spacer
spacer

SAS results for UniProt accession no. P03281

Sequence annotated by structure
>

Key:
Sec. struc: By homology
  Helix Strand  

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

 

FASTA alignment for UniProt accession no. P03281 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P03281 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 41 unique sequences (including 6 consensus sequences) giving 50 sequence matches in all. The 28 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P03281 -----------------------------------------------------------------   Hexon-interlacing protein OS=Human adenovirus C serotype 5  ...
3iyn:Q -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :T -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :S -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :R -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
3zif:N -----------------------------------------------------------------   Cryo-em structures of two intermediates provide insight  ...
2aee:A -----------------------------------------------------------------   Crystal structure of orotate phosphoribosyltransferase from  ...
2lpj:A*-----------------------------------------------------------------×2 Nmr structure of major ampullate spidroin 1 n-terminal  ...
3lrd:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr6:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr8:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr2:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
1io1:A*-------------------------------------------------------nikgltqasr×2 Crystal structure of f41 fragment of flagellin
1ucu:A aqvintnslslltqnnlnksqsalgtaierlssglrinsakddaagqaianrftanikgltqasr   R-type straight flagellar filament made of full-length  ...
3a5x:A aqvintnslslltqnnlnksqsalgtaierlssglrinsakddaagqaianrftanikgltqasr   L-type straight flagellar filament made of full-length flage
4h1z:A -----------------------------------------------------------------   Crystal structure of putative isomerase from sinorhizobium  ...
2ppg:A -----------------------------------------------------------------   Crystal structure of putative isomerase from sinorhizobium m
2c1u:A -----------------------------------------------------------------   Crystal structure of the di-haem cytochromE C peroxidase  ...
2c1v:A -----------------------------------------------------------------   Crystal structure of the di-haem cytochromE C peroxidase  ...
1l64:A -----------------------------------------------------------------   Tolerance of t4 lysozyme to multiple xaa (right arrow) ala  ...
1k3u:A -----------------------------------------------------------------   Crystal structure of wild-type tryptophan synthase  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P03281 -----------------------------------------------------------------   Hexon-interlacing protein OS=Human adenovirus C serotype 5  ...
3iyn:Q -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :T -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :S -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :R -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
3zif:N -----------------------------------------------------------------   Cryo-em structures of two intermediates provide insight  ...
2aee:A -----------------------------------------------------------------   Crystal structure of orotate phosphoribosyltransferase from  ...
2lpj:A*-----------------------------------------------------------------×2 Nmr structure of major ampullate spidroin 1 n-terminal  ...
3lrd:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr6:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr8:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr2:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
1io1:A*nandgisiaqttegalneinnnlqrvrelavqsanstnsqsdldsiqaeitqrlneidrvsgqtq×2 Crystal structure of f41 fragment of flagellin
1ucu:A nandgisiaqttegalneinnnlqrvrelavqsanstnsqsdldsiqaeitqrlneidrvsgqtq   R-type straight flagellar filament made of full-length  ...
3a5x:A nandgisiaqttegalneinnnlqrvrelavqsanstnsqsdldsiqaeitqrlneidrvsgqtq   L-type straight flagellar filament made of full-length flage
4h1z:A -----------------------------------------------------------------   Crystal structure of putative isomerase from sinorhizobium  ...
2ppg:A -----------------------------------------------------------------   Crystal structure of putative isomerase from sinorhizobium m
2c1u:A -----------------------------------------------------aidngalreeak   Crystal structure of the di-haem cytochromE C peroxidase  ...
2c1v:A -----------------------------------------------aidngalreeakgvfeai   Crystal structure of the di-haem cytochromE C peroxidase  ...
1l64:A -----------------------------------------------------------------   Tolerance of t4 lysozyme to multiple xaa (right arrow) ala  ...
1k3u:A -----------------------------------------------------------------   Crystal structure of wild-type tryptophan synthase  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P03281 -----------------------------------------------------------------   Hexon-interlacing protein OS=Human adenovirus C serotype 5  ...
3iyn:Q -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :T -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :S -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :R -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
3zif:N -----------------------------------------------------------------   Cryo-em structures of two intermediates provide insight  ...
2aee:A -----------------------------------------------------------------   Crystal structure of orotate phosphoribosyltransferase from  ...
2lpj:A*-----------------------------------------------------------------×2 Nmr structure of major ampullate spidroin 1 n-terminal  ...
3lrd:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr6:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr8:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr2:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
1io1:A*fngvkvlaqdntltiqvgandgetididlkqinsqtlgldtlnvqqkykvsdtaatvtgyadtti×2 Crystal structure of f41 fragment of flagellin
1ucu:A fngvkvlaqdntltiqvgandgetididlkqinsqtlgldtlnvqqkykvsdtaatvtgyadtti   R-type straight flagellar filament made of full-length  ...
3a5x:A fngvkvlaqdntltiqvgandgetididlkqinsqtlgldtlnvqqkykvsdtaatvtgyadtti   L-type straight flagellar filament made of full-length flage
4h1z:A -----------------------------------------------------------------   Crystal structure of putative isomerase from sinorhizobium  ...
2ppg:A -----------------------------------------------------------------   Crystal structure of putative isomerase from sinorhizobium m
2c1u:A gvfeaipekmtaikqtegvpltaekielgkvlffdprmsssgliscqtchnvglggvdglptsig   Crystal structure of the di-haem cytochromE C peroxidase  ...
2c1v:A pekmtaikqtednpegvpltaekielgkvlffdprmsssgliscqtchnvglggvdglptsighg   Crystal structure of the di-haem cytochromE C peroxidase  ...
1l64:A -----------------------------------------------------------------   Tolerance of t4 lysozyme to multiple xaa (right arrow) ala  ...
1k3u:A -------------------------------------------meryenlfaqlndrregafvpf   Crystal structure of wild-type tryptophan synthase  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P03281 -----------------------------------------------------------------   Hexon-interlacing protein OS=Human adenovirus C serotype 5  ...
3iyn:Q -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :T -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :S -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :R -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
3zif:N -----------------------------------------------------------------   Cryo-em structures of two intermediates provide insight  ...
2aee:A --------------------------------------aamtlasqiatqlldikavylkpedpf   Crystal structure of orotate phosphoribosyltransferase from  ...
2lpj:A*-----------------------------------------------------------------×2 Nmr structure of major ampullate spidroin 1 n-terminal  ...
3lrd:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr6:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr8:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr2:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
1io1:A*aldnstfkasatglggtdqkidgdlkfddttgkyyakvtvtggtgkdgyyevsvdktngevtlag×2 Crystal structure of f41 fragment of flagellin
1ucu:A aldnstfkasatglggtdqkidgdlkfddttgkyyakvtvtggtgkdgyyevsvdktngevtlag   R-type straight flagellar filament made of full-length  ...
3a5x:A aldnstfkasatglggtdqkidgdlkfddttgkyyakvtvtggtgkdgyyevsvdktngevtlag   L-type straight flagellar filament made of full-length flage
4h1z:A --------------------sdrvkkiesftltlpeepngrgylvrkanrtvyptfdrsvlvrie   Crystal structure of putative isomerase from sinorhizobium  ...
2ppg:A ---------drvkkiesftltlpretpylgkprpgeepngrgylvrkanrtvyptfdrsvlvrie   Crystal structure of putative isomerase from sinorhizobium m
2c1u:A hgwqkgprnaptmlnaifnaaqfwdgraadlaeqakgpvqagvsntpdqvvktinsmpeyveafk   Crystal structure of the di-haem cytochromE C peroxidase  ...
2c1v:A wqkgprnaptmlnaifnaaqfwdgraadlaeqakgpvqagvemsntpdqvvktinsmpeyveafk   Crystal structure of the di-haem cytochromE C peroxidase  ...
1l64:A -----------------------------------------------------------------   Tolerance of t4 lysozyme to multiple xaa (right arrow) ala  ...
1k3u:A vtlgdpgieqslkiidtlidagadalelgvpfsdpladgptiqnanlrafaagvtpaqcfemlal   Crystal structure of wild-type tryptophan synthase  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P03281 ------------------------------------------------mstnsfdgsivssyltt   Hexon-interlacing protein OS=Human adenovirus C serotype 5  ...
3iyn:Q ------------------------------------------------------dgsivssyltt   3.6-angstrom cryoem structure of human adenovirus type 5
  " :T ------------------------------------------------------dgsivssyltt   3.6-angstrom cryoem structure of human adenovirus type 5
  " :S ------------------------------------------------------dgsivssyltt   3.6-angstrom cryoem structure of human adenovirus type 5
  " :R ------------------------------------------------------dgsivssyltt   3.6-angstrom cryoem structure of human adenovirus type 5
3zif:N ------------------------------------------------------egriyvpyvta   Cryo-em structures of two intermediates provide insight  ...
2aee:A twasgikspiytdnrvtlsypktrdliengfvetikahfpeveviagtatagiphgaiiadkmtl   Crystal structure of orotate phosphoribosyltransferase from  ...
2lpj:A*------------------------------------------------------------gsgns×2 Nmr structure of major ampullate spidroin 1 n-terminal  ...
3lrd:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr6:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr8:A ------------------------------------------------------------gsgns   Self-assembly of spider silk proteins is controlled by a  ...
3lr2:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
1io1:A*gatspltgglpatatedvknvqvanadlteakaaltaagvtgtasvvkmsytdnngktidgglav×2 Crystal structure of f41 fragment of flagellin
1ucu:A gatspltgglpatatedvknvqvanadlteakaaltaagvtgtasvvkmsytdnngktidgglav   R-type straight flagellar filament made of full-length  ...
3a5x:A gatspltgglpatatedvknvqvanadlteakaaltaagvtgtasvvkmsytdnngktidgglav   L-type straight flagellar filament made of full-length flage
4h1z:A tengavgwgetyglvapratmeiiddlladftigrdpfdaaaihddlydlmrvrgytggfyvdal   Crystal structure of putative isomerase from sinorhizobium  ...
2ppg:A tengavgwgetyglvapratmeiiddlladftigrdpfdaaaihddlydlmrvrgytggfyvdal   Crystal structure of putative isomerase from sinorhizobium m
2c1u:A aafpeeadpvtfdnfaaaieqfeatlitpnsafdrflagddaamtdqekrglqafmetgctachy   Crystal structure of the di-haem cytochromE C peroxidase  ...
2c1v:A aafpeeadpvtfdnfaaaieqfeatlitpnsafdrflagddaamtdqekrglqafmetgctachy   Crystal structure of the di-haem cytochromE C peroxidase  ...
1l64:A -----------------------------------------------------------------   Tolerance of t4 lysozyme to multiple xaa (right arrow) ala  ...
1k3u:A irekhptipigllmyanlvfnngidafyarceqvgvdsvlvadvpveesapfrqaalrhniapif   Crystal structure of wild-type tryptophan synthase  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P03281 rm-ppwa--g---vrqnvmgs-sidgrpvlpansttl--t-ye--tvs--gtp-letaasaaa-s   Hexon-interlacing protein OS=Human adenovirus C serotype 5  ...
3iyn:Q rm-ppwa--g---vrqnvmgs-sidgrpvlpansttl--t-ye--tvs--gtp-letaasaaa-s   3.6-angstrom cryoem structure of human adenovirus type 5
  " :T rm-ppwa--g---vrqnvmgs-sidgrpvlpansttl--t-ye--tvs--g--------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :S rm-ppwa--g---vrqnvmgs-sidgrpvlpansttl--t-ye--tvs--g--------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :R rm-ppwa--g---vrqnvmgs-sidgrpvlpansttl--t-ye--tvs--g--------------   3.6-angstrom cryoem structure of human adenovirus type 5
3zif:N rl-pkws--g---svqdktgs-nmlggvvlppnsqah--r-te--tv---gte-atrdnlhae-g   Cryo-em structures of two intermediates provide insight  ...
2aee:A ----pfa--y---irskpkgn-qiegr-vlkgqkmvi--i-ed--listggsv-ld--aaaaa-s   Crystal structure of orotate phosphoribosyltransferase from  ...
2lpj:A*ht-tpwtnpg---laenfmns-fmqglssmpgftasq--l-ddmstia--qsm-vqsiqslaa-q×2 Nmr structure of major ampullate spidroin 1 n-terminal  ...
3lrd:A ht-tpwtnpg---laenfmns-fmqglssmpgftasqldn-ms--tia--qsm-vqsiqslaa-q   Self-assembly of spider silk proteins is controlled by a  ...
3lr6:A ht-tpwtnpg---laenfmns-fmqglssmpgftasqldn-ms--tia--qsm-vqsiqslaa-q   Self-assembly of spider silk proteins is controlled by a  ...
3lr8:A ht-tpwtnpg---laenfmns-fmqglssmpgftasq--l-ddmstia--qsm-vqsiqslaa-q   Self-assembly of spider silk proteins is controlled by a  ...
3lr2:A ht-tpwtnpg---laenfmns-fmqglssmpgftasq--l-ddmstia--qsm-vqsiqslaa-q   Self-assembly of spider silk proteins is controlled by a  ...
1io1:A*kvgddyy--s---atqnkdgsisinttkytaddgtsk--taln--klg--gad-gktevvsig-g×2 Crystal structure of f41 fragment of flagellin
1ucu:A kvgddyy--s---atqnkdgsisinttkytaddgtsk--taln--klg--gad-gktevvsig-g   R-type straight flagellar filament made of full-length  ...
3a5x:A kvgddyy--s---atqnkdgsisinttkytaddgtsk--taln--klg--gad-gktevvsig-g   L-type straight flagellar filament made of full-length flage
4h1z:A aa-idia--l---wdlagkla-glpvckllggqrrdr--i-aa--yis--glp-edtrakrae-l   Crystal structure of putative isomerase from sinorhizobium  ...
2ppg:A aa-idia--l---wdlagkla-glpvckllggqrrdr--i-aa--yis--glp-edtrakrae-l   Crystal structure of putative isomerase from sinorhizobium m
2c1u:A gv-nfgg--q---dyhpfgli-akpgaevlpagdtg---r-fe--vtr--ttd-deyvfraaplr   Crystal structure of the di-haem cytochromE C peroxidase  ...
2c1v:A gv-nfgg--q---dyhpfgli-akpgaevlpagdtg---r-fe--vtr--ttd-deyvfraaplr   Crystal structure of the di-haem cytochromE C peroxidase  ...
1l64:A ---mnif--e---mlridegl-rlkiykdtegyytig--i-gh--llt--kspslaaaaaaaa-a   Tolerance of t4 lysozyme to multiple xaa (right arrow) ala  ...
1k3u:A ic-ppna--dddllrq--vas-ygrgytyllsrsgvt--g-ae--nrg--alp-lhhlieklk-e   Crystal structure of wild-type tryptophan synthase  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P03281 aaaata----rgivt-dfaf-lsplassaasr--ssarddkltallaql-dsltre--lnvvsqq   Hexon-interlacing protein OS=Human adenovirus C serotype 5  ...
3iyn:Q aaaata----rgivt-dfaf-lsplassaasr--ssarddkltallaql-dsltre--lnvvsqq   3.6-angstrom cryoem structure of human adenovirus type 5
  " :T ---------------------------------------dkltallaql-dsltre--lnvvsqq   3.6-angstrom cryoem structure of human adenovirus type 5
  " :S ----------------------------------ssarddkltallaql-dsltre--lnvvsqq   3.6-angstrom cryoem structure of human adenovirus type 5
  " :R ------------------------------------arddkltallaql-dsltre--lnvvsqq   3.6-angstrom cryoem structure of human adenovirus type 5
3zif:N arrped----qtpym-ilve-dslgglkrrmd--lleesnqqllatlnr-lrtgla--a------   Cryo-em structures of two intermediates provide insight  ...
2aee:A regadv----lgvva-ifty-elpkasqnfke--agiklitlsnyteli-avaklq--gyitndg   Crystal structure of orotate phosphoribosyltransferase from  ...
2lpj:A*grtspn----klqal-nmaf-assmaeiaaseegggslstktssiasamsnaflqt--tgvvnqp×2 Nmr structure of major ampullate spidroin 1 n-terminal  ...
3lrd:A grtspn----klqal-nmaf-assmaeiaasqegggslstktssiasamsnaflqt--tgvvnqp   Self-assembly of spider silk proteins is controlled by a  ...
3lr6:A grtspn----klqal-nmaf-assmaeiaaseegggslstktssiasamsnaflqt--tgvvnqp   Self-assembly of spider silk proteins is controlled by a  ...
3lr8:A grtspn----klqal-nmaf-assmaqiaaseegggslstktssiasamsnaflqt--tgvvnqp   Self-assembly of spider silk proteins is controlled by a  ...
3lr2:A grtspn----klqal-nmaf-assmaeiaaseegggslstktssiasamsnaflqt--tgvvnqp   Self-assembly of spider silk proteins is controlled by a  ...
1io1:A*ktyaas----kaegh-nfka-qpdlaeaaatt--tenplqkidaalaqv-dtlrsd--laavqnr×2 Crystal structure of f41 fragment of flagellin
1ucu:A ktyaas----kaegh-nfka-qpdlaeaaatt--tenplqkidaalaqv-dtlrsd--lgavqnr   R-type straight flagellar filament made of full-length  ...
3a5x:A ktyaas----kaegh-nfka-qpdlaeaaatt--tenplqkidaalaqv-dtlrsd--laavqnr   L-type straight flagellar filament made of full-length flage
4h1z:A aaawqa----kgf-s-sfkf-aspvaddgvak--emeilrerlgpavri-acdmhw--ahtasea   Crystal structure of putative isomerase from sinorhizobium  ...
2ppg:A aaawqa----kgf-s-sfkf-aspvaddgvak--emeilrerlgpavri-acdmhw--ahtasea   Crystal structure of putative isomerase from sinorhizobium m
2c1u:A nvaltapyfhsgvvw-elae-avkimssaqig--teltdqqaeditafl-gtltge--qpvidhp   Crystal structure of the di-haem cytochromE C peroxidase  ...
2c1v:A nvaltapyfhsgvvw-elae-avkimssaqig--teltdqqaeditafl-gtltge--qpvidhp   Crystal structure of the di-haem cytochromE C peroxidase  ...
1l64:A aigrnt----ngvitkdeaeklfnqdvdaavr--gilrnaklkpvydsl-davrraalinmvfqm   Tolerance of t4 lysozyme to multiple xaa (right arrow) ala  ...
1k3u:A yhaapa-------lq-gfgi-sspeqvsaavr--agaagaisgsaivki---iekn--laspkqm   Crystal structure of wild-type tryptophan synthase  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P03281 lld-lrqqvsalkassppnav--------------------------------------------   Hexon-interlacing protein OS=Human adenovirus C serotype 5  ...
3iyn:Q lld-lrqqvsalkas--------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :T lld-lrqqvsalka---------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :S lld-lrqqvsa------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :R lld-lrqqvsalkasspp-----------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
3zif:N -----------------------------------------------------------------   Cryo-em structures of two intermediates provide insight  ...
2aee:A lhl-lkkfkedqvnwq-------------------------------------------------   Crystal structure of orotate phosphoribosyltransferase from  ...
2lpj:A*fin-eitqlvsmfaqagmndvsa------------------------------------------×2 Nmr structure of major ampullate spidroin 1 n-terminal  ...
3lrd:A fin-eitqlvsmfaqagmnd---------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr6:A fineitqlvsmfaqa--------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr8:A fineitqlvsmfaqag-------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr2:A fineitqlvsmfaqa--------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
1io1:A*fns-aitnlgntvnnltsar---------------------------------------------×2 Crystal structure of f41 fragment of flagellin
1ucu:A fns-aitnlgntvnnltsvrsriedsdyatevsnmsraqilqqagtsvlaqanqvpqnvlsllr-   R-type straight flagellar filament made of full-length  ...
3a5x:A fns-aitnlgntvnnltsarsriedsdyatevsnmsraqilqqagtsvlaqanqvpqnvlsllr-   L-type straight flagellar filament made of full-length flage
4h1z:A val-ikamephglwfaeapvrtedidglarvaasvstaiavgeewrtvhdmvprvarralaivqp   Crystal structure of putative isomerase from sinorhizobium  ...
2ppg:A val-ikamephglwfaeapvrtedidglarvaasvstaiavgeewrtvhdmvprvarralaivqp   Crystal structure of putative isomerase from sinorhizobium m
2c1u:A ilp-vrtgttplptpm-------------------------------------------------   Crystal structure of the di-haem cytochromE C peroxidase  ...
2c1v:A ilp-vrtgttplptpm-------------------------------------------------   Crystal structure of the di-haem cytochromE C peroxidase  ...
1l64:A get-gvagftnslrmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk--------   Tolerance of t4 lysozyme to multiple xaa (right arrow) ala  ...
1k3u:A lae-lrsfvsamkaasra-----------------------------------------------   Crystal structure of wild-type tryptophan synthase  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P03281 -----------------------------------------------------------------   Hexon-interlacing protein OS=Human adenovirus C serotype 5  ...
3iyn:Q -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :T -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :S -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
  " :R -----------------------------------------------------------------   3.6-angstrom cryoem structure of human adenovirus type 5
3zif:N -----------------------------------------------------------------   Cryo-em structures of two intermediates provide insight  ...
2aee:A -----------------------------------------------------------------   Crystal structure of orotate phosphoribosyltransferase from  ...
2lpj:A*-----------------------------------------------------------------×2 Nmr structure of major ampullate spidroin 1 n-terminal  ...
3lrd:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr6:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr8:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
3lr2:A -----------------------------------------------------------------   Self-assembly of spider silk proteins is controlled by a  ...
1io1:A*-----------------------------------------------------------------×2 Crystal structure of f41 fragment of flagellin
1ucu:A -----------------------------------------------------------------   R-type straight flagellar filament made of full-length  ...
3a5x:A -----------------------------------------------------------------   L-type straight flagellar filament made of full-length flage
4h1z:A emghkgitqfmrigayahvhhikviphatigagiflaaslqasaalanvdchefqhsifepnrrl   Crystal structure of putative isomerase from sinorhizobium  ...
2ppg:A emghkgitqfmrigayahvhhikviphatigagiflaaslqasaalanvdchefqhsifepnrrl   Crystal structure of putative isomerase from sinorhizobium m
2c1u:A -----------------------------------------------------------------   Crystal structure of the di-haem cytochromE C peroxidase  ...
2c1v:A -----------------------------------------------------------------   Crystal structure of the di-haem cytochromE C peroxidase  ...
1l64:A -----------------------------------------------------------------   Tolerance of t4 lysozyme to multiple xaa (right arrow) ala  ...
1k3u:A -----------------------------------------------------------------   Crystal structure of wild-type tryptophan synthase  ...

           5         6         6         6
           9         0         1         2
       67890123456789012345678901234567890                                 Protein name
       ----+---------+---------+---------+                                 ------------
P03281 -----------------------------------                                 Hexon-interlacing protein OS=Human adenovirus C serotype 5  ...
3iyn:Q -----------------------------------                                 3.6-angstrom cryoem structure of human adenovirus type 5
  " :T -----------------------------------                                 3.6-angstrom cryoem structure of human adenovirus type 5
  " :S -----------------------------------                                 3.6-angstrom cryoem structure of human adenovirus type 5
  " :R -----------------------------------                                 3.6-angstrom cryoem structure of human adenovirus type 5
3zif:N -----------------------------------                                 Cryo-em structures of two intermediates provide insight  ...
2aee:A -----------------------------------                                 Crystal structure of orotate phosphoribosyltransferase from  ...
2lpj:A*-----------------------------------                              ×2 Nmr structure of major ampullate spidroin 1 n-terminal  ...
3lrd:A -----------------------------------                                 Self-assembly of spider silk proteins is controlled by a  ...
3lr6:A -----------------------------------                                 Self-assembly of spider silk proteins is controlled by a  ...
3lr8:A -----------------------------------                                 Self-assembly of spider silk proteins is controlled by a  ...
3lr2:A -----------------------------------                                 Self-assembly of spider silk proteins is controlled by a  ...
1io1:A*-----------------------------------                              ×2 Crystal structure of f41 fragment of flagellin
1ucu:A -----------------------------------                                 R-type straight flagellar filament made of full-length  ...
3a5x:A -----------------------------------                                 L-type straight flagellar filament made of full-length flage
4h1z:A lvgdmdclngeyvvptgpglgvepskeaqgllkkh                                 Crystal structure of putative isomerase from sinorhizobium  ...
2ppg:A lvgdmdclngeyvvptgpglgvepskeaqgllkkh                                 Crystal structure of putative isomerase from sinorhizobium m
2c1u:A -----------------------------------                                 Crystal structure of the di-haem cytochromE C peroxidase  ...
2c1v:A -----------------------------------                                 Crystal structure of the di-haem cytochromE C peroxidase  ...
1l64:A -----------------------------------                                 Tolerance of t4 lysozyme to multiple xaa (right arrow) ala  ...
1k3u:A -----------------------------------                                 Crystal structure of wild-type tryptophan synthase  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P03281. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 140 - - P03281 Hexon-interlacing protein OS=Human adenovirus C serotype 5 GN=IX PE=1 SV=1
2. 774 100.0% 128 128 1002.5 7.3e-49 3iyn:Q 3.6-angstrom cryoem structure of human adenovirus type 5
3. 426 66.1% 127 84 420.0 2e-16 3iyn:T 3.6-angstrom cryoem structure of human adenovirus type 5
4. 450 69.4% 124 86 418.6 2.4e-16 3iyn:S 3.6-angstrom cryoem structure of human adenovirus type 5
5. 482 69.5% 131 91 415.6 3.6e-16 3iyn:R 3.6-angstrom cryoem structure of human adenovirus type 5
6. 122 44.9% 49 107 168.6 0.021 3zif:N Cryo-em structures of two intermediates provide insight into adenovirus assembly and disassembly
7. 109 32.9% 82 206 147.4 0.31 2aee:A Crystal structure of orotate phosphoribosyltransferase from streptococcus pyogenes
8. 100 21.3% 127 137 138.7 0.95 2lpj:A * Nmr structure of major ampullate spidroin 1 n-terminal domai 7.2
9. " " " " " "  = 2lth:A *
Nmr structure of major ampullate spidroin 1 n-terminal domai 5.5
10. 99 20.8% 125 129 137.8 1.1 3lrd:A Self-assembly of spider silk proteins is controlled by a ph- relay
11. 96 22.2% 117 125 134.2 1.7 3lr6:A Self-assembly of spider silk proteins is controlled by a ph- relay
12. 96 22.2% 117 131 133.8 1.8 3lr8:A Self-assembly of spider silk proteins is controlled by a ph- relay
13. 95 22.2% 117 125 132.9 2 3lr2:A Self-assembly of spider silk proteins is controlled by a ph- relay
14. 91 23.4% 124 395 119.8 11 1io1:A * Crystal structure of f41 fragment of flagellin
15. " " " " " "  = 1p95:A *
A structural study of the binding of flagellin by toll-like receptor 5
16. 92 23.4% 124 494 119.5 11 1ucu:A R-type straight flagellar filament made of full-length flagellin
17. 91 23.4% 124 494 118.2 13 3a5x:A L-type straight flagellar filament made of full-length flage
18. 87 39.0% 41 376 115.0 20 4h1z:A Crystal structure of putative isomerase from sinorhizobium m open loop conformation (target efi-502104)
19. 87 39.0% 41 387 114.8 20 2ppg:A Crystal structure of putative isomerase from sinorhizobium m
20. 85 29.7% 101 329 113.4 24 2c1u:A Crystal structure of the di-haem cytochromE C peroxidase from paracoccus pantotrophus - oxidised form
21. 85 29.7% 101 335 113.3 25 2c1v:A Crystal structure of the di-haem cytochromE C peroxidase from paracoccus pantotrophus - mixed valence form
22. 80 34.2% 73 162 111.9 30 1l64:A Tolerance of t4 lysozyme to multiple xaa (right arrow) ala substitutions: a polyalanine alpha-helix containing ten consecutive alanines
23. 82 28.6% 119 268 111.0 33 1k3u:A Crystal structure of wild-type tryptophan synthase complexed [1h-indol-3-yl-acetyl]aspartic acid

Number of sequences: 23

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 82 28.6% 119 267 111.0 33 1tjp:A Crystal structure of wild-type tryptophan synthase complexed [(2-hydroxylphenyl)amino]3-glycerolphosphate
2. 82 28.6% 119 267 111.0 33 1wbj:A * Wildtype tryptophan synthase complexed with glycerol phosphate
3. " " " " " "  = 2clk:A *
Tryptophan synthase in complex with d-glyceraldehyde 3- phosphate (g3p)
4. 82 28.6% 119 266 111.0 33 3cep:A Structure of a tryptophan synthase quinonoid intermediate
5. 82 28.6% 119 266 111.0 33 3pr2:A Tryptophan synthase indoline quinonoid structure with f9 inh alpha site
6. 82 28.6% 119 268 111.0 33 4hn4:A * Tryptophan synthase in complex with alpha aminoacrylate e(a- and the f9 inhibitor in the alpha site
7. " " " " " "  = 4hpj:A *
Crystal structure of tryptophan synthase at 1.45 a resolutio complex with 2-aminophenol quinonoid in the beta site and t inhibitor in the alpha site
8. " " " " " "  = 4hpx:A *
Crystal structure of tryptophan synthase at 1.65 a resolutio complex with alpha aminoacrylate e(a-a) and benzimidazole i site and the f9 inhibitor in the alpha site
9. " " " " " "  = 4ht3:A *
The crystal structure of salmonella typhimurium tryptophan s 1.30a complexed with n-(4'-trifluoromethoxybenzenesulfonyl) 1-ethylphosphate (f9) inhibitor in the alpha site, internal
10. " " " " " "  = 4kkx:A *
Crystal structure of tryptophan synthase from salmonella typ with 2-aminophenol quinonoid in the beta site and the f6 in the alpha site
11. 77 28.8% 52 116 110.4 36 1j1d:F Crystal structure of the 46kda domain of human cardiac troponin in the ca2+ saturated form
12. 80 31.8% 110 207 110.2 37 2yg8:A * Structure of an unusual 3-methyladenine DNA glycosylase ii ( alka) from deinococcus radiodurans
13. " " " " " "  = 2yg9:A *
Structure of an unusual 3-methyladenine DNA glycosylase ii ( alka) from deinococcus radiodurans
14. 84 38.6% 57 447 110.0 38 4lnb:B Aspergillus fumigatus protein farnesyltransferase ternary co farnesyldiphosphate and ethylenediamine scaffold inhibitor
15. 84 38.6% 57 446 110.0 38 4lng:B Aspergillus fumigatus protein farnesyltransferase complex wi farnesyldiphosphate and tipifarnib
16. 84 38.6% 57 445 110.0 38 4mbg:B Crystal structure of aspergillus fumigatus protein farnesylt binary complex with farnesyldiphosphate
17. 84 38.6% 57 452 109.9 38 4l9p:B Crystal structure of aspergillus fumigatus protein farnesylt complexed with the fii analog, fpt-ii, and the kcvvm peptid
18. 79 38.6% 70 191 109.5 40 2id3:A Crystal structure of transcriptional regulator sco5951 from streptomyces coelicolor a3(2)
19. 79 26.0% 119 198 109.2 42 3rug:E Crystal structure of valpha10-vbeta8.1 nkt tcr in complex wi alphaglucosylceramide (c20:2)
20. 83 27.4% 95 435 108.9 43 2g5f:A The structure of mbti from mycobacterium tuberculosis, the f enzyme in the synthesis of mycobactin, reveals it to be a s synthase
21. 80 26.4% 129 250 108.9 43 2rhg:A Tryptophan synthase complexed with igp, ph 7.0, internal ald
22. 83 27.4% 95 435 108.9 43 3log:A Crystal structure of mbti from mycobacterium tuberculosis
23. 83 27.4% 95 436 108.9 43 3st6:A Structure of a m. Tuberculosis synthase, mbti, in complex wi isochorismate analogue inhibitor
24. 83 27.4% 95 435 108.9 43 3veh:A Structure of a m. Tuberculosis salicylate synthase, mbti, in with an inhibitor methylamt
25. 78 30.0% 80 190 108.2 47 4k0m:C * Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
26. " " " " " "  = 4k0q:C *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
27. 76 28.0% 50 139 107.8 50 1bvq:A Three-dimensional structure of 4-hydroxybenzoyl coa thioesterase from pseudomonas sp. Strain cbs-3.
28. 82 31.1% 90 421 107.8 50 2j9i:A Lengsin is a survivor of an ancient family of class i glutamine synthetases in eukaryotes that has undergone evolutionary re-engineering for a tissue-specific role in the vertebrate eye lens.

Number of sequences: 28

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer