spacer
spacer

SAS results for UniProt accession no. P87262

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P87262 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P87262 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 29 unique sequences (including 14 consensus sequences) giving 131 sequence matches in all. The 30 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A -------rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqy    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*-----------------------------------------------------------------×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A -----------------------------------mtqaeiklcslllqehfgeivekigvhlir    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqvspfnh    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A --rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqvspf    Structure of human aldh4a1 crystallized in space group p21
3v9g:A rwkhtsslkvanepvlaftqgsperdalqkalkdlkgrmeaipcvvgdeevwtsdvqyqvspfnh    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*-------lkvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsdiqyqlspfnh×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*--------kvanepilafsqgsperdalqkalkdlkgqteaipcvvgdeevwtsdiqyqlspfnh×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A qvspfnhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprraeila    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*-----------------------------------------------------------------×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A tgsqplrviahdtgtsldqvkkalcvlvqhnlvsyqvhkrgvveyeaqcsrvlrmlrypryiytt    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A ghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprraeilaktmvgqg    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A nhghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprraeilaktmvg    Structure of human aldh4a1 crystallized in space group p21
3v9g:A ghkvakfcyadksllnkaieaalaarkewdlkpiadraqiflkaadmlsgprraeilaktmvgqg    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*ahkvakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsgprraevlaktmvgqg×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*ahkvakfcyadkallnraidaalaarkewdlkpmadraqvflkaadmlsgprraevlaktmvgqg×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A ktmvgqgktviqaeidaaaelidffrfnakyavelegpstnstvyrglegfvaaispfnftaigg    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*-----------------------------------------------------------------×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A ktlysdtgeliveelllngkltmsavvkkvadrltetmedgktmdyaevsntfvrladthfvqrc    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A ktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrglegfvaaispfnftaigg    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A qgktviqaeidaaaelidffrfnakyavelegqqpisvstnstvyrglegfvaaispfnftaigg    Structure of human aldh4a1 crystallized in space group p21
3v9g:A ktviqaeidaaaelidffrfnakyavelegqqpisvppstnstvyrglegfvaaispfnftaigg    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*ktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvyrglegfvaaispfnftaigg×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*ktviqaeidaaaelidffrfnakfavelegeqpisvppstnhtvyrglegfvaaispfnftaigg×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P87262 --------------------------------------------------maqrvtfrrrnpynt    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*--------------------------------------------------maqrvtfrrrnpynt×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*---------------------------------------------------aqrvtfrrrnpynt×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g --------------------------------------------------mvqrltlrrrlsynt    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*---------------------------------------------------aqrityrrrcsynt×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g ---------------------------------------------------vqrltyrrrlsynt    Structure of the human 60s ribosomal proteins
3iz5:i*--------------------------------------------------mvqrltyrkrhsyat×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g --------------------------------------------------mvqrltyrkrhsyat    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 ---------------------------------------------------------rrrcsynt    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j --------------------------------------------------scprvqyrrrmhyat    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*----------------------------------------------------------mkpmyrs×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A nlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfvpadgplfgdtvtssehlcgi    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*--------------------mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsg×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*-------------------------------------------------knikgikfgilspdei×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A psvdgiywqanldrfhqhfrdqaivsavanrmdqtsseivrtmlrmseittsssapftqplssne    Human rpc62 subunit structure
3j21:j*------------------------------mkypkqirtycpfckkhtihkvervkkrprselsa×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A nlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfvpadgplfgdtvtssehlcgi    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A nlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfvpadgplfgdtvtssehlcgi    Structure of human aldh4a1 crystallized in space group p21
3v9g:A nlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfvpadgplfgdtvtssehlcgi    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*nlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfvpadgptfgdtvtssehlcgi×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*nlagapalmgnvvlwkpsdtamlasyavyrilreaglppniiqfvpadgptfgdtvtssehlcgi×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P87262 rsnkik-vvktpggil--raqh------vkklatrp-----k--cgd----c-gsa-lqgistlr    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*rsnkik-vvktpggil--raqh------vkklatrp-----k--cgd----c-gsa-lqgistlr×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*rsnkik-vvktpggil--raqh------vkklatrp-----k--cgd----c-gsa-lqgistlr×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g rsnkrr-ivrtpggrl--vyqy------vkknptvp-----r--cgq----c-kek-lhgitpsr    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*rsnkvr-kvktpggrl--vaqy------vkkvvnyt-----k--cseag--c-nva-lngiaqvr×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g asnktr-lsrtpgnri--vyly------tkkvgkap-----ksacgv----c-pgr-lrgvravr    Structure of the human 60s ribosomal proteins
3iz5:i*ksnqtr-vvktpggkl--vyqy------tkkrasgp-----k--cpv----t-gkk-iqgiphlr×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g ksnqtr-vvktpggkl--vyqy------tkkrasgp-----k--cpv----t-gkk-iqgiphlr    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 rsnkvr-kvktpggrl--vaqy------vkkvvnyt-----k--cseag--c-nva-lngiaqvr    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j rgnrmr-lvrtpgnrl--vmqk------rgkrsqgp-----h--tpw----vlghkrlagtkalr    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*rswrrk-yvrtpggrv--vihf------erkkpkia-----h--cam----c-grp-lngiprgr×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A nftgsv-ptfkhlwkq--vaqn------ldrfhtfp-----rl-age----c-gkn-fhfvhrsa    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*igndgk-fskvpgg-----dkp------tkktdlky-----r--cge----c-gka-hlregwra×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*rkmsvt-aiitpgsvmdprlgv------iepgqkcp-----t--cgntlgnc-pgh-fghielvr×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A ifrslp-vgyniskqv--ldqy------ltlladdplefvgk--sgd----s-ggg-myvin-lh    Human rpc62 subunit structure
3j21:j*gqrrfrrilkgyggfp--rpkpegrekpvkkldlrf-----r--cte----c-gka-htrgrgfr×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A nftgsv-ptfkhlwkq--vaqn------ldrfhtfp-----rl-age----c-ggk-nfhfvhrs    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A nftgsv-ptfkhlwkq--vaqn------ldrfhtfp-----rl-age----c-ggk-nfhfvhrs    Structure of human aldh4a1 crystallized in space group p21
3v9g:A nftgsv-ptfkhlwkq--vaqn------ldrfhtfp-----rl-age----c-ggk-nfhfvhrs    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*nftgsv-ptfkhlwrq--vaqn------ldrfrtfp-----rl-age----c-ggk-nfhfvhss×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*nftgsv-ptfkhlwrq--vaqn------ldrfrtfp-----rl-age----c-ggk-nfhfvhss×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P87262 prqyat--vskthktvsraygg--srcancvkeri-------iraflieeqkivkkvvkeqteaa    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*prqyat--vskthktvsraygg--srcancvkeri-------iraflieeqkivkkvvkeqteaa×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*prqyat--vskthktvsraygg--srcancvkeri-------iraflieeqkivkkvvkeqteaa×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g pserpr--mskrlktvsrtygg--vlchsclreri-------vraflieeqkivk-alksqreal    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*paeyat--iarsaktvsrvygg--elchtcvrsri-------iraflteevkivkrkmis-----×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g pkvlmr--lsktkkhvsraygg--smcakcvrdri-------kraflieeqkivvkvlkaqaqsq    Structure of the human 60s ribosomal proteins
3iz5:i*pteykrprlsrnrrtvnrpygg--vlsgpavreri-------iraflveeqkivkkvlkiqktke×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g pteykrprlsrnrrtvnrpygg--vlsgpavreri-------iraflveeqkivkkvlkiq----    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 paeyat--iarsaktvsrvygg--elchtcvrsri-------iraflt-----------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j htkarl--aprhqkttsrpygg--vlsheqvrdri-------vraflieeqrivkralkahakvq    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*pvemrk--lpktkkrperpmphlcprcmrkvmkeq-------iraqls-----------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A dve-sv--vsgtlrs-afeygg--qkcsaclrlyvphslwpqikgrlleehsrikvgdpaedfgt    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*grlefq--e--------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*pvihvg--fvk-h---vyeflk--atcrrcgrvki-------sedeiekysriynaikkrwpsaa×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A kalasl--atatlesvvqerfg--srca-----ri-------frlvlqkeqkqvedfamipakea    Human rpc62 subunit structure
3j21:j*vkkfel--veg------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A advesv--vsgtlrs-afeygg--qkcsacarlyvphslwpqikgrlleehsrikvgdpaedfgt    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A advesv--vsgtlrs-afeygg--qkcsacsrlyvphslwpqikgrlleehsrikvgdpaedfgt    Structure of human aldh4a1 crystallized in space group p21
3v9g:A advesv--vsgtlrs-afeygg--qkcsacsrlyvphslwpqikgrlleehsrikvgdpaedfgt    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*advdsv--vsgtlrs-afeygg--qkcsacsrlyvpkslwpqikgrlleehsrikvgdpaedfgt×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*advdsv--vsgtlrs-afeygg--qkcsacsrlyvpkslwpqikgrlleehsrikvgdpaedfgt×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P87262 kksekkakk--------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*kksekk-----------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*k----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g vk---------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g k----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*kttks------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j kekkrraakrkskeekvaavakkvaakvgaksviakkeapkrkagkap-----------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A ffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqepimkeeifgp    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*rrlteyvkktamkaqvcphcgekqfkiltpsdirerlekvpesdveilgydpttsrpewmiltvl×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A kdmlykmlsenfmvnilsaarmllhrcyksianlierrqfetkenkrlleksqrveaiiasmqlq    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A ffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqepimkeeifgp    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A ffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqepimkeeifgp    Structure of human aldh4a1 crystallized in space group p21
3v9g:A ffsavidaksfarikkwleharsspsltilaggkcddsvgyfvepciveskdpqepimkeeifgp    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*ffsavidakafarikkwleharsspslsilaggqcnesvgyyvepciieskdpqepimkeeifgp×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*ffsavidakafarikkwleharsspslsilaggqcnesvgyyvepciieskdpqepimkeeifgp×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A vlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaagnfyindkstilrwt    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*pvppitirpsimaeddlthklvdivrinerlkesidagapqliiedlwdllqyhvatyfdneipg×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A eieemitaperqqletlkrnvnkldaseiqvdetifllesyiectmk------------------    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A vlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaagnfyindkstgsivg    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A vlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaagnfyindkstgshyi    Structure of human aldh4a1 crystallized in space group p21
3v9g:A vlsvyvypddkyketlqlvdsttsygltgavfsqdkdvvqeatkvlrnaagnfyindkstgsivg    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*vltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrmlrnaagnfyindkstgsvvg×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*vltvyvypddkyretlklvdsttsygltgavfaqdkaivqeatrmlrnaagnfyindkstgsvvg×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A spqvikethkplgdwsyaym---------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*lppskhrsgrplrtlaqrlkgkegrfrgnlsgkrvdfssrtvispdpnisidevgvpeiiartlt×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A -----------------------------------------------------------------    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A qqpfggarasgtndkpggphyilrwtspqvikethkplgdwsyaymq------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A lrwtspqviketh----------------------------------------------------    Structure of human aldh4a1 crystallized in space group p21
3v9g:A qqpfggarasgtndkpggphyilrwtspqvikethkplgdwsyaymq------------------    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*qqpfggarasgtndkpggphyilrwtspqvikethkplgdwrysymq------------------×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*qqpfggarasgtndkpggphyilrwtspqvikethkplgdwrysymq------------------×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*vperitpwnieklrqfvingpdkwpganyvirpdgrridlryvkdrkelastlapgyvverhltd×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A -----------------------------------------------------------------    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A -----------------------------------------------------------------    Structure of human aldh4a1 crystallized in space group p21
3v9g:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*-----------------------------------------------------------------×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*-----------------------------------------------------------------×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

                6         6         6         6         7         7     
                6         7         8         9         0         1     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*gdvvlfnrqpslhrismmahrvrvlkgltfrlnllvcppynadfdgdemnlhvpqseeaiaeake×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A -----------------------------------------------------------------    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A -----------------------------------------------------------------    Structure of human aldh4a1 crystallized in space group p21
3v9g:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*-----------------------------------------------------------------×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*-----------------------------------------------------------------×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

           7         7         7         7         7         7         7
           2         3         4         5         6         7         8
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*imlvhkniitpryggpiigaaqdyisgaylltvkttlltkeeaqqilgvadvkidlgepailapr×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A -----------------------------------------------------------------    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A -----------------------------------------------------------------    Structure of human aldh4a1 crystallized in space group p21
3v9g:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*-----------------------------------------------------------------×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*-----------------------------------------------------------------×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

                7         8         8         8         8         8     
                9         0         1         2         3         4     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*eyytgkqvvsaflpkdfnfhgqanvssgprlcknedcphdsyvvikngillegvfdkkaignqqp×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A -----------------------------------------------------------------    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A -----------------------------------------------------------------    Structure of human aldh4a1 crystallized in space group p21
3v9g:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*-----------------------------------------------------------------×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*-----------------------------------------------------------------×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

           8         8         8         8         8         9         9
           5         6         7         8         9         0         1
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*esilhwlikeysdeygkwlmdnlfrvfirfvelqgftmrledvslgddvkkeiyneidrakvevd×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A -----------------------------------------------------------------    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A -----------------------------------------------------------------    Structure of human aldh4a1 crystallized in space group p21
3v9g:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*-----------------------------------------------------------------×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*-----------------------------------------------------------------×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

                9         9         9         9         9         9     
                2         3         4         5         6         7     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*nliqkykngelepipgrtleeslenyildtldklrstagdiaskyldpfnfayvmartgargsvl×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A -----------------------------------------------------------------    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A -----------------------------------------------------------------    Structure of human aldh4a1 crystallized in space group p21
3v9g:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*-----------------------------------------------------------------×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*-----------------------------------------------------------------×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

                               1         1         1         1         1
           9         9         0         0         0         0         0
           8         9         0         1         2         3         4
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*nitqmaamlgqqsvrgerikrgymtrtlphfkpydispeargfiyssfrtglkptelffhaaggr×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A -----------------------------------------------------------------    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A -----------------------------------------------------------------    Structure of human aldh4a1 crystallized in space group p21
3v9g:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*-----------------------------------------------------------------×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*-----------------------------------------------------------------×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

                1         1         1         1         1         1     
                0         0         0         0         0         1     
                5         6         7         8         9         0     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P87262 -----------------------------------------------------------------    60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3iz5:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*eglvdtavrtsqsgymqrrlinalsdlraeydgtvrslygeviqvaygddgvfpmysahgktvdv×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A -----------------------------------------------------------------    Human rpc62 subunit structure
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A -----------------------------------------------------------------    Structure of human aldh4a1 crystallized in space group p21
3v9g:A -----------------------------------------------------------------    Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*-----------------------------------------------------------------×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*-----------------------------------------------------------------×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

           1      
           1      
           1      
       67890123456                                                          Protein name
       ----+------                                                          ------------
P87262 -----------                                                          60S ribosomal protein L34-A OS=Saccharomyces cerevisiae  ...
3izc:i*-----------                                                      ×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:g*-----------                                                      ×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3j39:g -----------                                                          Structure of the d. Melanogaster 60s ribosomal proteins
4a18:L*-----------                                                      ×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j3b:g -----------                                                          Structure of the human 60s ribosomal proteins
3iz5:i*-----------                                                      ×2  Localization of the large subunit ribosomal proteins into a  ...
3j61:g -----------                                                          Localization of the large subunit ribosomal proteins into a  ...
4adx:4 -----------                                                          The cryo-em structure of the archaeal 50s ribosomal subunit  ...
3zf7:j -----------                                                          High-resolution cryo-electron microscopy structure of the  ...
3j21:d*-----------                                                      ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9i:A -----------                                                          Crystal structure of human 1-pyrroline-5-carboxylate  ...
1ffk:Z*-----------                                                      ×68 Crystal structure of the large ribosomal subunit from  ...
2waq:A*nrifervvgwk                                                      ×2  The complete structure of the archaeal 13-subunit DNA-  ...
2xub:A -----------                                                          Human rpc62 subunit structure
3j21:j*-----------                                                      ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3v9h:A -----------                                                          Crystal structure of human 1-pyrroline-5-carboxylate  ...
4oe5:A -----------                                                          Structure of human aldh4a1 crystallized in space group p21
3v9g:A -----------                                                          Crystal structure of human 1-pyrroline-5-carboxylate dehydro
3v9k:A*-----------                                                      ×2  Crystal structure of mouse 1-pyrroline-5-carboxylate  ...
4lgz:A*-----------                                                      ×2  Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P87262. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 121 - - P87262 60S ribosomal protein L34-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL34A PE=1 SV=1
2. 762 100.0% 118 118 1008.6 3.3e-49 3izc:i * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
3. " " " " " "  = 3izs:i *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
4. 726 100.0% 112 112 961.7 1.4e-46 3u5e:g * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
5. " " " " " "  = 3u5i:g *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
6. " " " " " "  = 4b6a:g *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
7. " " " " " "  = 4byn:g *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
8. " " " " " "  = 4byu:g *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
9. 414 57.9% 114 113 553.0 8e-24 3j39:g Structure of the d. Melanogaster 60s ribosomal proteins
10. 408 59.6% 104 108 545.3 2.1e-23 4a18:L * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
11. " " " " " "  = 4a19:L *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
12. " " " " " "  = 4a1b:L *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
13. " " " " " "  = 4a1d:L *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
14. 380 53.1% 113 114 508.4 2.4e-21 3j3b:g Structure of the human 60s ribosomal proteins
15. 378 51.7% 118 119 505.6 3.5e-21 3iz5:i * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
16. " " " " " "  = 3izr:i *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
17. 374 54.5% 110 110 500.7 6.5e-21 3j61:g Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
18. 343 58.4% 89 90 461.1 1e-18 4adx:4 The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
19. 261 39.2% 120 162 350.8 1.5e-12 3zf7:j High-resolution cryo-electron microscopy structure of the tr brucei ribosome
20. 135 34.5% 84 89 188.7 0.0016 3j21:d * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
21. " " " " " "  = 3j44:d *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
22. 93 25.3% 79 506 125.2 5.3 3v9i:A Crystal structure of human 1-pyrroline-5-carboxylate dehydro mutant s352l
23. 84 34.9% 43 92 121.7 8.4 1ffk:Z * Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
24. " " " " " "  = 1jj2:2 *
Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
25. " " " " " "  = 1k73:4 *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
26. " " " " " "  = 1k8a:4 *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
27. " " " " " "  = 1k9m:4 *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
28. " " " " " "  = 1kc8:4 *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
29. " " " " " "  = 1kd1:4 *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
30. " " " " " "  = 1kqs:2 *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
31. " " " " " "  = 1m1k:4 *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
32. " " " " " "  = 1m90:4 *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
33. " " " " " "  = 1n8r:4 *
Structure of large ribosomal subunit in complex with virginiamycin m
34. " " " " " "  = 1nji:4 *
Structure of chloramphenicol bound to the 50s ribosomal subunit
35. " " " " " "  = 1q7y:4 *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
36. " " " " " "  = 1q81:4 *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
37. " " " " " "  = 1q82:4 *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
38. " " " " " "  = 1q86:4 *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
39. " " " " " "  = 1qvf:2 *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
40. " " " " " "  = 1qvg:2 *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
41. " " " " " "  = 1s72:3 *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
42. " " " " " "  = 1vq4:3 *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
43. " " " " " "  = 1vq5:3 *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
44. " " " " " "  = 1vq6:3 *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
45. " " " " " "  = 1vq7:3 *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
46. " " " " " "  = 1vq8:3 *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
47. " " " " " "  = 1vq9:3 *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
48. " " " " " "  = 1vqk:3 *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
49. " " " " " "  = 1vql:3 *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
50. " " " " " "  = 1vqm:3 *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
51. " " " " " "  = 1vqn:3 *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
52. " " " " " "  = 1vqo:3 *
The structure of ccpmn bound to the large ribosomal subunit marismortui
53. " " " " " "  = 1vqp:3 *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
54. " " " " " "  = 1w2b:2 *
Trigger factor ribosome binding domain in complex with 50s
55. " " " " " "  = 1yhq:3 *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
56. " " " " " "  = 1yi2:3 *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
57. " " " " " "  = 1yij:3 *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
58. " " " " " "  = 1yit:3 *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
59. " " " " " "  = 1yj9:3 *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
60. " " " " " "  = 1yjn:3 *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
61. " " " " " "  = 1yjw:3 *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
62. " " " " " "  = 2otj:3 *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
63. " " " " " "  = 2otl:3 *
Girodazole bound to the large subunit of haloarcula marismor
64. " " " " " "  = 2qa4:3 *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
65. " " " " " "  = 2qex:3 *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
66. " " " " " "  = 3cc2:3 *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
67. " " " " " "  = 3cc4:3 *
Co-crystal structure of anisomycin bound to the 50s ribosoma
68. " " " " " "  = 3cc7:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
69. " " " " " "  = 3cce:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
70. " " " " " "  = 3ccj:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
71. " " " " " "  = 3ccl:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
72. " " " " " "  = 3ccm:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
73. " " " " " "  = 3ccq:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
74. " " " " " "  = 3ccr:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
75. " " " " " "  = 3ccs:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
76. " " " " " "  = 3ccu:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
77. " " " " " "  = 3ccv:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
78. " " " " " "  = 3cd6:3 *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
79. " " " " " "  = 3cma:3 *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
80. " " " " " "  = 3cme:3 *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
81. " " " " " "  = 3cpw:2 *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
82. " " " " " "  = 3cxc:2 *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
83. " " " " " "  = 3g4s:3 *
Co-crystal structure of tiamulin bound to the large ribosoma
84. " " " " " "  = 3g6e:3 *
Co-crystal structure of homoharringtonine bound to the large subunit
85. " " " " " "  = 3g71:3 *
Co-crystal structure of bruceantin bound to the large riboso subunit
86. " " " " " "  = 3i55:3 *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
87. " " " " " "  = 3i56:3 *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
88. " " " " " "  = 3ow2:2 *
Crystal structure of enhanced macrolide bound to 50s ribosom
89. " " " " " "  = 4adx:3 *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
90. " " " " " "  = 4hub:3 *
The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
91. 89 20.3% 123 841 117.5 14 2waq:A * The complete structure of the archaeal 13-subunit DNA- directed RNA polymerase
92. " " " " " "  = 2wb1:A *
The complete structure of the archaeal 13-subunit DNA- directed RNA polymerase
93. 86 31.4% 86 433 116.8 16 2xub:A Human rpc62 subunit structure
94. 79 27.1% 70 94 115.1 20 3j21:j * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
95. " " " " " "  = 3j44:j *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
96. 85 25.3% 79 541 114.4 21 3v9h:A Crystal structure of human 1-pyrroline-5-carboxylate dehydro mutant s352a
97. 83 25.3% 79 505 112.1 29 4oe5:A Structure of human aldh4a1 crystallized in space group p21
98. 83 25.3% 79 541 111.8 30 3v9g:A Crystal structure of human 1-pyrroline-5-carboxylate dehydro
99. 82 25.3% 79 534 110.6 35 3v9k:A * Crystal structure of mouse 1-pyrroline-5-carboxylate dehydro complexed with the product glutamate
100. " " " " " "  = 3v9l:A *
Crystal structure of mouse 1-pyrroline-5-carboxylate dehydro complexed with NAD+
101. 82 25.3% 79 533 110.6 35 4lgz:A * Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase ( complexed with acetate
102. " " " " " "  = 4lh0:A *
Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase ( complexed with glyoxylate

Number of sequences: 102

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 82 25.3% 79 534 110.6 35 4lh1:A * Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase ( complexed with malonate
2. " " " " " "  = 4lh2:A *
Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase ( complexed with succinate
3. 82 25.3% 79 533 110.6 35 4lh3:A Structure of mouse 1-pyrroline-5-carboxylate dehydrogenase ( complexed with glutarate
4. 82 25.3% 79 544 110.5 35 3v9j:A Crystal structure of mouse 1-pyrroline-5-carboxylate dehydro complexed with sulfate ion
5. 82 25.3% 79 543 110.5 35 4e3x:A Crystal structure of mus musculus 1-pyrroline-5-carboxylate dehydrogenase cryoprotected in proline
6. 73 31.1% 61 66 108.9 43 2lri:C Nmr structure of the second phd finger of aire (aire-phd2)
7. 71 40.5% 37 40 108.7 44 4ejc:4 Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit.
8. 71 40.5% 37 44 108.3 47 2xqe:4 * The structure of ef-tu and aminoacyl-tRNA bound to the 70s ribosome with a gtp analog
9. " " " " " "  = 2y0v:4 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
10. " " " " " "  = 2y0x:4 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
11. " " " " " "  = 2y0z:4 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
12. " " " " " "  = 2y11:4 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
13. " " " " " "  = 2y13:4 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
14. " " " " " "  = 2y15:4 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a cognate codon on the 70s ribosome.
15. " " " " " "  = 2y17:4 *
Ef-tu complex 3
16. " " " " " "  = 2y19:4 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
17. 71 40.5% 37 45 108.2 48 2wro:4 * The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 2 of 4).
18. " " " " " "  = 2wrr:4 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 4 of 4).
19. " " " " " "  = 3zvp:4 *
Crystal structure of the hybrid state of ribosome in complex the guanosine triphosphatase release factor 3
20. " " " " " "  = 4abs:4 *
Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin w 70s ribosome
21. 71 40.5% 37 46 108.1 48 3uxq:4 * The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
22. " " " " " "  = 3uxr:4 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
23. " " " " " "  = 3v23:4 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
24. " " " " " "  = 3v25:4 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 2nd ribosom asu
25. " " " " " "  = 3v27:4 *
Crystal structure of hpf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
26. " " " " " "  = 3v29:4 *
Crystal structure of hpf bound to the 70s ribosome. This ent contains the 50s subunit of the 2nd molecule in the asu.
27. " " " " " "  = 3v2d:4 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 1st ribosom asu
28. " " " " " "  = 3v2f:4 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 2nd ribosom asu
29. " " " " " "  = 4dha:4 *
Crystal structure of yaej bound to the 70s ribosome
30. " " " " " "  = 4dhc:4 *
Crystal structure of yaej bound to the 70s ribosome

Number of sequences: 30

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer