spacer
spacer

SAS results for UniProt accession no. Q5I7K7

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. Q5I7K7 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q5I7K7 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 23 unique sequences (including 10 consensus sequences) giving 102 sequence matches in all. The 3 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q5I7K7 -----------------------------------------------------------------    Ribosomal protein L39 OS=Triticum aestivum PE=1 SV=1
3iz5:o*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:l -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
2zkr:3 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j39:l -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3izc:o*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3jyw:1*-----------------------------------------------------------------×3  Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:l*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3zf7:q -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
4a18:B*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2ww9:O*-----------------------------------------------------------------×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
1vvk:f*-----------------------------------------------------------------×2  Structure of the methanococcus jannaschii  ...
1yj9:2*-----------------------------------------------------------------×2  Crystal structure of the mutant 50s ribosomal subunit of  ...
1s72:2*-----------------------------------------------------------------×45 Refined crystal structure of the haloarcula marismortui  ...
1jj2:1*-----------------------------------------------------------------×20 Fully refined crystal structure of the haloarcula  ...
4j29:A -----------------------------------------------------------------    Crystal structure of engineered protein. Northeast  ...
3iml:D ---------ylftsesvseghpdkvadqisdaildailaqdkysrvaaetlcntglvvlageitt    Crystal structure of s-adenosylmethionine synthetase from  ...
  " :C dylftsesvseghpdkvadqisdaildailaqdkysrvaaetlcntglvvlageitttanidyiq    Crystal structure of s-adenosylmethionine synthetase from  ...
2jeu:A -----------------------------------------------------------------    Transcription activator structure reveals redox control of  ...
2jex:A -----------------------------------------------------------------    Transcription activator structure reveals redox control of  ...
2zkr:t -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q5I7K7 -----------------------------------------------mpshktfrikqklakkqr    Ribosomal protein L39 OS=Triticum aestivum PE=1 SV=1
3iz5:o*-----------------------------------------------mpshktfrikqklakkqr×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:l ------------------------------------------------sshktfrikrflakkqk    Structure of the human 60s ribosomal proteins
2zkr:3 -------------------------------------------------shktfrikrflakkqk    Structure of a mammalian ribosomal 60s subunit within an  ...
3j39:l ------------------------------------------------aahksfrikqklakklk    Structure of the d. Melanogaster 60s ribosomal proteins
3izc:o*-----------------------------------------------maaqksfrikqkmakakk×2  Localization of the large subunit ribosomal proteins into a  ...
3jyw:1*-------------------------------------------------aqksfrikqkmakakk×3  Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:l*------------------------------------------------aaqksfrikqkmakakk×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3zf7:q ------------------------------------------------grfkplaikkkyakklk    High-resolution cryo-electron microscopy structure of the  ...
4a18:B*------------------------------------------------ganktlnmkkrfgrkik×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2ww9:O*-----------------------------------------------maaqksfrikqkmakakk×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
1vvk:f*-----------------------------------------------marnkplakklrlakalk×2  Structure of the methanococcus jannaschii  ...
1yj9:2*-------------------------------------------------gkkskatkkrlakldn×2  Crystal structure of the mutant 50s ribosomal subunit of  ...
1s72:2*-------------------------------------------------gkkskatkkrlakldn×45 Refined crystal structure of the haloarcula marismortui  ...
1jj2:1*-------------------------------------------------gkkskatkkrlakldn×20 Fully refined crystal structure of the haloarcula  ...
4j29:A ------------------tvvivvsrderileellevvlksdpnvktvrtddkekvkeeiekark    Crystal structure of engineered protein. Northeast  ...
3iml:D tanidyiqiardtikrigygcavlvaydkqqglmfgyacdetpelmplpihlshrlverqanlrr    Crystal structure of s-adenosylmethionine synthetase from  ...
  " :C iardtikrigygcavlvaydkqsldqgagdqglmfgyacdetpelmplpihlshrlverqanlrr    Crystal structure of s-adenosylmethionine synthetase from  ...
2jeu:A ------------------------------------------tacerlhvaqetqmqliekssdk    Transcription activator structure reveals redox control of  ...
2jex:A ------------------------------------------tacerlhvaqetqmqliekssdk    Transcription activator structure reveals redox control of  ...
2zkr:t ----------------------------------tsdrsknrkrhfnapshirrkimsslskelr    Structure of a mammalian ribosomal 60s subunit within an  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q5I7K7 q-nrpipywir--mrtdntirynakrrhwrrtklgf-----------------------------    Ribosomal protein L39 OS=Triticum aestivum PE=1 SV=1
3iz5:o*q-nrpipywir--mrtdntirynakrrhwrrtklgf-----------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:l q-nrpipqwir--mktgnkirynskrrhwrrtklgl-----------------------------    Structure of the human 60s ribosomal proteins
2zkr:3 q-nrpipqwir--mktgnkirynskrrhwrrtklg------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j39:l q-nrsvpqwvr--lrtgntirynakrrhwrrtklkl-----------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3izc:o*q-nrplpqwir--lrtnntirynakrrnwrrtkmni-----------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3jyw:1*q-nrplpqwir--lrtnntirynakrrnwrrtkmn------------------------------×3  Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:l*q-nrplpqwir--lrtnntirynakrrnwrrtkmni-----------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3zf7:q q-nrpvpywir--lrtgnrikwnekrrhwrrtklhy-----------------------------    High-resolution cryo-electron microscopy structure of the  ...
4a18:B*q-nrplpnwyr--yksdtnirynskrrnwrrtklkiy----------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2ww9:O*q-nrplpqwir--lrtnntiry-------------------------------------------×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
1vvk:f*q-nrrvpvwvi--vktnrrvlthpkrrywrrtklke-----------------------------×2  Structure of the methanococcus jannaschii  ...
1yj9:2*q-nsrvpawvm--lktdrevqrnhkrrhwrrndtde-----------------------------×2  Crystal structure of the mutant 50s ribosomal subunit of  ...
1s72:2*q-nsrvpawvm--lktd---rrnhkrrhwrrndtde-----------------------------×45 Refined crystal structure of the haloarcula marismortui  ...
1jj2:1*q-nsrvpawvm--lktd---ernhkrrhwrrndtde-----------------------------×20 Fully refined crystal structure of the haloarcula  ...
4j29:A q-grpivifir--gateevvrdiveyaqkeglrvlvimvdqdqeeleriyeqlkkdgvdvrvtdn    Crystal structure of engineered protein. Northeast  ...
3iml:D d-gr-lp-wlrpdaksqvtvryvdgkphsidtvvlstqhapeidlpalreavieevikptlpadl    Crystal structure of s-adenosylmethionine synthetase from  ...
  " :C d-gr-lp-wlrpdaksqvtvryvdgkphsidtvvlstqhapeidlpalreavieevikptlpadl    Crystal structure of s-adenosylmethionine synthetase from  ...
2jeu:A l-qdhilywta--vrtentllyaarkkgvtvlghcrvphsvvcqerakqaiemqlslqelsktef    Transcription activator structure reveals redox control of  ...
2jex:A l-qdhilywta--vrtentllyaarkkgvtvlghcrvphsvvcqerakqaiemqlslqelsktef    Transcription activator structure reveals redox control of  ...
2zkr:t qknvsmp------irkddevq--vvrghykgqqigkvvqvyrkkyviyiervqrekangttvhvg    Structure of a mammalian ribosomal 60s subunit within an  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q5I7K7 -----------------------------------------------------------------    Ribosomal protein L39 OS=Triticum aestivum PE=1 SV=1
3iz5:o*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:l -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
2zkr:3 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j39:l -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3izc:o*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3jyw:1*-----------------------------------------------------------------×3  Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:l*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3zf7:q -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
4a18:B*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2ww9:O*-----------------------------------------------------------------×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
1vvk:f*-----------------------------------------------------------------×2  Structure of the methanococcus jannaschii  ...
1yj9:2*-----------------------------------------------------------------×2  Crystal structure of the mutant 50s ribosomal subunit of  ...
1s72:2*-----------------------------------------------------------------×45 Refined crystal structure of the haloarcula marismortui  ...
1jj2:1*-----------------------------------------------------------------×20 Fully refined crystal structure of the haloarcula  ...
4j29:A edeakkrlkellekvleh-----------------------------------------------    Crystal structure of engineered protein. Northeast  ...
3iml:D ikgdikflvnptgrfviggpqgdcgltgrkiivdtyggaaphgggafsgkdpskvdrsaayagry    Crystal structure of s-adenosylmethionine synthetase from  ...
  " :C ikgdikflvnptgrfviggpqgdcgltgrkiivdtyggaaphgggafsgkdpskvdrsaayagry    Crystal structure of s-adenosylmethionine synthetase from  ...
2jeu:A gdepwslldtswdrymsepkrcfkkgarvvevefdgnasntnwytvysnlymrtedgwqlakaga    Transcription activator structure reveals redox control of  ...
2jex:A gdepwslldtswdrymsepkrcfkkgarvvevefdgnasntnwytvysnlymrtedgwqlakaga    Transcription activator structure reveals redox control of  ...
2zkr:t ihpskvvitrkldkdrkkiler-------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q5I7K7 -----------------------------------------------------------------    Ribosomal protein L39 OS=Triticum aestivum PE=1 SV=1
3iz5:o*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:l -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
2zkr:3 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j39:l -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3izc:o*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3jyw:1*-----------------------------------------------------------------×3  Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:l*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3zf7:q -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
4a18:B*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2ww9:O*-----------------------------------------------------------------×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
1vvk:f*-----------------------------------------------------------------×2  Structure of the methanococcus jannaschii  ...
1yj9:2*-----------------------------------------------------------------×2  Crystal structure of the mutant 50s ribosomal subunit of  ...
1s72:2*-----------------------------------------------------------------×45 Refined crystal structure of the haloarcula marismortui  ...
1jj2:1*-----------------------------------------------------------------×20 Fully refined crystal structure of the haloarcula  ...
4j29:A -----------------------------------------------------------------    Crystal structure of engineered protein. Northeast  ...
3iml:D vaknivaaglasraliqvsyafdlrpkgiiqmldllrpiyektaayghfgreepefsweaadk--    Crystal structure of s-adenosylmethionine synthetase from  ...
  " :C vaknivaaglasraliqvsyaigvaeptsvmvntftitklvrehfdlrpkgiiqmldllrpiyek    Crystal structure of s-adenosylmethionine synthetase from  ...
2jeu:A dgtglyyctmagagriyysrfgdeaarfsttghysvrdqdrvyagvs------------------    Transcription activator structure reveals redox control of  ...
2jex:A dgtglyyctmagagriyysafgdeaarfsttghysvrdqdrvyagvs------------------    Transcription activator structure reveals redox control of  ...
2zkr:t -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...

           3         3      
           3         4      
       678901234567890123456                                                Protein name
       ----+---------+------                                                ------------
Q5I7K7 ---------------------                                                Ribosomal protein L39 OS=Triticum aestivum PE=1 SV=1
3iz5:o*---------------------                                            ×3  Localization of the large subunit ribosomal proteins into a  ...
3j3b:l ---------------------                                                Structure of the human 60s ribosomal proteins
2zkr:3 ---------------------                                                Structure of a mammalian ribosomal 60s subunit within an  ...
3j39:l ---------------------                                                Structure of the d. Melanogaster 60s ribosomal proteins
3izc:o*---------------------                                            ×2  Localization of the large subunit ribosomal proteins into a  ...
3jyw:1*---------------------                                            ×3  Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:l*---------------------                                            ×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3zf7:q ---------------------                                                High-resolution cryo-electron microscopy structure of the  ...
4a18:B*---------------------                                            ×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2ww9:O*---------------------                                            ×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
1vvk:f*---------------------                                            ×2  Structure of the methanococcus jannaschii  ...
1yj9:2*---------------------                                            ×2  Crystal structure of the mutant 50s ribosomal subunit of  ...
1s72:2*---------------------                                            ×45 Refined crystal structure of the haloarcula marismortui  ...
1jj2:1*---------------------                                            ×20 Fully refined crystal structure of the haloarcula  ...
4j29:A ---------------------                                                Crystal structure of engineered protein. Northeast  ...
3iml:D ---------------------                                                Crystal structure of s-adenosylmethionine synthetase from  ...
  " :C taayghfgreepefsweaadk                                                Crystal structure of s-adenosylmethionine synthetase from  ...
2jeu:A ---------------------                                                Transcription activator structure reveals redox control of  ...
2jex:A ---------------------                                                Transcription activator structure reveals redox control of  ...
2zkr:t ---------------------                                                Structure of a mammalian ribosomal 60s subunit within an  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q5I7K7. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 51 - - Q5I7K7 Ribosomal protein L39 OS=Triticum aestivum PE=1 SV=1
2. 361 100.0% 51 51 548.9 1.3e-23 3iz5:o * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
3. " " " " " "  = 3izr:o *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
4. " " " " " "  = 3j61:l *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
5. 285 81.6% 49 50 437.0 2.3e-17 3j3b:l Structure of the human 60s ribosomal proteins
6. 284 83.3% 48 48 435.7 2.7e-17 2zkr:3 Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
7. 273 78.7% 47 50 419.3 2.2e-16 3j39:l Structure of the d. Melanogaster 60s ribosomal proteins
8. 267 71.4% 49 51 410.4 7e-16 3izc:o * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
9. " " " " " "  = 3izs:o *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
10. 261 72.3% 47 48 401.8 2.1e-15 3jyw:1 * Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
11. " " " " " "  = 3o58:e *
Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
12. " " " " " "  = 3o5h:e *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
13. 261 72.3% 47 50 401.6 2.1e-15 3u5e:l * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
14. " " " " " "  = 3u5i:l *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
15. " " " " " "  = 4b6a:l *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
16. " " " " " "  = 4byn:l *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
17. " " " " " "  = 4byu:l *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
18. 233 66.0% 47 50 360.4 4.3e-13 3zf7:q High-resolution cryo-electron microscopy structure of the tr brucei ribosome
19. 205 53.2% 47 51 319.0 8.6e-11 4a18:B * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
20. " " " " " "  = 4a19:B *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
21. " " " " " "  = 4a1b:B *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
22. " " " " " "  = 4a1d:B *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
23. 191 67.6% 37 37 300.0 9.8e-10 2ww9:O * Cryo-em structure of the active yeast ssh1 complex bound to yeast 80s ribosome
24. " " " " " "  = 2wwa:O *
Cryo-em structure of idle yeast ssh1 complex bound to the yeast 80s ribosome
25. " " " " " "  = 2wwb:O *
Cryo-em structure of the mammalian sec61 complex bound to th actively translating wheat germ 80s ribosome
26. 151 42.9% 49 51 239.4 2.3e-06 1vvk:f * Structure of the methanococcus jannaschii ribosome-secyebeta complex (secyebeta + 50s ribosomal proteins)
27. " " " " " "  = 3j21:f *
Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
28. 148 45.2% 42 49 235.2 4e-06 1yj9:2 * Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
29. " " " " " "  = 4hub:2 *
The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
30. 136 47.6% 42 46 217.8 3.7e-05 1s72:2 * Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
31. " " " " " "  = 1vq4:2 *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
32. " " " " " "  = 1vq5:2 *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1vq6:2 *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
34. " " " " " "  = 1vq7:2 *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
35. " " " " " "  = 1vq8:2 *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
36. " " " " " "  = 1vq9:2 *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
37. " " " " " "  = 1vqk:2 *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
38. " " " " " "  = 1vql:2 *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
39. " " " " " "  = 1vqm:2 *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
40. " " " " " "  = 1vqn:2 *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
41. " " " " " "  = 1vqo:2 *
The structure of ccpmn bound to the large ribosomal subunit marismortui
42. " " " " " "  = 1vqp:2 *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
43. " " " " " "  = 1yhq:2 *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
44. " " " " " "  = 1yi2:2 *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
45. " " " " " "  = 1yij:2 *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
46. " " " " " "  = 1yit:2 *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
47. " " " " " "  = 1yjn:2 *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
48. " " " " " "  = 1yjw:2 *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
49. " " " " " "  = 2otj:2 *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
50. " " " " " "  = 2otl:2 *
Girodazole bound to the large subunit of haloarcula marismor
51. " " " " " "  = 2qa4:2 *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
52. " " " " " "  = 2qex:2 *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
53. " " " " " "  = 3cc2:2 *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
54. " " " " " "  = 3cc4:2 *
Co-crystal structure of anisomycin bound to the 50s ribosoma
55. " " " " " "  = 3cc7:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
56. " " " " " "  = 3cce:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
57. " " " " " "  = 3ccj:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
58. " " " " " "  = 3ccl:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
59. " " " " " "  = 3ccm:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
60. " " " " " "  = 3ccq:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
61. " " " " " "  = 3ccr:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
62. " " " " " "  = 3ccs:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
63. " " " " " "  = 3ccu:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
64. " " " " " "  = 3ccv:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
65. " " " " " "  = 3cd6:2 *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
66. " " " " " "  = 3cma:2 *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
67. " " " " " "  = 3cme:2 *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
68. " " " " " "  = 3cpw:1 *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
69. " " " " " "  = 3g4s:2 *
Co-crystal structure of tiamulin bound to the large ribosoma
70. " " " " " "  = 3g6e:2 *
Co-crystal structure of homoharringtonine bound to the large subunit
71. " " " " " "  = 3g71:2 *
Co-crystal structure of bruceantin bound to the large riboso subunit
72. " " " " " "  = 3i55:2 *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
73. " " " " " "  = 3i56:2 *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
74. " " " " " "  = 4adx:2 *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
75. 129 45.2% 42 46 207.5 0.00014 1jj2:1 * Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
76. " " " " " "  = 1k73:3 *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
77. " " " " " "  = 1k8a:3 *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
78. " " " " " "  = 1k9m:3 *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
79. " " " " " "  = 1kc8:3 *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
80. " " " " " "  = 1kd1:3 *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
81. " " " " " "  = 1kqs:1 *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
82. " " " " " "  = 1m1k:3 *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
83. " " " " " "  = 1m90:3 *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
84. " " " " " "  = 1n8r:3 *
Structure of large ribosomal subunit in complex with virginiamycin m
85. " " " " " "  = 1nji:3 *
Structure of chloramphenicol bound to the 50s ribosomal subunit
86. " " " " " "  = 1q7y:3 *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
87. " " " " " "  = 1q81:3 *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
88. " " " " " "  = 1q82:3 *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
89. " " " " " "  = 1q86:3 *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
90. " " " " " "  = 1qvf:1 *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
91. " " " " " "  = 1qvg:1 *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
92. " " " " " "  = 1w2b:1 *
Trigger factor ribosome binding domain in complex with 50s
93. " " " " " "  = 3cxc:1 *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
94. " " " " " "  = 3ow2:1 *
Crystal structure of enhanced macrolide bound to 50s ribosom
95. 77 34.5% 29 127 125.6 5.1 4j29:A Crystal structure of engineered protein. Northeast structura consortium target or258.
96. 70 28.9% 45 311 110.7 34 3iml:D Crystal structure of s-adenosylmethionine synthetase from bu pseudomallei
97. 70 28.9% 45 343 110.2 37 3iml:C Crystal structure of s-adenosylmethionine synthetase from bu pseudomallei
98. 68 45.0% 20 197 110.1 37 2jeu:A Transcription activator structure reveals redox control of a replication initiation reaction
99. 68 45.0% 20 197 110.1 37 2jex:A Transcription activator structure reveals redox control of a replication initiation reaction
100. 66 30.0% 50 110 110.1 37 2zkr:t Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map

Number of sequences: 100

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 70 28.9% 45 368 109.8 38 3iml:A Crystal structure of s-adenosylmethionine synthetase from bu pseudomallei
2. 61 32.1% 28 31 109.3 41 1ffk:Y Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
3. 67 34.8% 46 216 108.2 48 3zf7:N High-resolution cryo-electron microscopy structure of the tr brucei ribosome

Number of sequences: 3

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer