spacer
spacer

SAS results for UniProt accession no. Q5I7K5

Sequence annotated by structure
>

Key:
Sec. struc: By homology
  Helix Strand  

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

 

FASTA alignment for UniProt accession no. Q5I7K5 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q5I7K5 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 24 unique sequences (including 8 consensus sequences) giving 36 sequence matches in all. The 4 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q5I7K5 -----------------------------------------------------------------   Ribosomal protein P1 OS=Triticum aestivum PE=1 SV=1
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
2lbf:A -----------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
4beh:B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
3jyw:M vvidgkghlvgrlasvvakqllngqkivvvraeelnisgeffrnklkyhdflrkatafnktrgpf   Structure of the 60s proteins for eukaryotic ribosome based  ...
2zkr:g -----------------------------------------------------------------   Structure of a mammalian ribosomal 60s subunit within an  ...
3mq2:A -----------------------------------------------------------------   Crystal structure of 16s rrna methyltranferase kamb
1dd3:A*-----------------------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
3izc:v*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
2i0k:A ----------aplptppnfpndialfqqayqnwskeimldatwvcspktpqdvvrlanwahehdy   Cholesterol oxidase from brevibacterium sterolicum- his121al
1i19:A ---------vaplptppnfpndialfqqayqnwskeimldatwvcspktpqdvvrlanwahehdy   Crystal structure of cholesterol oxidase from b.Sterolicum
2gya:3*-----------------------------------------------------------------×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*-----------------------------------------------------------------×2 Nmr structure of l7 dimer from e.Coli
3t0n:A*-----------------------------------------------------------------×2 Crystal structure of twin-arginine translocation pathway  ...
4eyg:A*-----------------------------------------------------------------×2 Crystal structure of solute binding protein of abc  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q5I7K5 -----------------msssevactlaalilhddgipi-tsekiatvvkaagikve-aywpalf   Ribosomal protein P1 OS=Triticum aestivum PE=1 SV=1
4beh:A ----------------masvselaciysalilhddevtv-tedkinalikaagvnve-pfwpglf   Solution structure of human ribosomal protein p1.P2 heterodi
3iz5:t*----------------------vactlaalilhddgipi-tsekiatvvkaagikve-aywpalf×3 Localization of the large subunit ribosomal proteins into a  ...
2lbf:A ----------------masvselaciysalilhddevtv-tedkinalikaagvnve-pfwpglf   Solution structure of the dimerization domain of human  ...
3j3b:s ----------------------laciysalilhddevtv-tedkinalikaagvnve-pfwpglf   Structure of the human 60s ribosomal proteins
4beh:B ------------------amryvasylla-alggnssp--sakdikkildsvgiead-ddrlnkv   Solution structure of human ribosomal protein p1.P2 heterodi
3izc:t*----------------------salsyaaliladseiei-sseklltltnaanvpde-niwadif×2 Localization of the large subunit ribosomal proteins into a  ...
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
3a1y:A ----------------------meyvyaalllhsvgkei-neenlkavlqaagvepeearikalv   The structure of archaeal ribosomal stalk p1/p0 complex
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
3jyw:M hfrapsrifykalrgmvshktargkaalerlkvfegipp-pydkkkrvvvpqalrvl-rlkpgrk   Structure of the 60s proteins for eukaryotic ribosome based  ...
2zkr:g -----------------------------------------------------------------   Structure of a mammalian ribosomal 60s subunit within an  ...
3mq2:A -----------------------------------------------mrrvvgkrvq-efsdaef   Crystal structure of 16s rrna methyltranferase kamb
1dd3:A*----------------------------------------------------mtide-iieaiek×5 Crystal structure of ribosomal protein l12 from thermotoga m
3izc:v*----------------------mkylaaylllnaagntp-datkikailesvgieie-dekvssv×2 Localization of the large subunit ribosomal proteins into a  ...
2i0k:A kirprgamagwtpltvekganvekviladtmthlngitvntggpvatvtagagasie-aivtelq   Cholesterol oxidase from brevibacterium sterolicum- his121al
1i19:A kirprgamhgwtpltvekganvekviladtmthlngitvntggpvatvtagagasie-aivtelq   Crystal structure of cholesterol oxidase from b.Sterolicum
2gya:3*--------------------------------------------------------i-tkdqiie×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*-------------------------------------------------------si-tkdqiie×2 Nmr structure of l7 dimer from e.Coli
3t0n:A*aedtfkvglivpmtggqastgkqidnaiklyikkhgdtv-agkkievilkd-----d-aaipdnt×2 Crystal structure of twin-arginine translocation pathway  ...
4eyg:A*-edtfkvglivpmtggqastgkqidnaiklyikkhgdtv-agkkievilkd-----d-aaipdnt×2 Crystal structure of solute binding protein of abc  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q5I7K5 akllekrsvd-dlil-------svgsggggapaaa--a-aapaag-----ga-a-aaeekkeekk   Ribosomal protein P1 OS=Triticum aestivum PE=1 SV=1
4beh:A akalanvnig-slic-------nvgaggp-apaag--a-a-paggpapstaa-a-paeekkveak   Solution structure of human ribosomal protein p1.P2 heterodi
3iz5:t*akllekrsvd-dlil-------svg----------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
2lbf:A akalanvnig-slic-------nvgaggpa-----------------------------------   Solution structure of the dimerization domain of human  ...
3j3b:s akalanvnig-slic-------nv-----------------------------------------   Structure of the human 60s ribosomal proteins
4beh:B iselngknie-dviaqgigklasvpaggavavsaapgs-aapaag-----sapa-aaeekkdekk   Solution structure of human ribosomal protein p1.P2 heterodi
3izc:t*akaldgqnlk-dllv-------nfs----------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
3a1y:A aal-egvnid-evie-------kaa----------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
3jyw:M yttlgklst-------------svgwkaaaaaaaa--a-aaaaaa-----aa-a-aaaaaaaaaa   Structure of the 60s proteins for eukaryotic ribosome based  ...
2zkr:g ------laek-vkaf-------ladpsafvaaapv--a-aattaa-----pa-a-aaapakveak   Structure of a mammalian ribosomal 60s subunit within an  ...
3mq2:A eql--rsqyd-dvvl-------dvgtgdgkhpykv--arqnpsrl-----vv-a-ldadksrmek   Crystal structure of 16s rrna methyltranferase kamb
1dd3:A*ltvselaelv-kkle-------dkfgvtaaapvav--a-aapvag-----aa-agaaqeektefd×5 Crystal structure of ribosomal protein l12 from thermotoga m
3izc:v*lsalegksvd-elit-------egn----------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
2i0k:A khdlgwanlpapgvl-------sig-galavnahg--a-alpavg-----qt-t-lpghtygsls   Cholesterol oxidase from brevibacterium sterolicum- his121al
1i19:A khdlgwanlpapgvl-------sig-galavnahg--a-alpavg-----qt-t-lpghtygsls   Crystal structure of cholesterol oxidase from b.Sterolicum
2gya:3*avaamsvmdv-veli-------sameekfgvsaaa--a-vavaag-----pv-e-aaeektefdv×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*avaamsvmdv-veli-------sameekfgvsaaa--a-vavaag-----pv-e-aaeektefdv×2 Nmr structure of l7 dimer from e.Coli
3t0n:A*krlaqelivn-dkv--------nviagfgitpaal--a-aaplat-----qa-k-vpeivmaagt×2 Crystal structure of twin-arginine translocation pathway  ...
4eyg:A*krlaqelivn-dkv--------nviagfgitpaal--a-aaplat-----qa-k-vpeivmaagt×2 Crystal structure of solute binding protein of abc  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q5I7K5 eeakeesdddmgfslfd------------------------------------------------   Ribosomal protein P1 OS=Triticum aestivum PE=1 SV=1
4beh:A keeseesdddmgfglfd------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
2lbf:A -----------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
4beh:B ees-eesdddmgfglfd------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
1s4j:A ----eesdddmgfglfd------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
1s4h:A ----eeadddmgfglfd------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
3jyw:M aaaaaaaa---------------------------------------------------------   Structure of the 60s proteins for eukaryotic ribosome based  ...
2zkr:g ees-eesd---------------------------------------------------------   Structure of a mammalian ribosomal 60s subunit within an  ...
3mq2:A isakaaakpakgglpnllylwataerlpplsgvgelhvlmpwgsllrgvlgsspemlrgmaavcr   Crystal structure of 16s rrna methyltranferase kamb
1dd3:A*vvlksfgqnkiqvikvvreitglglkeakdlvekagspdaviksgvskeeaeeikkkleeagaev×5 Crystal structure of ribosomal protein l12 from thermotoga m
3izc:v*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
2i0k:A nlvteltavvwngttyaletyqrndpritplltnlgrcfltsvtmqagpnfrqrcqsytdipwre   Cholesterol oxidase from brevibacterium sterolicum- his121al
1i19:A nlvteltavvwngttyaletyqrndpritplltnlgrcfltsvtmqagpnfrqrcqsytdipwre   Crystal structure of cholesterol oxidase from b.Sterolicum
2gya:3*ilkaagankvavikavrgatglglkeakdlvesapaalkegvskddaealkkaleeagaevevk-×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*ilkaagankvavikavrgatglglkeakdlvesapaalkegvskddaealkkaleeagaevevk-×2 Nmr structure of l7 dimer from e.Coli
3t0n:A*siiterspyivrtsftlaqssiiigdwaakngikkvatltsdyapgndalaffkerftagggeiv×2 Crystal structure of twin-arginine translocation pathway  ...
4eyg:A*siiterspyivrtsftlaqssiiigdwaakngikkvatltsdyapgndalaffkerftagggeiv×2 Crystal structure of solute binding protein of abc  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q5I7K5 -----------------------------------------------------------------   Ribosomal protein P1 OS=Triticum aestivum PE=1 SV=1
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
2lbf:A -----------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
4beh:B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
3jyw:M -----------------------------------------------------------------   Structure of the 60s proteins for eukaryotic ribosome based  ...
2zkr:g -----------------------------------------------------------------   Structure of a mammalian ribosomal 60s subunit within an  ...
3mq2:A pgasflvalnlhawrpsvpevgehpeptpdsadewlapryaeagwkladcrylepeevagletsw   Crystal structure of 16s rrna methyltranferase kamb
1dd3:A*elk--------------------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
3izc:v*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
2i0k:A lfapkgadgrtfekfvaesggaeaiwypftekpwmkvwtvsgkppqarevsgpynyifsdnlpep   Cholesterol oxidase from brevibacterium sterolicum- his121al
1i19:A lfapkgadgrtfekfvaesggaeaiwypftekpwmkvwtvspslvgkppqarevsgpynyifsdn   Crystal structure of cholesterol oxidase from b.Sterolicum
2gya:3*-----------------------------------------------------------------×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*-----------------------------------------------------------------×2 Nmr structure of l7 dimer from e.Coli
3t0n:A*eeikvplanpdfapflqrmkdakpdamfvfvpagqggnfmkqfaergldksgikvigpgdvmddd×2 Crystal structure of twin-arginine translocation pathway  ...
4eyg:A*eeikvplanpdfapflqrmkdakpdamfvfvpagqggnfmkqfaergldksgikvigpgdvmddd×2 Crystal structure of solute binding protein of abc  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q5I7K5 -----------------------------------------------------------------   Ribosomal protein P1 OS=Triticum aestivum PE=1 SV=1
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
2lbf:A -----------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
4beh:B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
3jyw:M -----------------------------------------------------------------   Structure of the 60s proteins for eukaryotic ribosome based  ...
2zkr:g -----------------------------------------------------------------   Structure of a mammalian ribosomal 60s subunit within an  ...
3mq2:A trrlhssrdrfdvlaltgtisp-------------------------------------------   Crystal structure of 16s rrna methyltranferase kamb
1dd3:A*-----------------------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
3izc:v*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
2i0k:A itdmigainagnpgiaplfgpamyeitklglaatnandiwgwskdvqfyikattlrltegggavv   Cholesterol oxidase from brevibacterium sterolicum- his121al
1i19:A lpepitdmigainagnpgiaplfgpamyeitklglaatnandiwgwskdvqfyikattlrltegg   Crystal structure of cholesterol oxidase from b.Sterolicum
2gya:3*-----------------------------------------------------------------×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*-----------------------------------------------------------------×2 Nmr structure of l7 dimer from e.Coli
3t0n:A*llnsmgdaalgvvtahmysaahpsamnkefvaaykkefgqrpgfmavggydgihlvfealkktgg×2 Crystal structure of twin-arginine translocation pathway  ...
4eyg:A*llnsmgdaalgvvtahmysaahpsamnkefvaaykkefgqrpgfmavggydgihlvfealkktgg×2 Crystal structure of solute binding protein of abc  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q5I7K5 -----------------------------------------------------------------   Ribosomal protein P1 OS=Triticum aestivum PE=1 SV=1
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
2lbf:A -----------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
4beh:B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
3jyw:M -----------------------------------------------------------------   Structure of the 60s proteins for eukaryotic ribosome based  ...
2zkr:g -----------------------------------------------------------------   Structure of a mammalian ribosomal 60s subunit within an  ...
3mq2:A -----------------------------------------------------------------   Crystal structure of 16s rrna methyltranferase kamb
1dd3:A*-----------------------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
3izc:v*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
2i0k:A tsraniatvindftewfheriefyrakgefplngpveirccgldqaadvkvpsvgpptisatrpr   Cholesterol oxidase from brevibacterium sterolicum- his121al
1i19:A gavvtsraniatvindftewfheriefyrakgefplngpveirccgldqaadvkvpsvgpptisa   Crystal structure of cholesterol oxidase from b.Sterolicum
2gya:3*-----------------------------------------------------------------×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*-----------------------------------------------------------------×2 Nmr structure of l7 dimer from e.Coli
3t0n:A*kadgdsliaamkgmkwesprgpisidpetrdivqniyirkvekvdgelyniefakfdavkdpgkt×2 Crystal structure of twin-arginine translocation pathway  ...
4eyg:A*kadgdsliaamkgmkwesprgpisidpetrdivqniyirkvekvdgelyniefakfdavkdpgkt×2 Crystal structure of solute binding protein of abc  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q5I7K5 -----------------------------------------------------------------   Ribosomal protein P1 OS=Triticum aestivum PE=1 SV=1
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
2lbf:A -----------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
4beh:B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
3jyw:M -----------------------------------------------------------------   Structure of the 60s proteins for eukaryotic ribosome based  ...
2zkr:g -----------------------------------------------------------------   Structure of a mammalian ribosomal 60s subunit within an  ...
3mq2:A -----------------------------------------------------------------   Crystal structure of 16s rrna methyltranferase kamb
1dd3:A*-----------------------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
3izc:v*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
2i0k:A pdhpdwdvaiwlnvlgvpgtpgmfefyremeqwmrshynnddatfrpewskgwafgpdpytdndi   Cholesterol oxidase from brevibacterium sterolicum- his121al
1i19:A trprpdhpdwdvaiwlnvlgvpgtpgmfefyremeqwmrshynnddatfrpewskgwafgpdpyt   Crystal structure of cholesterol oxidase from b.Sterolicum
2gya:3*-----------------------------------------------------------------×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*-----------------------------------------------------------------×2 Nmr structure of l7 dimer from e.Coli
3t0n:A*-----------------------------------------------------------------×2 Crystal structure of twin-arginine translocation pathway  ...
4eyg:A*-----------------------------------------------------------------×2 Crystal structure of solute binding protein of abc  ...

                5         5         5         5         
                3         4         5         6         
       1234567890123456789012345678901234567890123456789                   Protein name
       ---------+---------+---------+---------+---------                   ------------
Q5I7K5 -------------------------------------------------                   Ribosomal protein P1 OS=Triticum aestivum PE=1 SV=1
4beh:A -------------------------------------------------                   Solution structure of human ribosomal protein p1.P2 heterodi
3iz5:t*-------------------------------------------------                ×3 Localization of the large subunit ribosomal proteins into a  ...
2lbf:A -------------------------------------------------                   Solution structure of the dimerization domain of human  ...
3j3b:s -------------------------------------------------                   Structure of the human 60s ribosomal proteins
4beh:B -------------------------------------------------                   Solution structure of human ribosomal protein p1.P2 heterodi
3izc:t*-------------------------------------------------                ×2 Localization of the large subunit ribosomal proteins into a  ...
1s4j:A -------------------------------------------------                   Nmr structure of cross-reactive peptides from homo sapiens
3a1y:A -------------------------------------------------                   The structure of archaeal ribosomal stalk p1/p0 complex
1s4h:A -------------------------------------------------                   Nmr structure of cross-reactive peptides from l.  ...
3jyw:M -------------------------------------------------                   Structure of the 60s proteins for eukaryotic ribosome based  ...
2zkr:g -------------------------------------------------                   Structure of a mammalian ribosomal 60s subunit within an  ...
3mq2:A -------------------------------------------------                   Crystal structure of 16s rrna methyltranferase kamb
1dd3:A*-------------------------------------------------                ×5 Crystal structure of ribosomal protein l12 from thermotoga m
3izc:v*-------------------------------------------------                ×2 Localization of the large subunit ribosomal proteins into a  ...
2i0k:A vtnkmratyiegvpttenwdtararynqidphrvftngfmdkllp----                   Cholesterol oxidase from brevibacterium sterolicum- his121al
1i19:A dndivtnkmratyiegvpttenwdtararynqidphrvftngfmdkllp                   Crystal structure of cholesterol oxidase from b.Sterolicum
2gya:3*-------------------------------------------------                ×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*-------------------------------------------------                ×2 Nmr structure of l7 dimer from e.Coli
3t0n:A*-------------------------------------------------                ×2 Crystal structure of twin-arginine translocation pathway  ...
4eyg:A*-------------------------------------------------                ×2 Crystal structure of solute binding protein of abc  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q5I7K5. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 110 - - Q5I7K5 Ribosomal protein P1 OS=Triticum aestivum PE=1 SV=1
2. 385 57.0% 114 114 498.0 9.1e-21 4beh:A Solution structure of human ribosomal protein p1.P2 heterodi
3. 360 100.0% 58 58 471.2 2.9e-19 3iz5:t * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
4. " " " " " "  = 3izr:t *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
5. " " " " " "  = 3j61:u *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
6. 236 52.3% 65 69 313.8 1.7e-10 2lbf:A Solution structure of the dimerization domain of human ribos protein p1/p2 heterodimer
7. 197 49.1% 57 57 265.9 7.7e-08 3j3b:s Structure of the human 60s ribosomal proteins
8. 205 43.5% 115 116 261.1 1.4e-07 4beh:B Solution structure of human ribosomal protein p1.P2 heterodi
9. 134 41.8% 55 58 186.5 0.0021 3izc:t * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
10. " " " " " "  = 3izs:t *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
11. 85 92.3% 13 13 134.9 1.5 1s4j:A Nmr structure of cross-reactive peptides from homo sapiens
12. 93 42.0% 50 58 134.8 1.6 3a1y:A The structure of archaeal ribosomal stalk p1/p0 complex
13. 81 84.6% 13 13 129.9 2.9 1s4h:A Nmr structure of cross-reactive peptides from l. Braziliensis
14. 92 39.7% 68 178 125.9 4.9 3jyw:M Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
15. 82 57.6% 33 48 122.2 7.8 2zkr:g Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
16. 90 28.0% 75 215 122.1 8 3mq2:A Crystal structure of 16s rrna methyltranferase kamb
17. 86 66.7% 24 128 120.6 9.7 1dd3:A * Crystal structure of ribosomal protein l12 from thermotoga m
18. " " " " " "  = 1dd4:A *
Crystal structure of ribosomal protein l12 from thermotoga maritim
19. " " " " " "  = 1giy:I *
Crystal structure of the ribosome at 5.5 a resolution. This file, 1giy, contains the 50s ribosome subunit. The 30s ribosome subunit, three tRNA, and mRNA molecules are in the file 1gix
20. " " " " " "  = 1l1u:3 *
Ternary complex docked in the decoding site of the 30s ribosomal subunit
21. " " " " " "  = 1yl3:I *
Crystal structure of 70s ribosome with thrs operator and trn subunit. The coordinates for the small subunit are in the p 1yl4.
22. 78 32.7% 49 58 115.9 18 3izc:v * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
23. " " " " " "  = 3izs:v *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
24. 87 34.2% 73 536 112.1 29 2i0k:A Cholesterol oxidase from brevibacterium sterolicum- his121al
25. 87 34.2% 73 541 112.0 29 1i19:A Crystal structure of cholesterol oxidase from b.Sterolicum
26. 77 65.2% 23 119 109.8 39 2gya:3 * Structure of the 50s subunit of a pre-translocational e. Coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-em map emd-1056
27. " " " " " "  = 2gyc:3 *
Structure of the 50s subunit of a secm-stalled e. Coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-em map emd-1143
28. 77 65.2% 23 120 109.7 39 1rqu:A * Nmr structure of l7 dimer from e.Coli
29. " " " " " "  = 1rqv:A *
Spatial model of l7 dimer from e.Coli with one hinge region in helical state
30. 83 31.1% 74 364 109.7 39 3t0n:A * Crystal structure of twin-arginine translocation pathway sig rhodopseudomonas palustris bisb5
31. " " " " " "  = 4ey3:A *
Crystal structure of solute binding protein of abc transport complex with p-hydroxybenzoic acid
32. 83 31.1% 74 363 109.7 39 4eyg:A * Crystal structure of solute binding protein of abc transport rhodopseudomonas palustris bisb5 in complex with vanillic a
33. " " " " " "  = 4eyk:A *
Crystal structure of solute binding protein of abc transport rhodopseudomonas palustris bisb5 in complex with 3,4-dihydr benzoic acid

Number of sequences: 33

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 63 81.8% 11 11 108.4 46 3sge:K Crystal structure of mab 17.2 in complex with r13 peptide
2. 78 47.1% 34 176 108.3 46 3jyw:P Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
3. 81 34.5% 58 312 108.2 47 3i4c:B Crystal structure of sulfolobus solfataricus adh(ssadh) double mutant (w95l,n249y)
4. 81 32.9% 82 318 108.1 48 3p7m:A Structure of putative lactate dehydrogenase from francisella tularensis subsp. Tularensis schu s4

Number of sequences: 4

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer