spacer
spacer

SAS results for UniProt accession no. Q8GVY2

Sequence annotated by structure
>

Key:
Sec. struc: By homology
  Helix Strand  

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

 

FASTA alignment for UniProt accession no. Q8GVY2 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q8GVY2 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 25 unique sequences (including 9 consensus sequences) giving 45 sequence matches in all. The 12 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q8GVY2 -----------------------------------------------------------------   60S ribosomal protein L38, putative, expressed OS=Oryza  ...
3iz5:n*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
3j3b:k -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:k -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:p -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3u5e:k*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:n*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4a18:P*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3pcr:A -----------------------------------------------------------------   Structure of espg-arf6 complex
3pcs:A -----------------------------------------------------------------   Structure of espg-pak2 autoinhibitory ialpha3 helix complex
4fmc:A -----------------------------------------------------------------   Espg-rab1 complex
4fmd:A*-----------------------------------------------------------------×2 Espg-rab1 complex structure at 3.05 a
3q1c:A -----------------------------------------------------------------   Structure of espg protein
4fma:A -----------------------------------------------------------------   Espg structure
2dng:A -----------------------------------------------------------------   Solution structure of RNA binding domain in eukaryotic  ...
1n93:X*klpgkflqytvggsdphpgighekdirqnavalldqsrrdmfhtvtpslvflcllipglhaafvh×2 Crystal structure of the borna disease virus nucleoprotein
3mjk:A -----------------------------------------------------------------   Structure of a growth factor precursor
1pzd:A -----------------------------------------------------------------   Structural identification of a conserved appendage domain  ...
1r4x:A -----------------------------------------------------------------   Crystal structure analys of the gamma-copi appendage domain
1ab0:A -----------------------------------------------------------------   C1g/v32d/f57h mutant of murine adipocyte lipid binding  ...
1adl:A*-----------------------------------------------------------------×2 Adipocyte lipid binding protein complexed with arachidonic  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q8GVY2 -----------------------------------------------------------------   60S ribosomal protein L38, putative, expressed OS=Oryza  ...
3iz5:n*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
3j3b:k -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:k -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:p -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3u5e:k*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:n*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4a18:P*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3pcr:A -----------------------------------------------------------------   Structure of espg-arf6 complex
3pcs:A -----------------------------------------------------------------   Structure of espg-pak2 autoinhibitory ialpha3 helix complex
4fmc:A -----------------------------------------------------------------   Espg-rab1 complex
4fmd:A*-----------------------------------------------------------------×2 Espg-rab1 complex structure at 3.05 a
3q1c:A -----------------------------------------------------------------   Structure of espg protein
4fma:A -----------------------------------------------------------------   Espg structure
2dng:A -----------------------------------------------------------------   Solution structure of RNA binding domain in eukaryotic  ...
1n93:X*ggvpresylstpvtrgeqtvvktakfygekttqrdlteleissifshccslligvvigssskika×2 Crystal structure of the borna disease virus nucleoprotein
3mjk:A -----------------------------------------------------------------   Structure of a growth factor precursor
1pzd:A -----------------------------------------------------------------   Structural identification of a conserved appendage domain  ...
1r4x:A -----------------------------------------------------------------   Crystal structure analys of the gamma-copi appendage domain
1ab0:A -----------------------------------------------------------------   C1g/v32d/f57h mutant of murine adipocyte lipid binding  ...
1adl:A*-----------------------------------------------------------------×2 Adipocyte lipid binding protein complexed with arachidonic  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q8GVY2 -----------------------------------------------------------------   60S ribosomal protein L38, putative, expressed OS=Oryza  ...
3iz5:n*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
3j3b:k -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:k -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:p -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3u5e:k*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:n*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4a18:P*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3pcr:A -------------------------------------------------------------emsc   Structure of espg-arf6 complex
3pcs:A --------------------------------------------------------kkswdemsc   Structure of espg-pak2 autoinhibitory ialpha3 helix complex
4fmc:A -------------------------------------------------------------emsc   Espg-rab1 complex
4fmd:A*-------------------------------------------------------------emsc×2 Espg-rab1 complex structure at 3.05 a
3q1c:A -----------------------------------------------------shmasswdemsc   Structure of espg protein
4fma:A -------------------------------------------------------------emsc   Espg structure
2dng:A -----------------------------------------------------------------   Solution structure of RNA binding domain in eukaryotic  ...
1n93:X*gaeqikkrfktmmaalnrpshgetatllqmfnpheaidwingqpwvgsfvlsllttdfespgkef×2 Crystal structure of the borna disease virus nucleoprotein
3mjk:A -----------------------------------------------------------------   Structure of a growth factor precursor
1pzd:A -----------------------------------------------------------------   Structural identification of a conserved appendage domain  ...
1r4x:A -----------------------------------------------------------------   Crystal structure analys of the gamma-copi appendage domain
1ab0:A ------------------gdafvgtwklvssenfddymkevgvgfatrkdagmakpnmiisvngd   C1g/v32d/f57h mutant of murine adipocyte lipid binding  ...
1adl:A*------------------cdafvgtwklvssenfddymkevgvgfatrkvagmakpnmiisvngd×2 Adipocyte lipid binding protein complexed with arachidonic  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q8GVY2 --------------------------------mpkqiheikdfl-ltarrkdars-----vrikr   60S ribosomal protein L38, putative, expressed OS=Oryza  ...
3iz5:n*--------------------------------mpkqiheikdfl-ltarrkdars-----vrikr×3 Localization of the large subunit ribosomal proteins into a  ...
3j3b:k ---------------------------------prkieeikdfl-ltarrkdaks-----vkikk   Structure of the human 60s ribosomal proteins
3j39:k --------------------------------mpreikevkdfl-nkarrsdara-----vkikk   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:p ---------------------------------preiknlkefl-aicsrkdarc-----vkvkh   High-resolution cryo-electron microscopy structure of the  ...
3u5e:k*---------------------------------areitdikqfl-eltrradvkt-----atvki×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:n*--------------------------------mareitdikqfl-eltrradvkt-----atvki×2 Localization of the large subunit ribosomal proteins into a  ...
4a18:P*---------------------------------pkeitdikkfm-klwqnk--kv-----vyvkt×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3pcr:A aeklfkvlsfglwnptysrserqsfqelltvlepvyplpnelgr-vsarfsdgss-----lrisv   Structure of espg-arf6 complex
3pcs:A aeklfkvlsfglwnptysrserqsfqelltvlepvyplpnelgr-vsarfsdgss-----lrisv   Structure of espg-pak2 autoinhibitory ialpha3 helix complex
4fmc:A aekllkvlsfglwnptysrserqsfqelltvlepvyplpnelgr-vsarfsdgss-----lrisv   Espg-rab1 complex
4fmd:A*aekllkvlsfglwnptysrserqsfqelltvlepvyplpnelgr-vsarfsdgss-----lrisv×2 Espg-rab1 complex structure at 3.05 a
3q1c:A aekllkvlsfglwnptysrserqsfqelltvlepvyplpnelgr-vsarfsdgss-----lrisv   Structure of espg protein
4fma:A aekllkvlsfglwnptysrserqsfqelltvlepvyplpnelgr-vsarfsdgss-----lrisv   Espg structure
2dng:A -----------gssgssgkelpteppytayvgnlpfntvqgdid-aifkdlsirs-----vrlvr   Solution structure of RNA binding domain in eukaryotic  ...
1n93:X*mdqiklvasyaqmttyttikeylaecmdatltipvvayeirdflevsaklkedhadlfpflgair×2 Crystal structure of the borna disease virus nucleoprotein
3mjk:A --------------------eaeiprevierlarsqihsirdl----qrlleids-----vrrkr   Structure of a growth factor precursor
1pzd:A -----------------------kvaatrqeifqeqlaavpefq-glgplfkssp-----epval   Structural identification of a conserved appendage domain  ...
1r4x:A -------------------mhhhhhhmtrqeifqeqlaavpefr-glgplfkssp-----epval   Crystal structure analys of the gamma-copi appendage domain
1ab0:A lvtirsesthknteisfklgvefdeitaddrkvksiitldggal-vqvqkwdgks-----ttikr   C1g/v32d/f57h mutant of murine adipocyte lipid binding  ...
1adl:A*lvtirsestfknteisfklgvefdeitaddrkvksiitldggal-vqvqkwdgks-----ttikr×2 Adipocyte lipid binding protein complexed with arachidonic  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q8GVY2 tk-d---------avk--fkvrcskylyt-lcvfdadkanklkqslppgltvqev----------   60S ribosomal protein L38, putative, expressed OS=Oryza  ...
3iz5:n*tk-d---------avk--fkvrcskylyt-lcvfdadkanklkqslppgltvqev----------×3 Localization of the large subunit ribosomal proteins into a  ...
3j3b:k nk-d---------nvk--fkvrcsrylyt-lvitdkekaeklkqslppglavkelk---------   Structure of the human 60s ribosomal proteins
3j39:k np-t---------ntk--fkircsrflyt-lvvqdkekadkikqslppglqvkevk---------   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:p np-k---------vtk--fkvrcsrhlyt-lvmadkkkadkiersihpsvkkitvtsrshanknt   High-resolution cryo-electron microscopy structure of the  ...
3u5e:k*nk-klnkagkpfrqtk--fkvrgssslyt-lvindagkakkliqslpptlkvnrl----------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:n*nk-klnkagkpfrqtk--fkvrgssslyt-lvindagkakkliqslpptlkvnrl----------×2 Localization of the large subunit ribosomal proteins into a  ...
4a18:P*nk-r---------itk--fklrgkkylyt-fktadpkiakgikdaipatyskiei----------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3pcr:A tnse---------lve--aeirtanneki-tvllesneqnrllqslpidrhmpyiqvhralsemd   Structure of espg-arf6 complex
3pcs:A tnse---------lve--aeirtanneki-tvllesneqnrllqslpidrhmpyiqvhralltdt   Structure of espg-pak2 autoinhibitory ialpha3 helix complex
4fmc:A tnse---------sie--aeirtpnneki-tvllesneqnrllqslpidrhmpyiqvhralsemd   Espg-rab1 complex
4fmd:A*tnse---------sie--aeirtpnneki-tvllesneqnrllqslpidrhmpyiqvhralsemd×2 Espg-rab1 complex structure at 3.05 a
3q1c:A tnse---------sie--aeirtpdneki-tvllesneqnrllqslpidrhmpyiqvhralmdlt   Structure of espg protein
4fma:A tnse---------sie--aeirtpdneki-tvllesneqnrllqslpidrhmpyiqvhralsemd   Espg structure
2dng:A dk-d---------tdk--fk--------g-fcyvefdevdslkealtydgallgdrslrvdiaeg   Solution structure of RNA binding domain in eukaryotic  ...
1n93:X*hp-d---------aik--laprsfpnlas-aafywskkens---tiqpgasvketqlaryrrrei×2 Crystal structure of the borna disease virus nucleoprotein
3mjk:A ie-e---------avpavcktrtviyeip-rsqvdptsanfliw--ppcvevkrctgccntssvk   Structure of a growth factor precursor
1pzd:A te-s---------ete--yvirctkhtftdhmvfqfdctntlndqtlenvtvqmepseayevlcy   Structural identification of a conserved appendage domain  ...
1r4x:A te-s---------ete--yvirctkhtftnhmvfqfdctntlndqtlenvtvqmepteayevlxy   Crystal structure analys of the gamma-copi appendage domain
1ab0:A kr-d---------gdk--lvvecvmkgvt-strvyera---------------------------   C1g/v32d/f57h mutant of murine adipocyte lipid binding  ...
1adl:A*kr-d---------gdk--lvvecvmkgvt-strvyera---------------------------×2 Adipocyte lipid binding protein complexed with arachidonic  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q8GVY2 -----------------------------------------------------------------   60S ribosomal protein L38, putative, expressed OS=Oryza  ...
3iz5:n*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
3j3b:k -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:k -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:p psk--------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3u5e:k*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:n*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4a18:P*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3pcr:A ltdttsmrnllgftsklsttliphnaqtdplsgptpfssifmdtcrglgnaklslngvdipanaq   Structure of espg-arf6 complex
3pcs:A tsmrnllgftsklsttliphnaqtdplsgptpfssifmdtcrglgnaklslngvdipanaqkllr   Structure of espg-pak2 autoinhibitory ialpha3 helix complex
4fmc:A ltdttsmrnllgftsklsttliphnaqtdplsgptpfssifmdtcrglgnaklslngvdipanaq   Espg-rab1 complex
4fmd:A*ltdttsmrnllgftsklsttliphnaqtdplsgptpfssifmdtcrglgnaklslngvdipanaq×2 Espg-rab1 complex structure at 3.05 a
3q1c:A dttsmrnllgftsklsttliphnaqtdplsgptpfssifmdtcrglgnaklslngvdipanaqml   Structure of espg protein
4fma:A ltdttsmrnllgftsklsttliphnaqtdplsgptpfssifmdtcrglgnaklslngvdipanaq   Espg structure
2dng:A rkqdksgpssg------------------------------------------------------   Solution structure of RNA binding domain in eukaryotic  ...
1n93:X*srgedgaelsgeisaimkmigvtgln---------------------------------------×2 Crystal structure of the borna disease virus nucleoprotein
3mjk:A cqpsrvhhrsvkvakveyvrkkpklkevqvrleehlecaca------------------------   Structure of a growth factor precursor
1pzd:A vparslpynqpgtcytlvalpkedptavactfscvmkftvkdcdpttgeaddegyedeyvledle   Structural identification of a conserved appendage domain  ...
1r4x:A vparslpynqpgtcytlvalpkedptavactfscmmkftvkdcdpttgetddegyedeyvledle   Crystal structure analys of the gamma-copi appendage domain
1ab0:A -----------------------------------------------------------------   C1g/v32d/f57h mutant of murine adipocyte lipid binding  ...
1adl:A*-----------------------------------------------------------------×2 Adipocyte lipid binding protein complexed with arachidonic  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q8GVY2 -----------------------------------------------------------------   60S ribosomal protein L38, putative, expressed OS=Oryza  ...
3iz5:n*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
3j3b:k -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:k -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:p -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3u5e:k*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:n*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4a18:P*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3pcr:A kllrdalglkdthssptrnvidhgisrhdaeqiaressgsdkqkaevveflchpeaataicsafy   Structure of espg-arf6 complex
3pcs:A dalglkdthssptrnvidhgisrhdaeqiaressgsdkqkaevveflchpeaataicsafyqsfn   Structure of espg-pak2 autoinhibitory ialpha3 helix complex
4fmc:A mllrdalglkdthssptrnvidhgisrhdaeqiaressgsdkqkaevveflchpeaataicsafy   Espg-rab1 complex
4fmd:A*mllrdalglkdthssptrnvidhgisrhdaeqiaressgsdkqkaevveflchpeaataicsafy×2 Espg-rab1 complex structure at 3.05 a
3q1c:A lrdalglkdthsspsrnvidhgisrhdaeqiaressgsdnqkaevveflchpeaataicsafyqs   Structure of espg protein
4fma:A mllrdalglkdthsspsrnvidhgisrhdaeqiaressgsdnqkaevveflchpeaataicsafy   Espg structure
2dng:A -----------------------------------------------------------------   Solution structure of RNA binding domain in eukaryotic  ...
1n93:X*-----------------------------------------------------------------×2 Crystal structure of the borna disease virus nucleoprotein
3mjk:A -----------------------------------------------------------------   Structure of a growth factor precursor
1pzd:A vtiadhiqkvmklnfeaawdevgdefqkeetftlstiktleeavgnivkflgmhpcersdkvpdn   Structural identification of a conserved appendage domain  ...
1r4x:A vtvadhiqkvmklnfeaawdevgdefekeetftlstiktleeavgnivkflgmhpcersdkvpdn   Crystal structure analys of the gamma-copi appendage domain
1ab0:A -----------------------------------------------------------------   C1g/v32d/f57h mutant of murine adipocyte lipid binding  ...
1adl:A*-----------------------------------------------------------------×2 Adipocyte lipid binding protein complexed with arachidonic  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q8GVY2 -----------------------------------------------------------------   60S ribosomal protein L38, putative, expressed OS=Oryza  ...
3iz5:n*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
3j3b:k -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:k -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:p -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3u5e:k*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:n*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4a18:P*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3pcr:A qsfnvpaltltheriskaseynaersldtpnacinisisqssdgniyvtshtgvlimapedrpne   Structure of espg-arf6 complex
3pcs:A vpaltltheriskaseynaerstpnacinisisqssdgniyvtshtgvlimapedrpnemgmltn   Structure of espg-pak2 autoinhibitory ialpha3 helix complex
4fmc:A qsfnvpaltltheriskaseynaersldtpnacinisisqssdgniyvtshtgvlimapedrpne   Espg-rab1 complex
4fmd:A*qsfnvpaltltheriskaseynaersldtpnacinisisqssdgniyvtshtgvlimapedrpne×2 Espg-rab1 complex structure at 3.05 a
3q1c:A fnvpaltltheriskaseynaetpnacinisisqssdgniyvtshtgvlimapedrpnemgmltn   Structure of espg protein
4fma:A qsfnvpaltltheriskaseynaersldtpnacinisisqssdgniyvtshtgvlimapedrpne   Espg structure
2dng:A -----------------------------------------------------------------   Solution structure of RNA binding domain in eukaryotic  ...
1n93:X*-----------------------------------------------------------------×2 Crystal structure of the borna disease virus nucleoprotein
3mjk:A -----------------------------------------------------------------   Structure of a growth factor precursor
1pzd:A knthtlllagvfrgghdilvrsrlllldtvtmqvtarsseelpvdivlasvg-------------   Structural identification of a conserved appendage domain  ...
1r4x:A knthtlllagvfrgghdilvrsrlllldtvtmqvtarsleelpvdiilas---------------   Crystal structure analys of the gamma-copi appendage domain
1ab0:A -----------------------------------------------------------------   C1g/v32d/f57h mutant of murine adipocyte lipid binding  ...
1adl:A*-----------------------------------------------------------------×2 Adipocyte lipid binding protein complexed with arachidonic  ...

                5         5         5         5
                3         4         5         6
       1234567890123456789012345678901234567890                            Protein name
       ---------+---------+---------+---------+                            ------------
Q8GVY2 ----------------------------------------                            60S ribosomal protein L38, putative, expressed OS=Oryza  ...
3iz5:n*----------------------------------------                         ×3 Localization of the large subunit ribosomal proteins into a  ...
3j3b:k ----------------------------------------                            Structure of the human 60s ribosomal proteins
3j39:k ----------------------------------------                            Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:p ----------------------------------------                            High-resolution cryo-electron microscopy structure of the  ...
3u5e:k*----------------------------------------                         ×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:n*----------------------------------------                         ×2 Localization of the large subunit ribosomal proteins into a  ...
4a18:P*----------------------------------------                         ×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3pcr:A mgmltnrtsyevpqgvkciidemvsalqpryaasetyl--                            Structure of espg-arf6 complex
3pcs:A rtsyevpqgvkciidemvsalqpryaasetylqn------                            Structure of espg-pak2 autoinhibitory ialpha3 helix complex
4fmc:A mgmltnrtsyevpqgvkciidemvralqpryaasetylqn                            Espg-rab1 complex
4fmd:A*mgmltnrtsyevpqgvkctidemvralqpryaasetylqn                         ×2 Espg-rab1 complex structure at 3.05 a
3q1c:A rtsyevpqgvkctidemvralqpryaasetyl--------                            Structure of espg protein
4fma:A mgmltnrtsyevpqgvkctidemvralqpryaasetylqn                            Espg structure
2dng:A ----------------------------------------                            Solution structure of RNA binding domain in eukaryotic  ...
1n93:X*----------------------------------------                         ×2 Crystal structure of the borna disease virus nucleoprotein
3mjk:A ----------------------------------------                            Structure of a growth factor precursor
1pzd:A ----------------------------------------                            Structural identification of a conserved appendage domain  ...
1r4x:A ----------------------------------------                            Crystal structure analys of the gamma-copi appendage domain
1ab0:A ----------------------------------------                            C1g/v32d/f57h mutant of murine adipocyte lipid binding  ...
1adl:A*----------------------------------------                         ×2 Adipocyte lipid binding protein complexed with arachidonic  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q8GVY2. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 69 - - Q8GVY2 60S ribosomal protein L38, putative, expressed OS=Oryza sativa subsp. japonica GN=OJ1612_A04.113 PE=2 SV=2
2. 449 100.0% 69 69 692.6 1.3e-31 3iz5:n * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
3. " " " " " "  = 3izr:n *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
4. " " " " " "  = 3j61:k *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
5. 340 73.5% 68 69 527.4 2.1e-22 3j3b:k Structure of the human 60s ribosomal proteins
6. 300 62.3% 69 70 466.7 5.1e-19 3j39:k Structure of the d. Melanogaster 60s ribosomal proteins
7. 206 46.0% 63 81 323.4 4.9e-11 3zf7:p High-resolution cryo-electron microscopy structure of the tr brucei ribosome
8. 167 43.4% 76 77 208.5 0.00012 3u5e:k * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
9. " " " " " "  = 3u5i:k *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
10. " " " " " "  = 4b6a:k *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
11. " " " " " "  = 4byn:k *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
12. " " " " " "  = 4byu:k *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
13. 173 43.6% 78 78 208.4 0.00012 3izc:n * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
14. " " " " " "  = 3izs:n *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
15. 127 35.3% 68 66 204.8 0.0002 4a18:P * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
16. " " " " " "  = 4a19:P *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
17. " " " " " "  = 4a1b:P *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
18. " " " " " "  = 4a1d:P *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
19. 78 30.0% 50 349 121.3 8.8 3pcr:A Structure of espg-arf6 complex
20. 78 30.0% 50 350 121.3 8.8 3pcs:A Structure of espg-pak2 autoinhibitory ialpha3 helix complex
21. 78 28.0% 50 351 121.3 8.8 4fmc:A Espg-rab1 complex
22. 78 28.0% 50 351 121.3 8.8 4fmd:A * Espg-rab1 complex structure at 3.05 a
23. " " " " " "  = 4fme:A *
Espg-rab1-arf6 complex
24. 77 28.0% 50 351 119.8 11 3q1c:A Structure of espg protein
25. 77 28.0% 50 351 119.8 11 4fma:A Espg structure
26. 72 37.5% 40 103 119.0 12 2dng:A Solution structure of RNA binding domain in eukaryotic translation initiation factor 4h
27. 73 27.0% 74 335 114.0 23 1n93:X * Crystal structure of the borna disease virus nucleoprotein
28. " " " " " "  = 1pp1:X *
Crystal structure of the borna disease virus nucleoprotein
29. 69 34.8% 66 129 113.2 25 3mjk:A Structure of a growth factor precursor
30. 70 31.7% 41 271 110.6 35 1pzd:A Structural identification of a conserved appendage domain in the carboxyl-terminus of the copi gamma-subunit.
31. 70 31.7% 41 273 110.5 35 1r4x:A Crystal structure analys of the gamma-copi appendage domain
32. 67 37.0% 27 131 110.1 37 1ab0:A C1g/v32d/f57h mutant of murine adipocyte lipid binding protein at ph 4.5
33. 67 37.0% 27 131 110.1 37 1adl:A * Adipocyte lipid binding protein complexed with arachidonic acid: x-ray crystallographic and titration calorimetry studies
34. " " " " " "  = 1alb:A *
Crystal structure of recombinant murine adipocyte lipid- binding protein

Number of sequences: 34

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 67 37.0% 27 131 110.1 37 1g74:A * Toward changing specificity: adipocyte lipid binding protein mutant, oleic acid bound form
2. " " " " " "  = 1g7n:A *
Toward changing specificity: adipocyte lipid binding protein mutant, apo form
3. 67 37.0% 27 131 110.1 37 1lib:A * The adipocyte lipid-binding protein at 1.6 angstroms resolution: crystal structures of the apoprotein and with bound saturated and unsaturated fatty acids
4. " " " " " "  = 1lid:A *
The adipocyte lipid-binding protein at 1.6 angstroms resolution: crystal structures of the apoprotein and with bound saturated and unsaturated fatty acids
5. " " " " " "  = 1lif:A *
The adipocyte lipid-binding protein at 1.6 angstroms resolution: crystal structures of the apoprotein and with bound saturated and unsaturated fatty acids
6. " " " " " "  = 2ans:A *
Adipocyte lipid binding protein complexed with 1-anilino-8-n sulfonate
7. " " " " " "  = 2q9s:A *
Linoleic acid bound to fatty acid binding protein 4
8. " " " " " "  = 3hk1:A *
Identification and characterization of a small molecule inhibitor of fatty acid binding proteins
9. " " " " " "  = 3jsq:A *
Crystal structure of adipocyte fatty acid binding protein no covalently modified with 4-hydroxy-2-nonenal
10. 67 37.0% 27 132 110.0 37 2qm9:B Troglitazone bound to fatty acid binding protein 4
11. 70 37.5% 32 306 109.9 38 2owy:A The recombination-associated protein rdgc adopts a novel tor architecture for DNA binding
12. 67 37.0% 27 139 109.7 39 2qm9:A Troglitazone bound to fatty acid binding protein 4

Number of sequences: 12

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer