spacer
spacer

SAS results for UniProt accession no. P05318

Sequence annotated by structure
>

Key:
Sec. struc: By homology
  Helix Strand  

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

 

FASTA alignment for UniProt accession no. P05318 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P05318 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 42 unique sequences (including 7 consensus sequences) giving 54 sequence matches in all. The 26 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05318 -----------------------------------------------------------------   60S acidic ribosomal protein P1-alpha OS=Saccharomyces  ...
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
2lbf:A -----------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4beh:B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
1dd3:A*-----------------------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
3sge:K -----------------------------------------------------------------   Crystal structure of mab 17.2 in complex with r13 peptide
2yg3:A*-----------------------------------------------------------------×2 Structure-based redesign of cofactor binding in putrescine  ...
2yg5:A -----------------------------------------------------------------   Structure-based redesign of cofactor binding in putrescine  ...
2yg6:A -----------------------------------------------------------------   Structure-based redesign of cofactor binding in putrescine  ...
2yg7:A -----------------------------------------------------------------   Structure-based redesign of cofactor binding in putrescine  ...
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
2act:A -----------------------------------------------------------------   Crystallographic refinement of the structure of actinidin  ...
2z6j:A mktritellkidypifqggmawvadgdlagavskagglgiigggnapkevvkanidkiksltdkp   Crystal structure of s. Pneumoniae enoyl-acyl carrier  ...
3tfl:A -----------------------------------------------------------------   Lytr-cps2a-psr family protein with bound octaprenyl  ...
2xxq:A -----------------------------------------------------------------   A widespread family of bacterial cell wall assembly proteins
3tel:A -----------------------------------------------------------------   Lytr-cps2a-psr family protein with bound octaprenyl  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P05318 -----------------------------------------------------------------   60S acidic ribosomal protein P1-alpha OS=Saccharomyces  ...
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
2lbf:A -----------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4beh:B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
1dd3:A*-----------------------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
3sge:K -----------------------------------------------------------------   Crystal structure of mab 17.2 in complex with r13 peptide
2yg3:A*-----------------------------ptlqrdvaivgagpsglaaatalrkaglsvaviear×2 Structure-based redesign of cofactor binding in putrescine  ...
2yg5:A -----------------------------ptlqrdvaivgagpsglaaatalrkaglsvaviear   Structure-based redesign of cofactor binding in putrescine  ...
2yg6:A -----------------------------ptlqrdvaivgagisglaaatalrkaglsvaviear   Structure-based redesign of cofactor binding in putrescine  ...
2yg7:A -----------------------------ptlqrdvaivgagpsglaaatalrkaglsvaviear   Structure-based redesign of cofactor binding in putrescine  ...
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
2act:A ----------------------------------------lpsyvdwrsagavvdiksqgecggx   Crystallographic refinement of the structure of actinidin  ...
2z6j:A fgvnimllspfvedivdlvieegvkvvttgagnpskymerfheagiivipvvpsvalakrmekig   Crystal structure of s. Pneumoniae enoyl-acyl carrier  ...
3tfl:A -----------------------------------------------------------------   Lytr-cps2a-psr family protein with bound octaprenyl  ...
2xxq:A -----------------------------------------------------------------   A widespread family of bacterial cell wall assembly proteins
3tel:A -----------------------------------------------------------------   Lytr-cps2a-psr family protein with bound octaprenyl  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05318 ---------------------------------------------------------mstesals   60S acidic ribosomal protein P1-alpha OS=Saccharomyces  ...
3izc:t*-------------------------------------------------------------sals×2 Localization of the large subunit ribosomal proteins into a  ...
4beh:A -------------------------------------------------------masvselaci   Solution structure of human ribosomal protein p1.P2 heterodi
2lbf:A -------------------------------------------------------masvselaci   Solution structure of the dimerization domain of human  ...
3iz5:t*-------------------------------------------------------------vact×3 Localization of the large subunit ribosomal proteins into a  ...
4beh:B -----------------------------------------------------------amryva   Solution structure of human ribosomal protein p1.P2 heterodi
3j3b:s -------------------------------------------------------------laci   Structure of the human 60s ribosomal proteins
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
1dd3:A*-----------------------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
3sge:K -----------------------------------------------------------------   Crystal structure of mab 17.2 in complex with r13 peptide
2yg3:A*drvggrtwtdtidgavleiggqwvspdqtalislldelglktferyregesvyissagertrytg×2 Structure-based redesign of cofactor binding in putrescine  ...
2yg5:A drvggrtwtdtidgavleiggqwvspdqtalislldelglktferyregesvyissagertrytg   Structure-based redesign of cofactor binding in putrescine  ...
2yg6:A drvggrtwtdtidgavleiggqwvspdqtalislldelglktferyregesvyissagertrytg   Structure-based redesign of cofactor binding in putrescine  ...
2yg7:A drvggrtwtdtidgavleiggqwvspdqtalislldelglktferyregesvyissagertrytg   Structure-based redesign of cofactor binding in putrescine  ...
3a1y:A -------------------------------------------------------------meyv   The structure of archaeal ribosomal stalk p1/p0 complex
2act:A wafsaiatveginkitsgslislseqelidcgrtqntrgcdggyitdgfqfiindgginteenyp   Crystallographic refinement of the structure of actinidin  ...
2z6j:A adaviaegmeagghigklttmtlvrqvataisipviaaggiadgegaaagfmlgaeavqvgtrfv   Crystal structure of s. Pneumoniae enoyl-acyl carrier  ...
3tfl:A -----------------------------------------------------------seysls   Lytr-cps2a-psr family protein with bound octaprenyl  ...
2xxq:A -----------------------------------------------------------seysls   A widespread family of bacterial cell wall assembly proteins
3tel:A -----------------------------------------------------------seysls   Lytr-cps2a-psr family protein with bound octaprenyl  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P05318 yaaliladseieisseklltltnaanvpveniwadifakaldgqnlkdl-------lvnfsag--   60S acidic ribosomal protein P1-alpha OS=Saccharomyces  ...
3izc:t*yaaliladseieisseklltltnaanvpdeniwadifakaldgqnlkdl-------lvnfs----×2 Localization of the large subunit ribosomal proteins into a  ...
4beh:A ysalilhddevtvtedkinalikaagvnvepfwpglfakalanvnigsl-------icnvgag--   Solution structure of human ribosomal protein p1.P2 heterodi
2lbf:A ysalilhddevtvtedkinalikaagvnvepfwpglfakalanvnigsl-------icnvgag--   Solution structure of the dimerization domain of human  ...
3iz5:t*laalilhddgipitsekiatvvkaagikveaywpalfakllekrsvddl-------ilsvg----×3 Localization of the large subunit ribosomal proteins into a  ...
4beh:B syllaalggnsspsakdikkildsvgieadddrlnkviselngkniedviaqgigklasvpag--   Solution structure of human ribosomal protein p1.P2 heterodi
3j3b:s ysalilhddevtvtedkinalikaagvnvepfwpglfakalanvnigsl-------icnv-----   Structure of the human 60s ribosomal proteins
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
1dd3:A*------------------------mtideiieaiekltvselaelvkkl-------edkfgvt--×5 Crystal structure of ribosomal protein l12 from thermotoga m
3sge:K -----------------------------------------------------------------   Crystal structure of mab 17.2 in complex with r13 peptide
2yg3:A*dsfptnettkkemdrlidemddlaaqigaeepwahplardldtvsfkqw-------linqsdd--×2 Structure-based redesign of cofactor binding in putrescine  ...
2yg5:A dsfptnettkkemdrlidemddlaaqigaeepwahplardldtvsfkqw-------linqsdd--   Structure-based redesign of cofactor binding in putrescine  ...
2yg6:A dsfptnettkkemdrlidemddlaaqigaeepwahplardldtvsfkqw-------linqsdd--   Structure-based redesign of cofactor binding in putrescine  ...
2yg7:A dsfptnettkkemdrlidemddlaaqigaeepwahplardldtvsfkqw-------linqsdd--   Structure-based redesign of cofactor binding in putrescine  ...
3a1y:A yaalllhsvgkeineenlkavlqaagvepeearikalvaalegvnidev-------iekaa----   The structure of archaeal ribosomal stalk p1/p0 complex
2act:A ytaqd-gdcdvalqdqkyvtidtyenvpynnewa--lqtavtyqpvs----------valdaa--   Crystallographic refinement of the structure of actinidin  ...
2z6j:A vakesnahpnykekilkardidttisaqhavraiknqltrdfelaekda-------feqmgag--   Crystal structure of s. Pneumoniae enoyl-acyl carrier  ...
3tfl:A va--vladseie-nvtqltsvtaptgtdneniqk-lladikssqnt-dl-------tvnqsssyl   Lytr-cps2a-psr family protein with bound octaprenyl  ...
2xxq:A va--vladseie-nvtqltsvtaptgtdneniqk-lladikssqnt-dl-------tvnqsssyl   A widespread family of bacterial cell wall assembly proteins
3tel:A va--vladseie-nvtqltsvtaptgtdneniqk-lladikssqnt-dl-------tvnqsssyl   Lytr-cps2a-psr family protein with bound octaprenyl  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05318 aaapagvagg-v-agge--a---geaeaekeee-----eak----eesdddmgfglfd-------   60S acidic ribosomal protein P1-alpha OS=Saccharomyces  ...
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4beh:A gpapa--aga-apaggp--apstaaapaeekkv-----eakkeeseesdddmgfglfd-------   Solution structure of human ribosomal protein p1.P2 heterodi
2lbf:A gpa--------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4beh:B gavavsaapg-s-aapa--a---gsapaaaeekkdekkees----eesdddmgfglfd-------   Solution structure of human ribosomal protein p1.P2 heterodi
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
1s4j:A ---------------------------------------------eesdddmgfglfd-------   Nmr structure of cross-reactive peptides from homo sapiens
1s4h:A ---------------------------------------------eeadddmgfglfd-------   Nmr structure of cross-reactive peptides from l.  ...
1dd3:A*aaapvavaaapv-agaa--a---gaaqeektef-----dvv----lksfgqnkiqvikvvreitg×5 Crystal structure of ribosomal protein l12 from thermotoga m
3sge:K ---------------------------------------------eeedddmgfgl---------   Crystal structure of mab 17.2 in complex with r13 peptide
2yg3:A*aeardniglf-i-aggm--l---tkpahsfsal-----qav----lmaasagsfshlvdedfild×2 Structure-based redesign of cofactor binding in putrescine  ...
2yg5:A aeardniglf-i-aggm--l---tkpahsfsal-----qav----lmaasagsfshlvdedfild   Structure-based redesign of cofactor binding in putrescine  ...
2yg6:A aeardniglf-i-aggm--l---tkpahsfsal-----qav----lmaasagsfshlvdedfild   Structure-based redesign of cofactor binding in putrescine  ...
2yg7:A aeardniglf-i-aggm--l---tkpahsfsal-----qav----lmaasagsfshlvdedfild   Structure-based redesign of cofactor binding in putrescine  ...
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
2act:A gdafkqyasg-i-ftgp--c---gtavdhaivi-----vgy----gteggvdywivknswdttwg   Crystallographic refinement of the structure of actinidin  ...
2z6j:A alakavvhgd-v-dggsvma---gqiaglvske-----eta----eeilkdlyygaakkiqeeas   Crystal structure of s. Pneumoniae enoyl-acyl carrier  ...
3tfl:A aayksliage-t-kaiv--l---nsvfeniiel-----eyp----dyaskikkiytkgftkkvea   Lytr-cps2a-psr family protein with bound octaprenyl  ...
2xxq:A aayksliage-t-kaiv--l---nsvfeniiel-----eyp----dyaskikkiytkgftkkvea   A widespread family of bacterial cell wall assembly proteins
3tel:A aayksliage-t-kaiv--l---nsvfeniiel-----eyp----dyaskikkiytkgftkkvea   Lytr-cps2a-psr family protein with bound octaprenyl  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P05318 -----------------------------------------------------------------   60S acidic ribosomal protein P1-alpha OS=Saccharomyces  ...
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
2lbf:A -----------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4beh:B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
1dd3:A*lglkeakdlvekagspdaviksgvskeeaeeikkkleeagaevelk-------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
3sge:K -----------------------------------------------------------------   Crystal structure of mab 17.2 in complex with r13 peptide
2yg3:A*krviggmqqvsirmaealgddvflnapvrtvkwnesgatvladgdirveasrvilavppnlysri×2 Structure-based redesign of cofactor binding in putrescine  ...
2yg5:A krviggmqqvsirmaealgddvflnapvrtvkwnesgatvladgdirveasrvilavppnlysri   Structure-based redesign of cofactor binding in putrescine  ...
2yg6:A krviggmqqvsirmaealgddvflnapvrtvkwnesgatvladgdirveasrvilavppnlysri   Structure-based redesign of cofactor binding in putrescine  ...
2yg7:A krviggmqqvsirmaealgddvflnapvrtvkwnesgatvladgdirveasrvilavppnlysri   Structure-based redesign of cofactor binding in putrescine  ...
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
2act:A eegymrilrnvggagtcgiatmpsypvk-------------------------------------   Crystallographic refinement of the structure of actinidin  ...
2z6j:A rwtgv------------------------------------------------------------   Crystal structure of s. Pneumoniae enoyl-acyl carrier  ...
3tfl:A pktsknqsfniyvsgidtygpissvsrsdvnilmtvnrdtkkilltttprdayvpiadggnnqkd   Lytr-cps2a-psr family protein with bound octaprenyl  ...
2xxq:A pktsknqsfniyvsgidtygpissvsrsdvnilmtvnrdtkkilltttpadayvpiadggnnqkd   A widespread family of bacterial cell wall assembly proteins
3tel:A pktsknqsfniyvsgidtygpissvsrsdvnilmtvnrdtkkilltttpadayvpiadggnnqkd   Lytr-cps2a-psr family protein with bound octaprenyl  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05318 -----------------------------------------------------------------   60S acidic ribosomal protein P1-alpha OS=Saccharomyces  ...
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
2lbf:A -----------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4beh:B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
1dd3:A*-----------------------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
3sge:K -----------------------------------------------------------------   Crystal structure of mab 17.2 in complex with r13 peptide
2yg3:A*sydpplprrqhqmhqhqslglvikvhavyetpfwredglsgtgfgasevvqevydntnheddrgt×2 Structure-based redesign of cofactor binding in putrescine  ...
2yg5:A sydpplprrqhqmhqhqslglvikvhavyetpfwredglsgtgfgasevvqevydntnheddrgt   Structure-based redesign of cofactor binding in putrescine  ...
2yg6:A sydpplprrqhqmhqhqslglvikvhavyetpfwredglsgtgfgasevvqevydntnheddrgt   Structure-based redesign of cofactor binding in putrescine  ...
2yg7:A sydpplprrqhqmhqhqslglvikvhavyetpfwredglsgtgfgasevvqevydntnheddrgt   Structure-based redesign of cofactor binding in putrescine  ...
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
2act:A -----------------------------------------------------------------   Crystallographic refinement of the structure of actinidin  ...
2z6j:A -----------------------------------------------------------------   Crystal structure of s. Pneumoniae enoyl-acyl carrier  ...
3tfl:A klthagiygvdssihtlenlygvdinyyvrlnftsflkmidllggvdvhndqefsalhgkfhfpv   Lytr-cps2a-psr family protein with bound octaprenyl  ...
2xxq:A klthagiygvdssihtlenlygvdinyyvrlnftsflkmidllggvdvhndqefsalhgkfhfpv   A widespread family of bacterial cell wall assembly proteins
3tel:A klthagiygvdssihtlenlygvdinyyvrlnftsflkmidllggvdvhndqefsalhgkfhfpv   Lytr-cps2a-psr family protein with bound octaprenyl  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P05318 -----------------------------------------------------------------   60S acidic ribosomal protein P1-alpha OS=Saccharomyces  ...
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
2lbf:A -----------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4beh:B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
1dd3:A*-----------------------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
3sge:K -----------------------------------------------------------------   Crystal structure of mab 17.2 in complex with r13 peptide
2yg3:A*lvafvsdekadamfelsaeerkatilaslarylgpkaeepvvyyesdwgseewtrgayaasfdlg×2 Structure-based redesign of cofactor binding in putrescine  ...
2yg5:A lvafvsdekadamfelsaeerkatilaslarylgpkaeepvvyyesdwgseewtrgcyaasfdlg   Structure-based redesign of cofactor binding in putrescine  ...
2yg6:A lvafvsdekadamfelsaeerkatilaslarylgpkaeepvvyyesdwgseewtrgcyaasfdlg   Structure-based redesign of cofactor binding in putrescine  ...
2yg7:A lvafvsdekadamfelsaeerkatilaslarylgpkaeepvvyyesdwgseewtrgcytasfdlg   Structure-based redesign of cofactor binding in putrescine  ...
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
2act:A -----------------------------------------------------------------   Crystallographic refinement of the structure of actinidin  ...
2z6j:A -----------------------------------------------------------------   Crystal structure of s. Pneumoniae enoyl-acyl carrier  ...
3tfl:A gnvhldseqalgfvrerysladgdrdrgrnqqkvivailqkltstealknystiinslqdsiqtn   Lytr-cps2a-psr family protein with bound octaprenyl  ...
2xxq:A gnvhldseqalgfvrerysladgdrdrgrnqqkvivailqkltstealknystiinslqdsiqtn   A widespread family of bacterial cell wall assembly proteins
3tel:A gnvhldseqalgfvrerysladgdrdrgrnqqkvivailqkltstealknystiinslqdsiqtn   Lytr-cps2a-psr family protein with bound octaprenyl  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05318 -----------------------------------------------------------------   60S acidic ribosomal protein P1-alpha OS=Saccharomyces  ...
3izc:t*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
2lbf:A -----------------------------------------------------------------   Solution structure of the dimerization domain of human  ...
3iz5:t*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4beh:B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3j3b:s -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
1s4j:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from homo sapiens
1s4h:A -----------------------------------------------------------------   Nmr structure of cross-reactive peptides from l.  ...
1dd3:A*-----------------------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
3sge:K -----------------------------------------------------------------   Crystal structure of mab 17.2 in complex with r13 peptide
2yg3:A*glhrygadsrtpvgpihfscsdiaaegyqhvdgavrmgqrtaadiiar-----------------×2 Structure-based redesign of cofactor binding in putrescine  ...
2yg5:A glhrygadsrtpvgpihfscsdiaaegyqhvdgavrmgqrtaadiiars----------------   Structure-based redesign of cofactor binding in putrescine  ...
2yg6:A glhrygadsrtpvgpihfscsdiaaegyqhvdgavrmgqrtaadiiar-----------------   Structure-based redesign of cofactor binding in putrescine  ...
2yg7:A glhrygadsrtpvgpihfscsdiaaegyghvdgavrmgqrtaadiiars----------------   Structure-based redesign of cofactor binding in putrescine  ...
3a1y:A -----------------------------------------------------------------   The structure of archaeal ribosomal stalk p1/p0 complex
2act:A -----------------------------------------------------------------   Crystallographic refinement of the structure of actinidin  ...
2z6j:A -----------------------------------------------------------------   Crystal structure of s. Pneumoniae enoyl-acyl carrier  ...
3tfl:A vpletminlvnaqlesggnykvnsqdlkgtgrmdlpsyampdsnlyvmeiddsslavvkaaiqdv   Lytr-cps2a-psr family protein with bound octaprenyl  ...
2xxq:A vpletminlvnaqlesggnykvnsqdlkgtgrmdlpsyampdsnlyvmeiddsslavvkaaiqdv   A widespread family of bacterial cell wall assembly proteins
3tel:A vpletminlvnaqlesggnykvnsqdlkgtgrmdlpsyampdsnlyvmeiddsslavvkaaiqdv   Lytr-cps2a-psr family protein with bound octaprenyl  ...

           5
           9
       67890                                                               Protein name
       ----+                                                               ------------
P05318 -----                                                               60S acidic ribosomal protein P1-alpha OS=Saccharomyces  ...
3izc:t*-----                                                            ×2 Localization of the large subunit ribosomal proteins into a  ...
4beh:A -----                                                               Solution structure of human ribosomal protein p1.P2 heterodi
2lbf:A -----                                                               Solution structure of the dimerization domain of human  ...
3iz5:t*-----                                                            ×3 Localization of the large subunit ribosomal proteins into a  ...
4beh:B -----                                                               Solution structure of human ribosomal protein p1.P2 heterodi
3j3b:s -----                                                               Structure of the human 60s ribosomal proteins
1s4j:A -----                                                               Nmr structure of cross-reactive peptides from homo sapiens
1s4h:A -----                                                               Nmr structure of cross-reactive peptides from l.  ...
1dd3:A*-----                                                            ×5 Crystal structure of ribosomal protein l12 from thermotoga m
3sge:K -----                                                               Crystal structure of mab 17.2 in complex with r13 peptide
2yg3:A*-----                                                            ×2 Structure-based redesign of cofactor binding in putrescine  ...
2yg5:A -----                                                               Structure-based redesign of cofactor binding in putrescine  ...
2yg6:A -----                                                               Structure-based redesign of cofactor binding in putrescine  ...
2yg7:A -----                                                               Structure-based redesign of cofactor binding in putrescine  ...
3a1y:A -----                                                               The structure of archaeal ribosomal stalk p1/p0 complex
2act:A -----                                                               Crystallographic refinement of the structure of actinidin  ...
2z6j:A -----                                                               Crystal structure of s. Pneumoniae enoyl-acyl carrier  ...
3tfl:A meg--                                                               Lytr-cps2a-psr family protein with bound octaprenyl  ...
2xxq:A megrk                                                               A widespread family of bacterial cell wall assembly proteins
3tel:A megr-                                                               Lytr-cps2a-psr family protein with bound octaprenyl  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P05318. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 106 - - P05318 60S acidic ribosomal protein P1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPP1A PE=1 SV=4
2. 339 98.3% 58 58 470.8 3e-19 3izc:t * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
3. " " " " " "  = 3izs:t *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
4. 278 49.1% 112 114 384.0 2e-14 4beh:A Solution structure of human ribosomal protein p1.P2 heterodi
5. 161 43.1% 65 69 231.4 6.5e-06 2lbf:A Solution structure of the dimerization domain of human ribos protein p1/p2 heterodimer
6. 143 43.6% 55 58 208.6 0.00012 3iz5:t * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
7. " " " " " "  = 3izr:t *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
8. " " " " " "  = 3j61:u *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
9. 156 33.0% 97 116 207.4 0.00014 4beh:B Solution structure of human ribosomal protein p1.P2 heterodi
10. 140 44.2% 52 57 204.7 0.0002 3j3b:s Structure of the human 60s ribosomal proteins
11. 93 100.0% 13 13 153.1 0.15 1s4j:A Nmr structure of cross-reactive peptides from homo sapiens
12. 89 92.3% 13 13 147.8 0.3 1s4h:A Nmr structure of cross-reactive peptides from l. Braziliensis
13. 85 48.6% 37 128 125.0 5.5 1dd3:A * Crystal structure of ribosomal protein l12 from thermotoga m
14. " " " " " "  = 1dd4:A *
Crystal structure of ribosomal protein l12 from thermotoga maritim
15. " " " " " "  = 1giy:I *
Crystal structure of the ribosome at 5.5 a resolution. This file, 1giy, contains the 50s ribosome subunit. The 30s ribosome subunit, three tRNA, and mRNA molecules are in the file 1gix
16. " " " " " "  = 1l1u:3 *
Ternary complex docked in the decoding site of the 30s ribosomal subunit
17. " " " " " "  = 1yl3:I *
Crystal structure of 70s ribosome with thrs operator and trn subunit. The coordinates for the small subunit are in the p 1yl4.
18. 71 90.9% 11 11 125.0 5.5 3sge:K Crystal structure of mab 17.2 in complex with r13 peptide
19. 91 36.2% 47 449 123.5 6.7 2yg3:A * Structure-based redesign of cofactor binding in putrescine oxidase: wild type enzyme
20. " " " " " "  = 2yg4:A *
Structure-based redesign of cofactor binding in putrescine oxidase: wild type bound to putrescine
21. 91 36.2% 47 450 123.5 6.7 2yg5:A Structure-based redesign of cofactor binding in putrescine oxidase: a394c mutant
22. 91 36.2% 47 449 123.5 6.7 2yg6:A Structure-based redesign of cofactor binding in putrescine oxidase: p15i-a394c double mutant
23. 91 36.2% 47 450 123.5 6.7 2yg7:A Structure-based redesign of cofactor binding in putrescine oxidase: a394c-a396t-q431g triple mutant
24. 79 34.0% 50 58 123.0 7.1 3a1y:A The structure of archaeal ribosomal stalk p1/p0 complex
25. 86 27.7% 83 217 122.3 7.8 2act:A Crystallographic refinement of the structure of actinidin at 1.7 angstroms resolution by fast fourier least-squares methods
26. 87 39.2% 51 307 121.0 9.1 2z6j:A Crystal structure of s. Pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor
27. 86 38.4% 73 371 118.3 13 3tfl:A Lytr-cps2a-psr family protein with bound octaprenyl pyrophos lipid
28. 86 38.4% 73 373 118.2 13 2xxq:A A widespread family of bacterial cell wall assembly proteins
29. 86 38.4% 73 372 118.2 13 3tel:A Lytr-cps2a-psr family protein with bound octaprenyl pyrophos lipid and manganese ion

Number of sequences: 29

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 86 38.4% 73 372 118.2 13 3tep:A Lytr-cps2a-psr family protein with bound octaprenyl pyrophos lipid and magnesium ion
2. 82 28.2% 85 218 117.0 15 1aec:A Crystal structure of actinidin-e-64 complex+
3. 73 37.0% 46 48 116.4 16 2zkr:g Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
4. 84 38.9% 72 374 115.5 19 2xxp:A A widespread family of bacterial cell wall assembly proteins
5. 84 38.9% 72 374 115.5 19 4de8:A Lytr-cps2a-psr family protein with bound octaprenyl monophos lipid
6. 79 28.2% 85 218 112.9 26 1f3q:A * Model structure of actinidin in complex with zpack (n- benzyloxycarbonyl-l-phenyl alanyl-l-alanine chloromethyl ketone)
7. " " " " " "  = 1fog:A *
Theoretical model structure of actinidin with different biologically important inhibitors
8. " " " " " "  = 1ftv:A *
Theoretical model structure of actinidin with different biologically important inhibitors
9. 80 32.9% 73 275 112.5 27 4f3v:A Crystal structure of n-terminal domain of ecca1 atpase from secretion system of mycobacterium tuberculosis
10. 76 29.2% 65 138 112.4 28 2yyh:A Crystal structure of nudix family protein from aquifex aeoli
11. 75 27.6% 87 132 111.4 31 1ors:C X-ray structure of the kvap potassium channel voltage sensor in complex with an fab
12. 80 26.5% 83 332 111.1 33 1w5e:A Ftsz w319y mutant, p1 (m. Jannaschii)
13. 80 26.5% 83 334 111.0 33 1fsz:A Crystal structure of the cell-division protein ftsz at 2.8a resolution
14. 80 26.5% 83 334 111.0 33 1w5a:A * Ftsz dimer, mggtp soak (m. Jannaschii)
15. " " " " " "  = 1w5b:A *
Ftsz dimer, gtp soak (m. Jannaschii)
16. 80 26.5% 83 335 111.0 33 2vap:A Ftsz gdp m. Jannaschii
17. 80 26.5% 83 338 110.9 33 1w58:1 Ftsz gmpcpp soak i213 (m. Jannaschii)
18. 80 26.5% 83 350 110.7 34 1w59:A Ftsz dimer, empty (m. Jannaschii)
19. 75 27.6% 87 147 110.6 35 2kyh:A Solution structure of the voltage-sensing domain of kvap
20. 79 30.3% 66 311 110.2 36 4h18:A Three dimensional structure of corynomycoloyl tranferasE C
21. 75 30.6% 62 160 110.0 38 1q5x:A Structure of of rraa (meng), a protein inhibitor of RNA processing
22. 75 30.6% 62 158 110.0 37 2yjt:A * Crystal structure of e. Coli dead-box protein srmb bound to regulator of ribonuclease activity a (rraa)
23. " " " " " "  = 2yjv:A *
Crystal structure of e. Coli regulator of ribonuclease activ (rraa) bound to fragment of dead-box protein rhlb
24. 76 26.5% 83 219 108.9 43 1act Hydrolase (proteinase)
25. 76 27.6% 87 223 108.8 44 1orq:C X-ray structure of a voltage-dependent potassium channel in with an fab
26. 78 37.2% 43 339 108.2 47 3n6z:A Crystal structure of a putative immunoglobulin a1 protease (bacova_03286) from bacteroides ovatus at 1.30 a resolution

Number of sequences: 26

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer