spacer
spacer

SAS results for UniProt accession no. P0C2H6

Sequence annotated by structure
>

Key:
Sec. struc: By homology
  Helix Strand  

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

 

FASTA alignment for UniProt accession no. P0C2H6 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P0C2H6 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 21 unique sequences (including 6 consensus sequences) giving 34 sequence matches in all. The 1 sequences excluded from the alignment is listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P0C2H6 -----------------------------------------------------------------   60S ribosomal protein L27-A OS=Saccharomyces cerevisiae  ...
3u5e:Z*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3j61:Z -----------------------------------------------------------------   Localization of the large subunit ribosomal proteins into a  ...
4a18:N*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:a -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3iz5:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j21:5*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2zzm:A -----------------------------------------------------------------   The complex structure of atrm5 and trnaleu
2zzn:A -----------------------------------------------------------------   The complex structure of atrm5 and trnacys
4dq1:A -----------------------------------------------------------------   Thymidylate synthase from staphylococcus aureus.
1r6z:P ieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwahdr   The crystal structure of the argonaute2 paz domain (as a mbp
2gxa:A -----------------------------------------------------------------   Crystal structure of papillomavirus e1 hexameric helicase  ...
2v9p:A -----------------------------------------------------------------   Crystal structure of papillomavirus e1 hexameric helicase  ...
3j39:E -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:G*-----------------------------------------------------------------×4 Localization of the large subunit ribosomal proteins into a  ...
2kds:A -----------------------------------------------------------------   Structure of ribosomal protein l14e from sulfolobus solfatar
2joy:A -----------------------------------------------------------------   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
4oc9:A -----------------------------------------------------------------   2.35 angstrom resolution crystal structure of putative o-  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P0C2H6 -----------------------------------------------------------------   60S ribosomal protein L27-A OS=Saccharomyces cerevisiae  ...
3u5e:Z*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3j61:Z -----------------------------------------------------------------   Localization of the large subunit ribosomal proteins into a  ...
4a18:N*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:a -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3iz5:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j21:5*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2zzm:A -----------------------------------------------------------------   The complex structure of atrm5 and trnaleu
2zzn:A -----------------------------------------------------------------   The complex structure of atrm5 and trnacys
4dq1:A -----------------------------------------------------------------   Thymidylate synthase from staphylococcus aureus.
1r6z:P fggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpnppktwee   The crystal structure of the argonaute2 paz domain (as a mbp
2gxa:A -----------------------------------------------------------------   Crystal structure of papillomavirus e1 hexameric helicase  ...
2v9p:A -----------------------------------------------------------------   Crystal structure of papillomavirus e1 hexameric helicase  ...
3j39:E -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:G*-----------------------------------------------------------------×4 Localization of the large subunit ribosomal proteins into a  ...
2kds:A -----------------------------------------------------------------   Structure of ribosomal protein l14e from sulfolobus solfatar
2joy:A -----------------------------------------------------------------   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
4oc9:A ------------------------------------------fnketlalhgaynfdtqrsisvp   2.35 angstrom resolution crystal structure of putative o-  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P0C2H6 -----------------------------------------------------------------   60S ribosomal protein L27-A OS=Saccharomyces cerevisiae  ...
3u5e:Z*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3j61:Z -----------------------------------------------------------------   Localization of the large subunit ribosomal proteins into a  ...
4a18:N*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:a -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3iz5:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j21:5*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2zzm:A -----------------------------------------------------------------   The complex structure of atrm5 and trnaleu
2zzn:A -----------------------------------------------------------------   The complex structure of atrm5 and trnacys
4dq1:A -----------------------------------------------------------------   Thymidylate synthase from staphylococcus aureus.
1r6z:P ipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvdnagakagltflv   The crystal structure of the argonaute2 paz domain (as a mbp
2gxa:A -----------------------------------------------------------------   Crystal structure of papillomavirus e1 hexameric helicase  ...
2v9p:A -----------------------------------------------------------------   Crystal structure of papillomavirus e1 hexameric helicase  ...
3j39:E -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:G*-----------------------------------------------------------------×4 Localization of the large subunit ribosomal proteins into a  ...
2kds:A -----------------------------------------------------------------   Structure of ribosomal protein l14e from sulfolobus solfatar
2joy:A -----------------------------------------------------------------   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
4oc9:A iyqntaynfenldqaaarfnlqelgniysrlsnptsdvlgqrlanveggafgipvasgmaacfya   2.35 angstrom resolution crystal structure of putative o-  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P0C2H6 -----------------------------------------------------------------   60S ribosomal protein L27-A OS=Saccharomyces cerevisiae  ...
3u5e:Z*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3j61:Z -----------------------------------------------------------------   Localization of the large subunit ribosomal proteins into a  ...
4a18:N*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:a -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3iz5:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j21:5*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2zzm:A -----------------------------------------------------------------   The complex structure of atrm5 and trnaleu
2zzn:A -----------------------------------------------------------------   The complex structure of atrm5 and trnacys
4dq1:A -----------------------------------------------------------------   Thymidylate synthase from staphylococcus aureus.
1r6z:P dliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvtvlptfkgqpskpfvgv   The crystal structure of the argonaute2 paz domain (as a mbp
2gxa:A -----tekfdfgtmvqwaydhkyaeeskiayeyalaagsdsnaraflatnsqakhvkdcatmvrh   Crystal structure of papillomavirus e1 hexameric helicase  ...
2v9p:A --tlneskfdfgtmvqwaydhkyaeeskiayeyalaagsdsnaraflatnsqakhvkdcatmvrh   Crystal structure of papillomavirus e1 hexameric helicase  ...
3j39:E -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:G*-----------------------------------------------------------------×4 Localization of the large subunit ribosomal proteins into a  ...
2kds:A -----------------------------------------------------------------   Structure of ribosomal protein l14e from sulfolobus solfatar
2joy:A -----------------------------------------------------------------   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
4oc9:A linlassgdnvaysnkiyggtqtlishtlknfgiearefdiddldslekvidqntkaiffeslsn   2.35 angstrom resolution crystal structure of putative o-  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P0C2H6 -----------------------------------------------------------------   60S ribosomal protein L27-A OS=Saccharomyces cerevisiae  ...
3u5e:Z*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3j61:Z -----------------------------------------------------------------   Localization of the large subunit ribosomal proteins into a  ...
4a18:N*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:a -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3iz5:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j21:5*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2zzm:A -----------------------------------------------------------------   The complex structure of atrm5 and trnaleu
2zzn:A -----------------------------------------------------------------   The complex structure of atrm5 and trnacys
4dq1:A -----------------------------------------------------------------   Thymidylate synthase from staphylococcus aureus.
1r6z:P lsaginaaspnkelakeflenylltdegleavnkdkplgavalksyeeelakdpriaatmenaqk   The crystal structure of the argonaute2 paz domain (as a mbp
2gxa:A ylraetqalsmpayikarcklatgegswksiltffnyqnielitfinalklwlkgipkknclafi   Crystal structure of papillomavirus e1 hexameric helicase  ...
2v9p:A ylraetqalsmpayikarcklatgegswksiltffnyqnielitfinalklwlkgipkknclafi   Crystal structure of papillomavirus e1 hexameric helicase  ...
3j39:E --------kgkkhpvnsylkggilryskaqmykrralyrlkdkkspvvekakvpikkskasyptk   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:G*------------------------------------------------------msaqkapkwyp×4 Localization of the large subunit ribosomal proteins into a  ...
2kds:A -----------------------------------------------------------------   Structure of ribosomal protein l14e from sulfolobus solfatar
2joy:A -----------------------------------------------------------------   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
4oc9:A pqiaiadiekinqiakkhkivsicdntvatpfllqpfkhgvdvivhslsxyvsgqgtalggalie   2.35 angstrom resolution crystal structure of putative o-  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P0C2H6 ------------------makflkagkvavvvrgryagkkvvivkphdegsk--shpfgh-a---   60S ribosomal protein L27-A OS=Saccharomyces cerevisiae  ...
3u5e:Z*-------------------akflkagkvavvvrgryagkkvvivkphdegsk--shpfgh-a---×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:a*----------------------lkagkvavvvrgryagkkvvivkphdegsk--shpfgh-a---×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z -------------------gkfmkpgkvvlvlagrysgrkavivkniddgts--drpysh-a---   Structure of the human 60s ribosomal proteins
3j39:Z -------------------rkimkqgkivivlsgryagrkaiivkthddgtp--ekpfgh-a---   Structure of the d. Melanogaster 60s ribosomal proteins
3j61:Z ------------------mvkflkpgkavillqgrfagrkavivrvfeegtr--drpygh-c---   Localization of the large subunit ribosomal proteins into a  ...
4a18:N*-------------------akflkygrvvillqgrfagkkavivkssedgtk--drkfgh-v---×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:a --------------------kflkpgkvvimtsgryagkkavivqntdtrnk--erpygh-s---   High-resolution cryo-electron microscopy structure of the  ...
3iz5:a*------------------mvkflkpgkavillqgrfagrkavivrvfeegtr--drpygh-c---×2 Localization of the large subunit ribosomal proteins into a  ...
3j21:5*---------------------aidvgriavviagrragqkvvvvdiidknfv--lvtgag-l---×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2zzm:A -----------------------------------------------------------------   The complex structure of atrm5 and trnaleu
2zzn:A -----------------------------------------------------------------   The complex structure of atrm5 and trnacys
4dq1:A ----------------------nsfdaayhslceevleigntrndrtntgti--sk-fgh-q---   Thymidylate synthase from staphylococcus aureus.
1r6z:P geimpnipqmsafwyavrtavinaasgrqtvdealkdaqtnaaaefvdishk--sfpism-p---   The crystal structure of the argonaute2 paz domain (as a mbp
2gxa:A gppntgksmlcnslihflggsvlsfanhkshfwlasladtraalvddathac--wryfdt-y---   Crystal structure of papillomavirus e1 hexameric helicase  ...
2v9p:A gppntgksmlcnslihflggsvlsfanhkshfwlasladtraalvddathac--wryfdt-y---   Crystal structure of papillomavirus e1 hexameric helicase  ...
3j39:E tfvkkrpskanfsehkrntrrnltpgtvlillagrhqgkrvvllkvlasglllvtgpfal-nscp   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:G*sedvaalkktrkaarpqklraslvpgtvlillagrfrgkrvvylk-hlednt--llisgp-f---×4 Localization of the large subunit ribosomal proteins into a  ...
2kds:A --------------------paievgricvkvkgreagskcvivdiidd---------nf-v---   Structure of ribosomal protein l14e from sulfolobus solfatar
2joy:A -------------------mpaievgricvkvkgreagskcvivdiidd---------nf-v---   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
4oc9:A rkdlndllknndrykafntpdpsyhglnlntldlpifsirviitwlrdlgas--lapqnawl---   2.35 angstrom resolution crystal structure of putative o-  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P0C2H6 lvagier-yplkvtkk--hg--akkvakrtki--k-pfikv-vnynhl-lptry-tl-dve-af-   60S ribosomal protein L27-A OS=Saccharomyces cerevisiae  ...
3u5e:Z*lvagier-yplkvtkk--hg--akkvakrtki--k-pfikv-vnynhl-lptry-tl-dve-af-×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:a*lvagier-yplkvtkk--hg--akkvakrtki--k-pfikv-vnynhl-lptry-tl-dve-af-×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z lvagidr-yprkvtaa--mg--kkkiakrski--k-sfvkv-ynynhl-mptry-sv-dip-ld-   Structure of the human 60s ribosomal proteins
3j39:Z lvagidr-yprkvtkk--mg--knklkkkskv--k-pflks-lnynhl-mptry-ta-hdi-sf-   Structure of the d. Melanogaster 60s ribosomal proteins
3j61:Z lvaglak-ypkkvirk--ds--akktakksrv--k-cflkl-vnfthl-mptry-tl-dvd-lk-   Localization of the large subunit ribosomal proteins into a  ...
4a18:N*lvagver-spkkvtkr--mg--skkiqkrtsv--k-pfiky-vnlnhi-mptry-svkelc-df-×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:a llagikk-yprkvvrg--ms--krsitrrsqv--g-vflrv-vnhkhf-lptry-nm-dls----   High-resolution cryo-electron microscopy structure of the  ...
3iz5:a*lvaglak-ypkkvirk--ds--akktakksrv--k-cflkl-vnfthl-mptry-tl-dvd-lk-×2 Localization of the large subunit ribosomal proteins into a  ...
3j21:5*nkvkrrr-mnikhiep--lp--qkidiprgas--d-eevra-alekag-isla------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2zzm:A ------p-lclkinkk--hgeqtrriliennllnk-dykit-segnylylpik--dv-ded-il-   The complex structure of atrm5 and trnaleu
2zzn:A -----mp-lclkinkk--hgeqtrriliennllnk-dykit-segnylylpik--dv-ded-il-   The complex structure of atrm5 and trnacys
4dq1:A lrfdlskgfpllttkk--vs--fklva--tel--l-wfikgdtniqyl-lkynn-ni-wnewaf-   Thymidylate synthase from staphylococcus aureus.
1r6z:P mieyler-fslkakin--nt--tnldysrrfl--e-pflrg-invvyt-ppqsf-qs-apr-vy-   The crystal structure of the argonaute2 paz domain (as a mbp
2gxa:A lrnaldg-ypvsidrk--h-----kaavqika--p-pllvt-snidvq-aedry-ly------l-   Crystal structure of papillomavirus e1 hexameric helicase  ...
2v9p:A lrnaldg-ypvsidrk--h-----kaavqika--p-pllvt-snidvq-aedry-ly------l-   Crystal structure of papillomavirus e1 hexameric helicase  ...
3j39:E lrrvsqr-yvigtsskvdlg--afkvpehlnd--a-yfrrl-kakkd-----kk-tg-ead-if-   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:G*kvngv----plr--rv--na--ryviatstkv--svegvnv-ekfnve-yfake-kl-tkk-ek-×4 Localization of the large subunit ribosomal proteins into a  ...
2kds:A lvtg-----pkdit-----g--vkr--------------rr-vnilhl-eptdk-ki-diq----   Structure of ribosomal protein l14e from sulfolobus solfatar
2joy:A lvtg-----pkdit-----g--vkr--------------rr-vnilhl-eptdk-ki-diq----   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
4oc9:A llqglet-lavriekhs-qn--aekvanflns--h-pdikg-vnyptl-asnayhnl-fkk-yfd   2.35 angstrom resolution crystal structure of putative o-  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P0C2H6 k------svv---stet---feqpsqreeakkvvkk-a-feerhq--------agknqwffsklr   60S ribosomal protein L27-A OS=Saccharomyces cerevisiae  ...
3u5e:Z*k------svv---stet---feqpsqreeakkvvkk-a-feerhq--------agknqwffsklr×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:a*k------svv---ste-------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z k------tvv---nkdv---frdpalkrkarreakv-k-feeryk--------tgknkwffqklr   Structure of the human 60s ribosomal proteins
3j39:Z e------kl----spkd---lkdpvkrkthrfqtrv-k-fesvyk--------egknkwffqklr   Structure of the d. Melanogaster 60s ribosomal proteins
3j61:Z e------vaa---gpda---latrdkkvaacksaka-r-ledrfk--------tgknrwfftklr   Localization of the large subunit ribosomal proteins into a  ...
4a18:N*k------elv---kedk---ikn-naksevrdtlkk-v-fvekyrtinpeeksashtkfffsklr×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:a r------elr---grin---vsdaskkakskqlvkr-l-fqaryn--------agnnrwffqrlr   High-resolution cryo-electron microscopy structure of the  ...
3iz5:a*e------vaa---gpd-------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j21:5*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2zzm:A k------sil---nie----felvdkeleekkiikkps-freiis--------xxyrkeidegli   The complex structure of atrm5 and trnaleu
2zzn:A k------sil---nie----felvdkeleekkiikkps-freiis--------kkyrkeidegli   The complex structure of atrm5 and trnacys
4dq1:A e------nyi---ksde---yngpdmtdfghralsd-pefneqyk--------eqmkqfkqrile   Thymidylate synthase from staphylococcus aureus.
1r6z:P rvnglsrapa---sset---fehdgkkvtiasyfhs-r-nyplkf--------pqlhclnvgssi   The crystal structure of the argonaute2 paz domain (as a mbp
2gxa:A h------srv---qtfr---feqpctdesgeqpfni-t-dadwks--------ffvrlwgrldl-   Crystal structure of papillomavirus e1 hexameric helicase  ...
2v9p:A h------srv---qtfr---feqpctdeqpfnitda-d-wksffv--------rlwgrldlid--   Crystal structure of papillomavirus e1 hexameric helicase  ...
3j39:E a------a-----kker---fvpneqrkkdqkevda-a-llkvik--------ahpegkffakyl   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:G*k------eanlfpeqqn---keikaervedqkvvdk-a-liaeik--------ktpllkqylsas×4 Localization of the large subunit ribosomal proteins into a  ...
2kds:A k------gas---deevkkkleesnlteymkekiki-r-mptl----------------------   Structure of ribosomal protein l14e from sulfolobus solfatar
2joy:A k------gas---deevkkkleesnlteymkekiki-r-mptl----------------------   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
4oc9:A k------nfa---sgll---sfeakdyeharricdk-t-qlflla--------anlgdsksliih   2.35 angstrom resolution crystal structure of putative o-  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P0C2H6 f----------------------------------------------------------------   60S ribosomal protein L27-A OS=Saccharomyces cerevisiae  ...
3u5e:Z*f----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z f----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:Z f----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3j61:Z f----------------------------------------------------------------   Localization of the large subunit ribosomal proteins into a  ...
4a18:N*f----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:a f----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3iz5:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j21:5*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2zzm:A slsydvvgdlvilqisdevdekirkeigelayklipckgvfrrksevkgefrvrelehlagenrt   The complex structure of atrm5 and trnaleu
2zzn:A slsydvvgdlvilqisdevdekirkeigelayklipckgvfrrksevkgefrvrelehlagenrt   The complex structure of atrm5 and trnacys
4dq1:A ddtfakqfgdlgnvygkqwrdwvdkdgnhfdqlktvieqikhnpdsrrhivsawnpteidtmalp   Thymidylate synthase from staphylococcus aureus.
1r6z:P ksillpielcsiee---------------------------------------------------   The crystal structure of the argonaute2 paz domain (as a mbp
2gxa:A -----------------------------------------------------------------   Crystal structure of papillomavirus e1 hexameric helicase  ...
2v9p:A -----------------------------------------------------------------   Crystal structure of papillomavirus e1 hexameric helicase  ...
3j39:E qnmfalhssqyphrmrf------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:G*fslkngdkphmlkf---------------------------------------------------×4 Localization of the large subunit ribosomal proteins into a  ...
2kds:A -----------------------------------------------------------------   Structure of ribosomal protein l14e from sulfolobus solfatar
2joy:A -----------------------------------------------------------------   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
4oc9:A pastthsqlseeelqkagitkatirlsiglensddliadlkqaie--------------------   2.35 angstrom resolution crystal structure of putative o-  ...

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P0C2H6 -----------------------------------------------------------------   60S ribosomal protein L27-A OS=Saccharomyces cerevisiae  ...
3u5e:Z*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3j61:Z -----------------------------------------------------------------   Localization of the large subunit ribosomal proteins into a  ...
4a18:N*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:a -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3iz5:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j21:5*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2zzm:A ltihkengyrlwvdiakvyfsprlggerarimkkvslndvvvdmfagvgpfsiacknakkiyaid   The complex structure of atrm5 and trnaleu
2zzn:A ltihkengyrlwvdiakvyfsprlggerarimkkvslndvvvdmfagvgpfsiacknakkiyaid   The complex structure of atrm5 and trnacys
4dq1:A pchtmfqfyvqdgklscqlyqrsadiflgvpfniasyallthliakecglevgefvhtfgdahiy   Thymidylate synthase from staphylococcus aureus.
1r6z:P -----------------------------------------------------------------   The crystal structure of the argonaute2 paz domain (as a mbp
2gxa:A -----------------------------------------------------------------   Crystal structure of papillomavirus e1 hexameric helicase  ...
2v9p:A -----------------------------------------------------------------   Crystal structure of papillomavirus e1 hexameric helicase  ...
3j39:E -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:G*-----------------------------------------------------------------×4 Localization of the large subunit ribosomal proteins into a  ...
2kds:A -----------------------------------------------------------------   Structure of ribosomal protein l14e from sulfolobus solfatar
2joy:A -----------------------------------------------------------------   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
4oc9:A -----------------------------------------------------------------   2.35 angstrom resolution crystal structure of putative o-  ...

                6         6         6         6         7         7     
                6         7         8         9         0         1     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P0C2H6 -----------------------------------------------------------------   60S ribosomal protein L27-A OS=Saccharomyces cerevisiae  ...
3u5e:Z*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:Z -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3j61:Z -----------------------------------------------------------------   Localization of the large subunit ribosomal proteins into a  ...
4a18:N*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:a -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
3iz5:a*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3j21:5*-----------------------------------------------------------------×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2zzm:A inphaiellxkniklnklehkiipilsdvrevdvkgnrvimnlpkfahkfidkaldiveeggvih   The complex structure of atrm5 and trnaleu
2zzn:A inphaiellkkniklnklehkiipilsdvrevdvkgnrvimnlpkfahkfidkaldiveeggvih   The complex structure of atrm5 and trnacys
4dq1:A snhidaiqtqlaresfnpptlkinsdksifdinyedleivdyeshpaika---------------   Thymidylate synthase from staphylococcus aureus.
1r6z:P -----------------------------------------------------------------   The crystal structure of the argonaute2 paz domain (as a mbp
2gxa:A -----------------------------------------------------------------   Crystal structure of papillomavirus e1 hexameric helicase  ...
2v9p:A -----------------------------------------------------------------   Crystal structure of papillomavirus e1 hexameric helicase  ...
3j39:E -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3izc:G*-----------------------------------------------------------------×4 Localization of the large subunit ribosomal proteins into a  ...
2kds:A -----------------------------------------------------------------   Structure of ribosomal protein l14e from sulfolobus solfatar
2joy:A -----------------------------------------------------------------   Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
4oc9:A -----------------------------------------------------------------   2.35 angstrom resolution crystal structure of putative o-  ...

           7         7         7         7         7   
           2         3         4         5         6   
       678901234567890123456789012345678901234567890123                    Protein name
       ----+---------+---------+---------+---------+---                    ------------
P0C2H6 ------------------------------------------------                    60S ribosomal protein L27-A OS=Saccharomyces cerevisiae  ...
3u5e:Z*------------------------------------------------                 ×5 The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:a*------------------------------------------------                 ×2 Localization of the large subunit ribosomal proteins into a  ...
3j3b:Z ------------------------------------------------                    Structure of the human 60s ribosomal proteins
3j39:Z ------------------------------------------------                    Structure of the d. Melanogaster 60s ribosomal proteins
3j61:Z ------------------------------------------------                    Localization of the large subunit ribosomal proteins into a  ...
4a18:N*------------------------------------------------                 ×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:a ------------------------------------------------                    High-resolution cryo-electron microscopy structure of the  ...
3iz5:a*------------------------------------------------                 ×2 Localization of the large subunit ribosomal proteins into a  ...
3j21:5*------------------------------------------------                 ×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
2zzm:A yytigkdfdkaiklfekkcdcevlekrivxsyapreyilald------                    The complex structure of atrm5 and trnaleu
2zzn:A yytigkdfdkaiklfekkcdcevlekrivksyapreyilaldfkinkk                    The complex structure of atrm5 and trnacys
4dq1:A ------------------------------------------------                    Thymidylate synthase from staphylococcus aureus.
1r6z:P ------------------------------------------------                    The crystal structure of the argonaute2 paz domain (as a mbp
2gxa:A ------------------------------------------------                    Crystal structure of papillomavirus e1 hexameric helicase  ...
2v9p:A ------------------------------------------------                    Crystal structure of papillomavirus e1 hexameric helicase  ...
3j39:E ------------------------------------------------                    Structure of the d. Melanogaster 60s ribosomal proteins
3izc:G*------------------------------------------------                 ×4 Localization of the large subunit ribosomal proteins into a  ...
2kds:A ------------------------------------------------                    Structure of ribosomal protein l14e from sulfolobus solfatar
2joy:A ------------------------------------------------                    Nmr structure of 50s ribosomal protein l14e from sulfolobus  ...
4oc9:A ------------------------------------------------                    2.35 angstrom resolution crystal structure of putative o-  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P0C2H6. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 136 - - P0C2H6 60S ribosomal protein L27-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL27A PE=1 SV=1
2. 876 100.0% 135 135 1120.3 2e-55 3u5e:Z * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
3. " " " " " "  = 3u5i:Z *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
4. " " " " " "  = 4b6a:Z *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
5. " " " " " "  = 4byn:Z *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
6. " " " " " "  = 4byu:Z *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
7. 607 100.0% 95 95 781.5 1.5e-36 3izc:a * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
8. " " " " " "  = 3izs:a *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
9. 536 56.0% 134 135 689.4 2e-31 3j3b:Z Structure of the human 60s ribosomal proteins
10. 490 51.5% 134 134 631.1 3.5e-28 3j39:Z Structure of the d. Melanogaster 60s ribosomal proteins
11. 465 47.1% 136 136 599.3 2.1e-26 3j61:Z Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
12. 437 47.2% 144 143 563.5 2.1e-24 4a18:N * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
13. " " " " " "  = 4a19:N *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
14. " " " " " "  = 4a1b:N *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
15. " " " " " "  = 4a1d:N *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
16. 416 42.5% 134 132 537.4 5.9e-23 3zf7:a High-resolution cryo-electron microscopy structure of the tr brucei ribosome
17. 367 54.4% 90 99 477.0 1.4e-19 3iz5:a * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
18. " " " " " "  = 3izr:a *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
19. 88 48.1% 27 81 124.5 5.8 3j21:5 * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
20. " " " " " "  = 3j44:5 *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
21. 94 31.6% 76 329 123.7 6.5 2zzm:A The complex structure of atrm5 and trnaleu
22. 94 31.6% 76 336 123.6 6.5 2zzn:A The complex structure of atrm5 and trnacys
23. 88 26.9% 104 312 116.5 16 4dq1:A Thymidylate synthase from staphylococcus aureus.
24. 90 21.4% 84 498 116.2 17 1r6z:P The crystal structure of the argonaute2 paz domain (as a mbp
25. 87 28.0% 75 270 116.1 17 2gxa:A Crystal structure of papillomavirus e1 hexameric helicase with ssdna and mgadp
26. 87 29.2% 72 272 116.0 17 2v9p:A Crystal structure of papillomavirus e1 hexameric helicase DNA-free form
27. 83 25.7% 136 228 112.0 29 3j39:E Structure of the d. Melanogaster 60s ribosomal proteins
28. 81 27.1% 118 176 111.0 33 3izc:G * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
29. " " " " " "  = 3izs:G *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
30. " " " " " "  = 3o58:F *
Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
31. " " " " " "  = 3o5h:F *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
32. 81 28.1% 114 95 110.9 34 2kds:A Structure of ribosomal protein l14e from sulfolobus solfatar
33. 81 28.1% 114 96 110.8 34 2joy:A Nmr structure of 50s ribosomal protein l14e from sulfolobus solfataricus: northeast structural genomics consortium target ssr105
34. 84 28.3% 99 420 109.6 40 4oc9:A 2.35 angstrom resolution crystal structure of putative o- acetylhomoserine (thiol)-lyase (mety) from campylobacter je subsp. Jejuni nctc 11168 with n'-pyridoxyl-lysine-5'-monoph position 205

Number of sequences: 34

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 79 23.9% 67 158 109.1 42 3zf7:v High-resolution cryo-electron microscopy structure of the tr brucei ribosome

Number of sequences: 1

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer