous substrate recognition in folding and assembly ac of the trigger factor chaperone
23. 82 21.7% 115 285 107.8 50 4mzu:A Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans

Number of sequences: 23

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer