spacer
spacer

SAS results for UniProt accession no. Q7XC31

Sequence annotated by structure
>

Key:
Sec. struc: By homology
  Helix Strand  

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

 

FASTA alignment for UniProt accession no. Q7XC31 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q7XC31 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 24 unique sequences (including 9 consensus sequences) giving 47 sequence matches in all. The 9 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q7XC31 -----------------------------------------------------------------   60S ribosomal protein L27 OS=Oryza sativa subsp. japonica  ...
3j61:Z -----------------------------------------------------------------   Localization of the large subunit ribosomal proteins into a  ...
3iz5:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3u5e:Z*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:a -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
4a18:N*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3zf7:v ---------------------------------------------------paatkkavekkakk   High-resolution cryo-electron microscopy structure of the  ...
3u5e:E -----------------------------------------------saqkapkwypsedvaalk   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:E*-----------------------------------------------saqkapkwypsedvaalk×4 The structure of the eukaryotic ribosome at 3.0 a  ...
2z7c:A -----------------------------------------------------------------   Crystal structure of chromatin protein alba from  ...
3izc:G*----------------------------------------------msaqkapkwypsedvaalk×4 Localization of the large subunit ribosomal proteins into a  ...
3j39:E kgkkhpvnsylkggilryskaqmykrralyrlkdkkspvvekakvpikkskasyptktfvkkrps   Structure of the d. Melanogaster 60s ribosomal proteins
4ess:A -----------------------------------------------arirdvqgditefqgdai   Crystal structure of e6d/l155r variant of de novo designed  ...
4etj:A -----------------------------------------arirhvqgditefqgdaivnaann   Crystal structure of e6h variant of de novo designed serine  ...
3v45:A -----------------------------------------arirevqgditefqgdaivnaann   Crystal structure of de novo designed serine hydrolase  ...
4a18:E*------------------------------------argpagknrgvskiskwykaddeatpfhr×4 T.Thermophila 60s ribosomal subunit in complex with  ...
1r5s:A -----------------------------------------------------------------   Connexin 43 carboxyl terminal domain
2do3:A --------------------------------------------------------------gss   Solution structure of the third kow motif of transcription  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q7XC31 ----------mvkflkpgkavillqgrfagrkavivrvfee---gtr--drpyg--hclvag---   60S ribosomal protein L27 OS=Oryza sativa subsp. japonica  ...
3j61:Z ----------mvkflkpgkavillqgrfagrkavivrvfee---gtr--drpyg--hclvag---   Localization of the large subunit ribosomal proteins into a  ...
3iz5:a*----------mvkflkpgkavillqgrfagrkavivrvfee---gtr--drpyg--hclvag---×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z -----------gkfmkpgkvvlvlagrysgrkavivknidd---gts--drpys--halvag---   Structure of the human 60s ribosomal proteins
3u5e:Z*-----------akflkagkvavvvrgryagkkvvivkphde---gsk--shpfg--halvag---×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:Z -----------rkimkqgkivivlsgryagrkaiivkthdd---gtp--ekpfg--halvag---   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:a ------------kflkpgkvvimtsgryagkkavivqntdt---rnk--erpyg--hsllag---   High-resolution cryo-electron microscopy structure of the  ...
4a18:N*-----------akflkygrvvillqgrfagkkavivkssed---gtk--drkfg--hvlvag---×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:a*--------------lkagkvavvvrgryagkkvvivkphde---gsk--shpfg--halvag---×2 Localization of the large subunit ribosomal proteins into a  ...
3zf7:v vsrkspeystvrksckpgtiaiilagrfrgrravilkqlpk---n--------g--plvisg---   High-resolution cryo-electron microscopy structure of the  ...
3u5e:E ktrkaarpqklraslvpgtvlillagrfrgkrvvylkhled---ntl--lisgp--fkvngv---   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:E*ktrkaarpqklraslvpgtvlillagrfrgkrvvylkhled---ntl--lisgp--fkvngv---×4 The structure of the eukaryotic ribosome at 3.0 a  ...
2z7c:A -------------------------------------------------hvvyi--gkkpvm---   Crystal structure of chromatin protein alba from  ...
3izc:G*ktrkaarpqklraslvpgtvlillagrfrgkrvvylkhled---ntl--lisgp--fkvngv---×4 Localization of the large subunit ribosomal proteins into a  ...
3j39:E kanfsehkrntrrnltpgtvlillagrhqgkrvvllkvlas---glllvtgpfalnsc---p---   Structure of the d. Melanogaster 60s ribosomal proteins
4ess:A vnaannylklgagvagailrkggpsiqeecdrigkirvgeaavtgag--nlpvr--yvihaav--   Crystal structure of e6d/l155r variant of de novo designed  ...
4etj:A ylklgagvagailrkggpsiqeecdrigkirvgeaavtgag---nlp--vryvi--haavlg---   Crystal structure of e6h variant of de novo designed serine  ...
3v45:A ylklgagvagailrkggpsiqeecdrigkirvgeaavtgag---nlp--vryvi--haavlg---   Crystal structure of de novo designed serine hydrolase  ...
4a18:E*rqlkkatatklrndiapgtvlillagrfrgkrvvflkqlks---gll--lvtgp--ykvngv---×4 T.Thermophila 60s ribosomal subunit in complex with  ...
1r5s:A --------------gplgspskdcgspkyayfngcssptap---lsp--msppg--yklvtgdrn   Connexin 43 carboxyl terminal domain
2do3:A gssgefpaqelrkyfkmgdhvkviagrfegdtglivrveen---fvi--lfsdl--tmhelk---   Solution structure of the third kow motif of transcription  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q7XC31 ---lakypk-kvirk-dsakktakksrvkcflklvnfthl------mptr--ytl-d--v-dl--   60S ribosomal protein L27 OS=Oryza sativa subsp. japonica  ...
3j61:Z ---lakypk-kvirk-dsakktakksrvkcflklvnfthl------mptr--ytl-d--v-dl--   Localization of the large subunit ribosomal proteins into a  ...
3iz5:a*---lakypk-kvirk-dsakktakksrvkcflklvnfthl------mptr--ytl-d--v-dl--×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z ---idrypr-kvtaa-mgkkkiakrskiksfvkvynynhl------mptr--ysv-d--i-pl--   Structure of the human 60s ribosomal proteins
3u5e:Z*---ierypl-kvtkk-hgakkvakrtkikpfikvvnynhl------lptr--ytl-d--v-ea--×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:Z ---idrypr-kvtkk-mgknklkkkskvkpflkslnynhl------mptr--ytahd--i-sf--   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:a ---ikkypr-kvvrg-mskrsitrrsqvgvflrvvnhkhf------lptr--ynm-d--l-s---   High-resolution cryo-electron microscopy structure of the  ...
4a18:N*---verspk-kvtkr-mgskkiqkrtsvkpfikyvnlnhi------mptr--ysv-kelc-df--×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:a*---ierypl-kvtkk-hgakkvakrtkikpfikvvnynhl------lptr--ytl-d--v-ea--×2 Localization of the large subunit ribosomal proteins into a  ...
3zf7:v ---pmkysg-vpirridsryiiatstrvd--ltgvdtsai------tpei--fkr-e--k-ke--   High-resolution cryo-electron microscopy structure of the  ...
3u5e:E ---plrrvn-aryvi-atstkvsvegvnvekfnveyfake------eika--erv-e--d-qk--   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:E*---plrrvn-aryvi-atstkvsvegvnvekfnveyfake------keik--aer-v--e-dq--×4 The structure of the eukaryotic ribosome at 3.0 a  ...
2z7c:A ---nyvlav-itqfh-egakevsikargraisravdvaei------vrnr--flk-dd-v-dv--   Crystal structure of chromatin protein alba from  ...
3izc:G*---plrrvn-aryvi-atstkvsvegvnvekfnveyfake------kltk--kek-k--e-an--×4 Localization of the large subunit ribosomal proteins into a  ...
3j39:E ---lrrvsq-ryvig-tsskvdlgafkvpehlndayfrrl------kakkdkktg-e--a-difa   Structure of the d. Melanogaster 60s ribosomal proteins
4ess:A ---lgdepsletvrk---atksalekavelglktvaftaawvgg--lpae--avl-r--v-ml--   Crystal structure of e6d/l155r variant of de novo designed  ...
4etj:A ---depasl-etvrk---atksalekavelglktvaftalgawvgglpae--avl-r--v-ml--   Crystal structure of e6h variant of de novo designed serine  ...
3v45:A ---depasl-etvrk---atksalekavelglktvaftalgawvgglpae--avl-r--v-ml--   Crystal structure of de novo designed serine hydrolase  ...
4a18:E*---plkrvn-qaytl-ststkvdltgvntakfeddyfgre------kark--nhk-n--l-fk--×4 T.Thermophila 60s ribosomal subunit in complex with  ...
1r5s:A nsscrnynk-qaseq-nwanysaeqnrmgqagstisnsha------qpfd--fpd-d--nqna--   Connexin 43 carboxyl terminal domain
2do3:A ---vlprdl-qlcse--------------------------------------------------   Solution structure of the third kow motif of transcription  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q7XC31 -kevaagpd--al---at------rd--kk---vaacksakarledrfktgknrwfftklrf---   60S ribosomal protein L27 OS=Oryza sativa subsp. japonica  ...
3j61:Z -kevaagpd--al---at------rd--kk---vaacksakarledrfktgknrwfftklrf---   Localization of the large subunit ribosomal proteins into a  ...
3iz5:a*-kevaagpd--------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z -dktvvnkd--vf---rd------pa--lk---rkarreakvkfeeryktgknkwffqklrf---   Structure of the human 60s ribosomal proteins
3u5e:Z*-fksvvste--tf---eq------ps--qr---eeakkvvkkafeerhqagknqwffsklrf---×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:Z -ekls--pk--dl---kd------pv--kr---kthrfqtrvkfesvykegknkwffqklrf---   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:a -relr-gri--nv---sd------as--kk---akskqlvkrlfqarynagnnrwffqrlrf---   High-resolution cryo-electron microscopy structure of the  ...
4a18:N*-kelvk-ed--ki---knnaksevrdtlkk---vfvekyrtinpeek-sashtkfffsklrf---×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:a*-fksvvste--------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3zf7:v -vsderaql--qn---ai------dt--al---iqaikkdplgkemagylhsvftikpgdaphrl   High-resolution cryo-electron microscopy structure of the  ...
3u5e:E -vvdkalia--ei---kk------tp--ll---kqylsasfslkngdkphmlkf-----------   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:E*-kvvdkali--ae---ik------kt--pl---lkqylsasfslkngdkphmlkf----------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
2z7c:A -keikigte--el---pt------ad--gr---ttntstieivlarkt-----------------   Crystal structure of chromatin protein alba from  ...
3izc:G*-lfpeqqnk--ei---ka------er--ve---dqkvvdkaliaeikktpllkqylsasfslkng×4 Localization of the large subunit ribosomal proteins into a  ...
3j39:E akkerfvpn--eq---rk------kd--qkevdaallkvikahpegkffakylqnmfalhssqyp   Structure of the d. Melanogaster 60s ribosomal proteins
4ess:A -eeikkapd--tlevtgv------hg--te---ksaeaarrarleh-------------------   Crystal structure of e6d/l155r variant of de novo designed  ...
4etj:A -eeikkapd--tl---ev------tg--vh----gteksaeaarrallehhhh------------   Crystal structure of e6h variant of de novo designed serine  ...
3v45:A -eeikkapd--tl---ev------tg--vh----gteksaeaarrallehhhhhh----------   Crystal structure of de novo designed serine hydrolase  ...
4a18:E*-aelteeqk--kk---et------er--kn---arkqdqqavdtpllaavkkveflknylaskft×4 T.Thermophila 60s ribosomal subunit in complex with  ...
1r5s:A -kkvaaghelqpl---ai------vd--qr---pssrassrassrprpddlei------------   Connexin 43 carboxyl terminal domain
2do3:A -----------------------------------------------------------------   Solution structure of the third kow motif of transcription  ...

                2  
                7  
       123456789012                                                        Protein name
       ---------+--                                                        ------------
Q7XC31 ------------                                                        60S ribosomal protein L27 OS=Oryza sativa subsp. japonica  ...
3j61:Z ------------                                                        Localization of the large subunit ribosomal proteins into a  ...
3iz5:a*------------                                                     ×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z ------------                                                        Structure of the human 60s ribosomal proteins
3u5e:Z*------------                                                     ×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:Z ------------                                                        Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:a ------------                                                        High-resolution cryo-electron microscopy structure of the  ...
4a18:N*------------                                                     ×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:a*------------                                                     ×2 Localization of the large subunit ribosomal proteins into a  ...
3zf7:v kw----------                                                        High-resolution cryo-electron microscopy structure of the  ...
3u5e:E ------------                                                        The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:E*------------                                                     ×4 The structure of the eukaryotic ribosome at 3.0 a  ...
2z7c:A ------------                                                        Crystal structure of chromatin protein alba from  ...
3izc:G*dkphmlkf----                                                     ×4 Localization of the large subunit ribosomal proteins into a  ...
3j39:E hrmrf-------                                                        Structure of the d. Melanogaster 60s ribosomal proteins
4ess:A ------------                                                        Crystal structure of e6d/l155r variant of de novo designed  ...
4etj:A ------------                                                        Crystal structure of e6h variant of de novo designed serine  ...
3v45:A ------------                                                        Crystal structure of de novo designed serine hydrolase  ...
4a18:E*lnnndrphemkf                                                     ×4 T.Thermophila 60s ribosomal subunit in complex with  ...
1r5s:A ------------                                                        Connexin 43 carboxyl terminal domain
2do3:A ------------                                                        Solution structure of the third kow motif of transcription  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q7XC31. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 136 - - Q7XC31 60S ribosomal protein L27 OS=Oryza sativa subsp. japonica GN=OSJNBa0027P10.10 PE=2 SV=1
2. 892 100.0% 136 136 1210.4 1.9e-60 3j61:Z Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
3. 648 100.0% 99 99 883.3 3.2e-42 3iz5:a * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
4. " " " " " "  = 3izr:a *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
5. 493 51.5% 134 135 672.4 1.8e-30 3j3b:Z Structure of the human 60s ribosomal proteins
6. 458 47.0% 134 135 625.3 7.5e-28 3u5e:Z * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
7. " " " " " "  = 3u5i:Z *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
8. " " " " " "  = 4b6a:Z *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
9. " " " " " "  = 4byn:Z *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
10. " " " " " "  = 4byu:Z *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
11. 423 47.4% 135 134 578.1 3.2e-25 3j39:Z Structure of the d. Melanogaster 60s ribosomal proteins
12. 408 44.8% 134 132 558.0 4.2e-24 3zf7:a High-resolution cryo-electron microscopy structure of the tr brucei ribosome
13. 374 46.5% 144 143 503.5 4.5e-21 4a18:N * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
14. " " " " " "  = 4a19:N *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
15. " " " " " "  = 4a1b:N *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
16. " " " " " "  = 4a1d:N *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
17. 346 53.5% 86 95 476.4 1.5e-19 3izc:a * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
18. " " " " " "  = 3izs:a *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
19. 113 34.6% 81 158 159.1 0.069 3zf7:v High-resolution cryo-electron microscopy structure of the tr brucei ribosome
20. 87 44.8% 29 156 124.1 6.2 3u5e:E The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
21. 87 44.8% 29 157 124.1 6.2 3u5i:E * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
22. " " " " " "  = 4b6a:E *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
23. " " " " " "  = 4byn:E *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
24. " " " " " "  = 4byu:E *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
25. 84 25.4% 63 89 123.5 6.7 2z7c:A Crystal structure of chromatin protein alba from hyperthermophilic archaeon pyrococcus horikoshii
26. 87 44.8% 29 176 123.4 6.8 3izc:G * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
27. " " " " " "  = 3izs:G *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
28. " " " " " "  = 3o58:F *
Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
29. " " " " " "  = 3o5h:F *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
30. 88 25.4% 130 228 120.4 9.9 3j39:E Structure of the d. Melanogaster 60s ribosomal proteins
31. 84 30.2% 106 158 120.0 10 4ess:A Crystal structure of e6d/l155r variant of de novo designed s hydrolase osh55, northeast structural genomics consortium ( target or187
32. 84 32.5% 83 164 119.8 11 4etj:A Crystal structure of e6h variant of de novo designed serine osh55, northeast structural genomics consortium (nesg) targ
33. 84 32.5% 83 166 119.7 11 3v45:A Crystal structure of de novo designed serine hydrolase osh55 northeast structural genomics consortium target or130
34. 83 39.3% 28 190 117.5 14 4a18:E * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
35. " " " " " "  = 4a19:E *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
36. " " " " " "  = 4a1b:E *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
37. " " " " " "  = 4a1d:E *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
38. 79 25.5% 94 132 114.3 22 1r5s:A Connexin 43 carboxyl terminal domain
39. 76 46.4% 28 69 114.3 22 2do3:A Solution structure of the third kow motif of transcription elongation factor spt5

Number of sequences: 39

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 85 24.0% 129 219 113.9 23 3iz5:G * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
2. " " " " " "  = 3izr:G *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
3. " " " " " "  = 3j61:E *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
4. 78 24.1% 116 135 112.9 26 3u5i:W * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
5. " " " " " "  = 4b6a:W *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
6. " " " " " "  = 4byn:W *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
7. " " " " " "  = 4byu:W *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
8. 74 26.7% 105 103 109.1 42 4ce4:Y 39s large subunit of the porcine mitochondrial ribosome
9. 76 30.1% 83 165 108.9 43 4gvv:A Crystal structure of de novo design serine hydrolase osh55.2 northeast structural genomics consortium (nesg) target or24

Number of sequences: 9

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer