spacer
spacer

SAS results for UniProt accession no. P05749

Sequence annotated by structure
>

Key:
Sec. struc: By homology
  Helix Strand  

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

 

FASTA alignment for UniProt accession no. P05749 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P05749 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 24 unique sequences (including 6 consensus sequences) giving 35 sequence matches in all. The 4 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05749 -----------------------------------------------------------------   60S ribosomal protein L22-A OS=Saccharomyces cerevisiae  ...
3izc:W*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:U -----------------------------------------------------------------   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:U*-----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:U -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:U -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:W*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:M*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:V -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
1otn:A -----------------------------------------------------------------   Calcium-binding mutant of the internalin b lrr domain
2qne:A gllpkyniltedqvqkihentmkileeigiefeyepalevfrregqkvegkrvyltrefvesklk   Crystal structure of putative methyltransferase  ...
3twa:A*-----------------------------------------------------------------×2 Crystal structure of gluconate dehydratase (target  ...
1fvi:A -----------------------------------------------------------------   Crystal structure of chlorella virus DNA ligase-adenylate
3tw9:A -----------------------------------------------------------------   Crystal structure of gluconate dehydratase (target  ...
1d0b:A -----------------------------------------------------------------   Internalin b leucine rich repeat domain
1ux7:A*-----------------------------------------------------------------×2 Carbohydrate-binding module cbm36 in complex with calcium  ...
4i6m:A -----------------------------------------------------------------   Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of  ...
1otm:A -----------------------------------------------------------------   Calcium-binding mutant of the internalin b lrr domain
2jub:A -----------------------------------------------------------------   Solution structure of ipi
3wee:B -----------------------------------------------------------------   Structure of the full-length yeast arp7-arp9 heterodimer
1tf1:A -----------------------------------------------------------------   Crystal structure of the e. Coli glyoxylate regulatory  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P05749 -----------------------------------------------------------------   60S ribosomal protein L22-A OS=Saccharomyces cerevisiae  ...
3izc:W*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:U -----------------------------------------------------------------   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:U*-----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:U -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:U -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:W*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:M*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:V -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
1otn:A -----------------------------------------------------------------   Calcium-binding mutant of the internalin b lrr domain
2qne:A sapaeftlharnpennvviggdnivfmpgygapfiyeldgsrrkttlqdyenfaklagasknmhl   Crystal structure of putative methyltransferase  ...
3twa:A*-----------------------------------------------------------------×2 Crystal structure of gluconate dehydratase (target  ...
1fvi:A -----------------------------------------------------------------   Crystal structure of chlorella virus DNA ligase-adenylate
3tw9:A -----------------------------------------------------------------   Crystal structure of gluconate dehydratase (target  ...
1d0b:A -----------------------------------------------------------------   Internalin b leucine rich repeat domain
1ux7:A*-----------------------------------------------------------------×2 Carbohydrate-binding module cbm36 in complex with calcium  ...
4i6m:A -----------------------------------------------------------------   Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of  ...
1otm:A -----------------------------------------------------------------   Calcium-binding mutant of the internalin b lrr domain
2jub:A -----------------------------------------------------------------   Solution structure of ipi
3wee:B -----------------------------------------------------------------   Structure of the full-length yeast arp7-arp9 heterodimer
1tf1:A -----------------------------------------------------------------   Crystal structure of the e. Coli glyoxylate regulatory  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05749 -----------------------------------------------------------------   60S ribosomal protein L22-A OS=Saccharomyces cerevisiae  ...
3izc:W*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:U -----------------------------------------------------------------   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:U*-----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:U -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:U -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:W*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:M*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:V -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
1otn:A -----------------------------------------------------------------   Calcium-binding mutant of the internalin b lrr domain
2qne:A sggtmaepqdipdgvrhlqmlyssiknsdkcfmgsaegkeraedsveiaailfggkdvikekpvl   Crystal structure of putative methyltransferase  ...
3twa:A*------------------------------nlkitnvktiltapggidlavvkietnepglyglg×2 Crystal structure of gluconate dehydratase (target  ...
1fvi:A -----------------------------------------------------------------   Crystal structure of chlorella virus DNA ligase-adenylate
3tw9:A -----------------------------------------------------nlkitnvktilt   Crystal structure of gluconate dehydratase (target  ...
1d0b:A -----------------------------------------------------------------   Internalin b leucine rich repeat domain
1ux7:A*-----------------------------------------------------------------×2 Carbohydrate-binding module cbm36 in complex with calcium  ...
4i6m:A -----------------------------------------------------------------   Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of  ...
1otm:A -----------------------------------------------------------------   Calcium-binding mutant of the internalin b lrr domain
2jub:A -----------------------------------------------------------------   Solution structure of ipi
3wee:B -----------------------------------------------------------------   Structure of the full-length yeast arp7-arp9 heterodimer
1tf1:A -----------------------------------------------------------------   Crystal structure of the e. Coli glyoxylate regulatory  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P05749 -----------------------------------------------------------------   60S ribosomal protein L22-A OS=Saccharomyces cerevisiae  ...
3izc:W*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:U -----------------------------------------------------------------   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:U*-----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:U -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:U -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:W*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:M*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:V -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
1otn:A -----------------------------------------------------------------   Calcium-binding mutant of the internalin b lrr domain
2qne:A vslinsltplkydermlgalmayaeagqaviiaslvmagstgpaslagtlslqnaevlagislaq   Crystal structure of putative methyltransferase  ...
3twa:A*catftqrifavksaideymapflvgkdptriediwqsgvvsgywrngpimnnalsgvdmalwdik×2 Crystal structure of gluconate dehydratase (target  ...
1fvi:A -----------------------------------------------------------------   Crystal structure of chlorella virus DNA ligase-adenylate
3tw9:A apggidlavvkietnepglyglgcatftqrifavksaideymapflvgkdptriediwqsgvvsg   Crystal structure of gluconate dehydratase (target  ...
1d0b:A -----------------------------------------------------------------   Internalin b leucine rich repeat domain
1ux7:A*-----------------------------------------------------------------×2 Carbohydrate-binding module cbm36 in complex with calcium  ...
4i6m:A ------------------------tlnrkcvvihngshrtvagfsnvelpqciipssyikrteae   Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of  ...
1otm:A -----------------------------------------------------------------   Calcium-binding mutant of the internalin b lrr domain
2jub:A -----------------------------------------------------------------   Solution structure of ipi
3wee:B ----------------------nrkxvvihngshrtvagfsnvelpqxiipssyikrtdeggeae   Structure of the full-length yeast arp7-arp9 heterodimer
1tf1:A ----------------------------------------------grenlyfqghmdvlsvagp   Crystal structure of the e. Coli glyoxylate regulatory  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05749 -----------------------------------------------------------------   60S ribosomal protein L22-A OS=Saccharomyces cerevisiae  ...
3izc:W*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:U -----------------------------------------------------------------   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:U*-----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:U -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:U -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:W*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:M*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:V -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
1otn:A -----------------------------------------------------------------   Calcium-binding mutant of the internalin b lrr domain
2qne:A sinpgtpviygstsalsdmrsgslsigspecalfisasaqlarfygvpsrsggglndsktvdaqa   Crystal structure of putative methyltransferase  ...
3twa:A*gklagmpvydllggkcrdgiplychtdggdevevednirarmeegyqyvrcqmgmyggagtddlk×2 Crystal structure of gluconate dehydratase (target  ...
1fvi:A --------------------------------------aitkpllaatleniedvqfpclatpki   Crystal structure of chlorella virus DNA ligase-adenylate
3tw9:A ywrngpimnnalsgvdmalwdikgklagmpvydllggkcrdgiplychtdggdevevednirarm   Crystal structure of gluconate dehydratase (target  ...
1d0b:A -----------------------------------------------------------------   Internalin b leucine rich repeat domain
1ux7:A*-----------------------------------------------------------------×2 Carbohydrate-binding module cbm36 in complex with calcium  ...
4i6m:A fifgtynmidaaaekrngdevytlvdsqglpynwdalemqwrylydtqlkvspeelplvitmpat   Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of  ...
1otm:A -----------------------------------------------------------------   Calcium-binding mutant of the internalin b lrr domain
2jub:A -----------------------------------------------------------------   Solution structure of ipi
3wee:B fifgtynmidaaaekrngdevytlvdsqglpynwdalemqwrylydtqlkvspeelplvitmpat   Structure of the full-length yeast arp7-arp9 heterodimer
1tf1:A fmrrlmllsgetvnvairngneavligqlecksmvrmcaplgsrlplhasgagkallyplaeeel   Crystal structure of the e. Coli glyoxylate regulatory  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P05749 -mapntsrkqkiaktftvdvssptengv-f----dp---asyak---ylid---hikvega-vgn   60S ribosomal protein L22-A OS=Saccharomyces cerevisiae  ...
3izc:W*------srkqkiaktftvdvssptengv-f----dp---asyak---ylid---hikvega-vgn×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:U ---------qkiaktftvdvssptengv-f----dp---asyak---ylid---hikvega-vgn   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:U*-----------iaktftvdvssptengv-f----dp---asyak---ylid---hikvega-vgn×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:U --------kkqvlk-ftldcthpvedgi-m----da---anfeq---flqe---rikvngk-agn   Structure of the human 60s ribosomal proteins
3j39:U ------qkkkkvslrftidctniaedsi-m----dv---adfek---yika---rlkvngk-vnn   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:W*------ggkkkgsvsfvidcskpvedki-m----ei---aslek---flqe---rikvaggkagn×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:M*----------kvnlgfkidcsqpvedkv-i----li---gefae---flks---kikvggk-lgn×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:V ----------kgkkvfkidcsipasdgi-f----sddilsnfqq---yfqd---nvklngr-kgk   High-resolution cryo-electron microscopy structure of the  ...
1otn:A ---------------etitvstpikq-i-f----pd---aafae---tikd---nlkkk-----s   Calcium-binding mutant of the internalin b lrr domain
2qne:A gyesmmtlmaanltgvnfvlhtagilqy-f----ma---msyek---fimd---d-eiagm-llh   Crystal structure of putative methyltransferase  ...
3twa:A*liatqlarakniqpkrsprsktp---giyf----dp---dayaksvprlfd---hlrnklg-fg-×2 Crystal structure of gluconate dehydratase (target  ...
1fvi:A agirsvkqtqmlsrtf-----kpirnsv-m----n------------rllt---ellpegs-dge   Crystal structure of chlorella virus DNA ligase-adenylate
3tw9:A eegyqyvrcqmgmiqpkrsprsktpgiy-f----dp---dayaksvprlfd---hlrnklg-fg-   Crystal structure of gluconate dehydratase (target  ...
1d0b:A ---------------etitvstpikq-i-f----pd---dafae---tikd---nlkkk-----s   Internalin b leucine rich repeat domain
1ux7:A*-itkveaenmkiggtyagkisapfdgva-lyanady---vsysq---yfansthnisvrga-ssn×2 Carbohydrate-binding module cbm36 in complex with calcium  ...
4i6m:A ngkpdmaileryyelafdklnvpvfqiv-i----ep---laial---smgk---ssafvid-iga   Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of  ...
1otm:A ---------------etitvstpikq-i-f----pd---aafae---tika---nlkkk-----s   Calcium-binding mutant of the internalin b lrr domain
2jub:A ----------------atltsevikank-g----re---gkpmi---slvd---geeikgt-v-y   Solution structure of ipi
3wee:B ngkpdmaileryyelafdklnvpvfqiv-i----ep---laial---smgk---ssafvid-iga   Structure of the full-length yeast arp7-arp9 heterodimer
1tf1:A msiilqtglqqftpttlvdm--ptllkd-l----eq---arelg---ytvd-----keehv-vgl   Crystal structure of the e. Coli glyoxylate regulatory  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05749 lgnav-tvted-gtvv-tvvs---tak----fsg-ky-lkyltkkyl----kk--nql-rd---w   60S ribosomal protein L22-A OS=Saccharomyces cerevisiae  ...
3izc:W*lgnav-tvted-gtvv-tvvs---tak----fsg-ky-lkyltkkyl----kk--nql-rd---w×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:U lgnav-tvted-gtvv-tvvs---tak----fsg-ky-lkyltkkyl----kk--nql-rd---w   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:U*lgnav-tvted-gtvv-tvvs---tak----fsg-ky-lkyltkkyl----kk--nql-rd---w×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:U lgggvvtiers-kski-tvts---evp----fsk-ry-lkyltkkyl----kk--nnl-rd---w   Structure of the human 60s ribosomal proteins
3j39:U lgnnv-tfers-klkl-ivss---dvh----fsk-ay-lkyltkkyl----kk--nsl-rd---w   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:W*lgdsv-tvtrd-ktkv-tvts---dga----fsk-ry-lkyltkkyl----kk--hnv-rd---w×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:M*lgeni-tisnd-dkki-nvqs---tip----fsk-ry-lkyltkkyl----kk--qdl-rn---y×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:V ltskv-rvnmr-entl-sitt---tma----yrk-ky-fkyltkkfl----kk--kdl-rd---w   High-resolution cryo-electron microscopy structure of the  ...
1otn:A vtdav-tqnel-nsid-qiia---nnsdiksvqgiqy-lpnvtklfl----ng--nkl-td---i   Calcium-binding mutant of the internalin b lrr domain
2qne:A ymkgy-tfded-gmaf-dvie---kvg----pgg-hf-l---tqkht----rk--nhk-re---f   Crystal structure of putative methyltransferase  ...
3twa:A*iefih-dvher-vtpv-tain---lak----tle-qyqlfyledpva----pe--ni---d---w×2 Crystal structure of gluconate dehydratase (target  ...
1fvi:A isieg-atfqd-ttsa-vmtg---hak----fsy-yw-fdyvtddpl----kkyidrv-ed---m   Crystal structure of chlorella virus DNA ligase-adenylate
3tw9:A iefih-dvher-vtpv-tain---lak----tle-qyqlfyledpva----pe--ni---d---w   Crystal structure of gluconate dehydratase (target  ...
1d0b:A vtdav-tqnel-nsid-qiia---nnsdiksvqgiqy-lpnvtklfl----ng--nkl-td---i   Internalin b leucine rich repeat domain
1ux7:A*agtak-vdlvi-ggvt---vg---sfn----ftg-kt-ptvqtlsni----th--atg-dq---e×2 Carbohydrate-binding module cbm36 in complex with calcium  ...
4i6m:A sgcnv-tpiid-givvknavv---rsk----fgg-df-ldfqvherlaplike--eqk-rstdvw   Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of  ...
1otm:A vtdav-tqnel-nsid-qiia---nnsdiksvqgiqy-lpnvtklfl----ng--nkl-td---i   Calcium-binding mutant of the internalin b lrr domain
2jub:A lgdgw-sakkd-gati-vispaeetal----fka-kh-isaahlkii----ak--nll-------   Solution structure of ipi
3wee:B sgcnv-tpiid-givvknavv---rsk----fgg-df-ldfqvherlaplike--krs-td---v   Structure of the full-length yeast arp7-arp9 heterodimer
1tf1:A ncias-aiyddvgsvv-aais----------isg-ps-srltedrfv----sq--gelvrd---t   Crystal structure of the e. Coli glyoxylate regulatory  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P05749 irfvstkt--neyrlafyqvtpeedeeedee----------------------------------   60S ribosomal protein L22-A OS=Saccharomyces cerevisiae  ...
3izc:W*irfvstkt--neyrlafyqv---------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:U irfvstkt--neyrlafy-----------------------------------------------   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:U*irfvstkt--neyrlafy-----------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:U lrvvansk--esyelryfqinqdeeeeed------------------------------------   Structure of the human 60s ribosomal proteins
3j39:U irvvanek--dsyelryfrissnddedddae----------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:W*lrviaankdrnvyelryfni---------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:M*lyvtssdk--nsyqlryfn----------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:V irilakgk--dtyqlkyfni---------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
1otn:A kpltnlkn--lgwlfldenkikdlsslkdlkklkslslehngisdinglvhlpqleslylgnnki   Calcium-binding mutant of the internalin b lrr domain
2qne:A ytptlsdr--saydtwakekletkqraharwqqilanyvppaldpeidaklqafiaqrgkevge-   Crystal structure of putative methyltransferase  ...
3twa:A*lkmlrqqs--stpismgelfvnvnewkplidnrlidyirchvstiggitparklavyselngvrt×2 Crystal structure of gluconate dehydratase (target  ...
1fvi:A knyitvhp--hilehaqvkiiplipveinnitellqyerdvlskgfegvmirkpdgkykfgrstl   Crystal structure of chlorella virus DNA ligase-adenylate
3tw9:A lkmlrqqs--stpismgelfvnvnewkplidnrlidyirchvstiggitparklavyselngvrt   Crystal structure of gluconate dehydratase (target  ...
1d0b:A kpltnlkn--lgwlfldenkikdlsslkdlkklkslslehngisdinglvhlpqleslylgnnki   Internalin b leucine rich repeat domain
1ux7:A*iklaltsd--dgtwdayvdfiefsl----------------------------------------×2 Carbohydrate-binding module cbm36 in complex with calcium  ...
4i6m:A ye-astwi--qqfkstmlqvs-ekdlfeleryykeqadiyakqqennplvqkknflfkplnktlt   Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of  ...
1otm:A kpltnlkn--lgwlfldenkikdlsslkdlkklkslslehngisdinglvhlpqleslylgnnki   Calcium-binding mutant of the internalin b lrr domain
2jub:A -----------------------------------------------------------------   Solution structure of ipi
3wee:B wyeastwi--qqfkstmlqvs-ekdlfeleryykeqadiyakqqtgspnnplvqkknflfkplnk   Structure of the full-length yeast arp7-arp9 heterodimer
1tf1:A ardistal--glka---------------------------------------------------   Crystal structure of the e. Coli glyoxylate regulatory  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P05749 -----------------------------------------------------------------   60S ribosomal protein L22-A OS=Saccharomyces cerevisiae  ...
3izc:W*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:U -----------------------------------------------------------------   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:U*-----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:U -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:U -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:W*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:M*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:V -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
1otn:A tditvlsrltkldtlslednqisdivplagltklqnlylsknhisdlralaglknldvlelfsqe   Calcium-binding mutant of the internalin b lrr domain
2qne:A -----------------------------------------------------------------   Crystal structure of putative methyltransferase  ...
3twa:A*awhgpgdispvgvcanmhldlsspnfgiqeytpmndalrdvfpgcpeidhgyaylndkpglgidi×2 Crystal structure of gluconate dehydratase (target  ...
1fvi:A kegillkmkqfkdaeatiismtalfksgkveedvmgsievdydgvvfsigtgfdadqrrdfwqnk   Crystal structure of chlorella virus DNA ligase-adenylate
3tw9:A awhgpgdispvgvcanmhldlsspnfgiqeytpmndalrdvfpgcpeidhgyaylndkpglgidi   Crystal structure of gluconate dehydratase (target  ...
1d0b:A tditvlsrltkldtlslednqisdivplagltklqnlylsknhisdlralaglknldvlelfsqe   Internalin b leucine rich repeat domain
1ux7:A*-----------------------------------------------------------------×2 Carbohydrate-binding module cbm36 in complex with calcium  ...
4i6m:A ldlkecyqfaeylfkpqlisdkfspedglgplmaksvkkagasispeqvysllltnviitgstsl   Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of  ...
1otm:A tditvlsrltkldtlslednqisdivplagltklqnlylsknhisdlralaglknldvlelfsqe   Calcium-binding mutant of the internalin b lrr domain
2jub:A -----------------------------------------------------------------   Solution structure of ipi
3wee:B tltldlkexyqfaeylfkpqlisdkfspedglgplmaksvkkagasinsmkantsspeqvyslll   Structure of the full-length yeast arp7-arp9 heterodimer
1tf1:A -----------------------------------------------------------------   Crystal structure of the e. Coli glyoxylate regulatory  ...

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P05749 -----------------------------------------------------------------   60S ribosomal protein L22-A OS=Saccharomyces cerevisiae  ...
3izc:W*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:U -----------------------------------------------------------------   The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:U*-----------------------------------------------------------------×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:U -----------------------------------------------------------------   Structure of the human 60s ribosomal proteins
3j39:U -----------------------------------------------------------------   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:W*-----------------------------------------------------------------×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:M*-----------------------------------------------------------------×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:V -----------------------------------------------------------------   High-resolution cryo-electron microscopy structure of the  ...
1otn:A c----------------------------------------------------------------   Calcium-binding mutant of the internalin b lrr domain
2qne:A -----------------------------------------------------------------   Crystal structure of putative methyltransferase  ...
3twa:A*deakaakypceggipswtmartpdgtasrp-----------------------------------×2 Crystal structure of gluconate dehydratase (target  ...
1fvi:A esyigkmvkfkyfemprfpvfigir----------------------------------------   Crystal structure of chlorella virus DNA ligase-adenylate
3tw9:A deakaakypceggipswtmartpdgtasrp-----------------------------------   Crystal structure of gluconate dehydratase (target  ...
1d0b:A c----------------------------------------------------------------   Internalin b leucine rich repeat domain
1ux7:A*-----------------------------------------------------------------×2 Carbohydrate-binding module cbm36 in complex with calcium  ...
4i6m:A iegmeqriikelsirfpqyklttfanqvmmdrkiqgwlgaltmanlpswslgkwyskedyetlkr   Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of  ...
1otm:A c----------------------------------------------------------------   Calcium-binding mutant of the internalin b lrr domain
2jub:A -----------------------------------------------------------------   Solution structure of ipi
3wee:B tnviitgstsliegmeqriikelsirfpqyklttfanqvmmdrkiqgwlgaltmanlpswslgkw   Structure of the full-length yeast arp7-arp9 heterodimer
1tf1:A -----------------------------------------------------------------   Crystal structure of the e. Coli glyoxylate regulatory  ...

                6 
                6 
       12345678901                                                         Protein name
       ---------+-                                                         ------------
P05749 -----------                                                         60S ribosomal protein L22-A OS=Saccharomyces cerevisiae  ...
3izc:W*-----------                                                      ×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:U -----------                                                         The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:U*-----------                                                      ×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3j3b:U -----------                                                         Structure of the human 60s ribosomal proteins
3j39:U -----------                                                         Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:W*-----------                                                      ×3 Localization of the large subunit ribosomal proteins into a  ...
4a18:M*-----------                                                      ×4 T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:V -----------                                                         High-resolution cryo-electron microscopy structure of the  ...
1otn:A -----------                                                         Calcium-binding mutant of the internalin b lrr domain
2qne:A -----------                                                         Crystal structure of putative methyltransferase  ...
3twa:A*-----------                                                      ×2 Crystal structure of gluconate dehydratase (target  ...
1fvi:A -----------                                                         Crystal structure of chlorella virus DNA ligase-adenylate
3tw9:A -----------                                                         Crystal structure of gluconate dehydratase (target  ...
1d0b:A -----------                                                         Internalin b leucine rich repeat domain
1ux7:A*-----------                                                      ×2 Carbohydrate-binding module cbm36 in complex with calcium  ...
4i6m:A d----------                                                         Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of  ...
1otm:A -----------                                                         Calcium-binding mutant of the internalin b lrr domain
2jub:A -----------                                                         Solution structure of ipi
3wee:B yskedyetlkr                                                         Structure of the full-length yeast arp7-arp9 heterodimer
1tf1:A -----------                                                         Crystal structure of the e. Coli glyoxylate regulatory  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P05749. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 121 - - P05749 60S ribosomal protein L22-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL22A PE=1 SV=3
2. 660 100.0% 105 105 876.2 7.9e-42 3izc:W * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
3. " " " " " "  = 3izs:W *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
4. 630 100.0% 100 100 837.3 1.2e-39 3u5e:U The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
5. 617 100.0% 98 98 820.4 1e-38 3u5i:U * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
6. " " " " " "  = 4b6a:U *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
7. " " " " " "  = 4byn:U *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
8. " " " " " "  = 4byu:U *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
9. 357 46.9% 113 112 478.9 1.1e-19 3j3b:U Structure of the human 60s ribosomal proteins
10. 340 43.5% 115 116 456.4 1.9e-18 3j39:U Structure of the d. Melanogaster 60s ribosomal proteins
11. 308 47.2% 106 108 415.0 3.9e-16 3iz5:W * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
12. " " " " " "  = 3izr:W *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
13. " " " " " "  = 3j61:U *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
14. 271 42.4% 99 100 367.1 1.8e-13 4a18:M * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
15. " " " " " "  = 4a19:M *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
16. " " " " " "  = 4a1b:M *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
17. " " " " " "  = 4a1d:M *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
18. 246 34.6% 104 104 334.1 1.2e-11 3zf7:V High-resolution cryo-electron microscopy structure of the tr brucei ribosome
19. 89 27.2% 81 207 123.7 6.5 1otn:A Calcium-binding mutant of the internalin b lrr domain
20. 89 27.7% 65 476 117.9 14 2qne:A Crystal structure of putative methyltransferase (zp_00558420 desulfitobacterium hafniense y51 at 2.30 a resolution
21. 87 27.4% 106 415 116.2 17 3twa:A * Crystal structure of gluconate dehydratase (target efi-50167 salmonella enterica subsp. Enterica serovar enteritidis str complexed with magnesium and glycerol
22. " " " " " "  = 3twb:A *
Crystal structure of gluconate dehydratase (target efi-50167 salmonella enterica subsp. Enterica serovar enteritidis str complexed with magnesium and gluconic acid
23. 85 21.6% 111 264 115.4 19 1fvi:A Crystal structure of chlorella virus DNA ligase-adenylate
24. 86 30.6% 85 394 115.3 19 3tw9:A Crystal structure of gluconate dehydratase (target efi-50167 salmonella enterica subsp. Enterica serovar enteritidis str
25. 82 25.9% 81 207 114.5 21 1d0b:A Internalin b leucine rich repeat domain
26. 78 28.9% 76 120 113.0 25 1ux7:A * Carbohydrate-binding module cbm36 in complex with calcium and xylotriose
27. " " " " " "  = 1w0n:A *
Structure of uncomplexed carbohydrate binding domain cbm36
28. 84 28.0% 107 399 112.6 27 4i6m:A Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/sn chromatin remodeler.
29. 79 25.9% 81 207 110.6 35 1otm:A Calcium-binding mutant of the internalin b lrr domain
30. 73 28.6% 56 76 109.7 39 2jub:A Solution structure of ipi
31. 82 26.9% 104 409 109.7 39 3wee:B Structure of the full-length yeast arp7-arp9 heterodimer
32. 77 29.3% 92 184 108.8 44 1tf1:A Crystal structure of the e. Coli glyoxylate regulatory protein ligand binding domain

Number of sequences: 32

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 81 30.6% 85 396 108.7 44 4ihc:A Crystal structure of probable mannonate dehydratase dd703_09 efi-502222) from dickeya dadantii ech703
2. 78 24.1% 79 229 108.6 45 3i78:A 35/99/170/186/220-loops of fxa in sgt
3. 78 24.1% 79 230 108.5 45 3i77:A 35/99/170-loops of fxa in sgt
4. 82 25.9% 81 523 108.1 48 1m9s:A Crystal structure of internalin b (inlb), a listeria monocytogenes virulence protein containing sh3-like domains.

Number of sequences: 4

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer