spacer
spacer

SAS results for UniProt accession no. P0A800

Sequence annotated by structure

Key:
Sec. struc: By homology Predicted
  Helix Strand   Helix Strand
Residue contacts:   to ligand
Active sites:   (from PDB SITE records)

Predicted secondary structure (green) comes from the DSC program. The lighter the green the less certain the prediction. Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P0A800 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P0A800 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 14 unique sequences (including 7 consensus sequences) giving 36 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P0A800 -----------------------------------------------------------------   DNA-directed RNA polymerase subunit omega OS=Escherichia  ...
3iyd:E*-----------------------------------------------------------------×8 Three-dimensional em structure of an intact  ...
4mex:E*-----------------------------------------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
3lu0:E*-----------------------------------------------------------------×5 Molecular model of escherichia coli core RNA polymerase
4ljz:K*-----------------------------------------------------------------×4 Crystal structure analysis of the e.Coli holoenzyme
4igc:J*-----------------------------------------------------------------×6 X-ray crystal structure of escherichia coli sigma70 holoenzy
4mex:K*-----------------------------------------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
1yio:A*-----------------------------------------------------------------×2 Crystallographic structure of response regulator styr from  ...
3smh:A ------------------------------------------------rnnpfyfpsrrfstryg   Crystal structure of major peanut allergen ara h 1
1wz8:A -----------------------------------------------------------------   Crystal structure of probable enoyl-coa dehydratase from  ...
3i12:A -----------------------------------------------------------------   The crystal structure of the d-alanyl-alanine synthetase a  ...
3q1k:A -----------------------------------------------------------------   The crystal structure of the d-alanyl-alanine synthetase a  ...
4hzs:A qsltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfirevn   Crystal structure of ack1 kinase domain with c-terminal sh3
1dd1:A -----------------------------------------------------------------   Crystal structure analysis of the smad4 active fragment
1g88:A -----------------------------------------------------------------   S4afl3arg515 mutant

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P0A800 -----------------------------------------------------------------   DNA-directed RNA polymerase subunit omega OS=Escherichia  ...
3iyd:E*-----------------------------------------------------------------×8 Three-dimensional em structure of an intact  ...
4mex:E*-----------------------------------------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
3lu0:E*-----------------------------------------------------------------×5 Molecular model of escherichia coli core RNA polymerase
4ljz:K*-----------------------------------------------------------------×4 Crystal structure analysis of the e.Coli holoenzyme
4igc:J*-----------------------------------------------------------------×6 X-ray crystal structure of escherichia coli sigma70 holoenzy
4mex:K*-----------------------------------------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
1yio:A*-----------------------------------------------------------------×2 Crystallographic structure of response regulator styr from  ...
3smh:A nqngrirvlqrfdqrsrqfqnlqnhrivqieakpntlvlpkhadadnilviqqgqatvtvangnn   Crystal structure of major peanut allergen ara h 1
1wz8:A ---laslearypglafawprpgvleitfrgeklnamppalhrglarvwrdleavegvravllrge   Crystal structure of probable enoyl-coa dehydratase from  ...
3i12:A -----------------------------------------------------------------   The crystal structure of the d-alanyl-alanine synthetase a  ...
3q1k:A -----------------------------------------------------------------   The crystal structure of the d-alanyl-alanine synthetase a  ...
4hzs:A amhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgyle   Crystal structure of ack1 kinase domain with c-terminal sh3
1dd1:A ----------------------------------------------------------------n   Crystal structure analysis of the smad4 active fragment
1g88:A ----------------------------------------------------------------n   S4afl3arg515 mutant

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P0A800 -----------------------------------------------------------------   DNA-directed RNA polymerase subunit omega OS=Escherichia  ...
3iyd:E*-----------------------------------------------------------------×8 Three-dimensional em structure of an intact  ...
4mex:E*-----------------------------------------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
3lu0:E*-----------------------------------------------------------------×5 Molecular model of escherichia coli core RNA polymerase
4ljz:K*-----------------------------------------------------------------×4 Crystal structure analysis of the e.Coli holoenzyme
4igc:J*-----------------------------------------------------------------×6 X-ray crystal structure of escherichia coli sigma70 holoenzy
4mex:K*-----------------------------------------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
1yio:A*-----------------akptvfvvdddmsvreglrnllrsagfevetfdcastflehrrpeqhg×2 Crystallographic structure of response regulator styr from  ...
3smh:A rksfnldeghalripsgfisyilnrhdnqnlrvakismpvntpgqfedffpassrdqssylqgfs   Crystal structure of major peanut allergen ara h 1
1wz8:A ggvfsaggsfglieemrasheallrvfweardlvlgplnfprpvvaavekvavgaglalalaadi   Crystal structure of probable enoyl-coa dehydratase from  ...
3i12:A -------------------------------------------------------aklrvgivfg   The crystal structure of the d-alanyl-alanine synthetase a  ...
3q1k:A -------------------------------------------------------aklrvgivfg   The crystal structure of the d-alanyl-alanine synthetase a  ...
4hzs:A skrfihrdlaarnlllatrdlvkigdfglmralpvpfawcapeslktrtfshasdtwmfgvtlwe   Crystal structure of ack1 kinase domain with c-terminal sh3
1dd1:A ghlqhhppmppqppisnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfcl   Crystal structure analysis of the smad4 active fragment
1g88:A ghlqhhppmppqppisnhpapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfcl   S4afl3arg515 mutant

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P0A800 ----------marvtvqdavekignrfdlvlvaar-----rarqmqvggkdplvpeendkttvia   DNA-directed RNA polymerase subunit omega OS=Escherichia  ...
3iyd:E*-----------ARVTVQDAVEKIGNRFDLVLVAAR-----RARQMQVGGKDPLVPEENDKTTVIA×8 Three-dimensional em structure of an intact  ...
4mex:E*------------rvtvqdavekignrfdlvlvaar-----rarqmqvggkdplvpeendkttvia×2 Crystal structure of escherichia coli RNA polymerase in  ...
3lu0:E*-----------arvtvqdavekignrfdlvlvaar-----rarqmqvggkdplvpeendkttvia×5 Molecular model of escherichia coli core RNA polymerase
4ljz:K*-----------arvtvqdavekignrfdlvlvaar-----rarqmqvggkdplvpeendkttvia×4 Crystal structure analysis of the e.Coli holoenzyme
4igc:J*-----------arvtvqdavekignrfdlvlvaar-----rarqmqvggkdplvpeendkttvia×6 X-ray crystal structure of escherichia coli sigma70 holoenzy
4mex:K*------------rvtvqdavekignrfdlvlvaar-----rarqmqvggkdplvpeendkttvia×2 Crystal structure of escherichia coli RNA polymerase in  ...
1yio:A*clvldmrmpgmsgielqeqltaisdgipivfitahgdipmtvramkagaie-flpkpfeeqal--×2 Crystallographic structure of response regulator styr from  ...
3smh:A rntleaafnaefneirrvlleennnegvivkvske-----hveeltkhaks-vseeegditnpin   Crystal structure of major peanut allergen ara h 1
1wz8:A avvgkgtrlldghlrlgvaagdhavllwpllvgma-----kak-yhlllnepltgeeaerlglva   Crystal structure of probable enoyl-coa dehydratase from  ...
3i12:A gksaehevslqsaknivdaidk--trfdvvllgid-----kagqwhvndaenylqnaddpah-ia   The crystal structure of the d-alanyl-alanine synthetase a  ...
3q1k:A gksaehevslqsaknivdaidk--trfdvvllgid-----kagqwhvndaenylqnaddpah-ia   The crystal structure of the d-alanyl-alanine synthetase a  ...
4hzs:A mftygqepwiglngsqilhkidkegerlprpedcp-----qdiynvmvqcwahkpe--drptfva   Crystal structure of ack1 kinase domain with c-terminal sh3
1dd1:A gqlsnvhrteaierarlhigkgvqleckgegdvwv-----rclsdhavfvqsyyldreagrapgd   Crystal structure analysis of the smad4 active fragment
1g88:A gqlsnvhrteaierarlhigkgvqleckgegdvwv-----rclsdhavfvqsyyldreagrapgd   S4afl3arg515 mutant

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P0A800 lreieegl-inn--qildvr-erqeqqeqeaaelqa--vtaiaegrr------------------   DNA-directed RNA polymerase subunit omega OS=Escherichia  ...
3iyd:E*LREIEEGL-INN--QILDVR-ERQEQQEQEAAELQA--VTAIAEGRR------------------×8 Three-dimensional em structure of an intact  ...
4mex:E*lreieegl-inn--qildvr-erqeqqeqeaaelqa--vtaiaegrr------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
3lu0:E*lreieegl-inn--qildvr-erqeqqeqeaaelqa--vtaiaegr-------------------×5 Molecular model of escherichia coli core RNA polymerase
4ljz:K*lreieegl-inn--qildvr-erqeqqeqeaael-------------------------------×4 Crystal structure analysis of the e.Coli holoenzyme
4igc:J*lreieegl-inn--qildvr-erqeqqeqea----------------------------------×6 X-ray crystal structure of escherichia coli sigma70 holoenzy
4mex:K*lreieegl-inn--qildvr-erqeqqeqea----------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
1yio:A*ldaieqglqlna--errqar-etqdqleqlfssltg--reqqvlqltirglmnkqiagelgiaev×2 Crystallographic structure of response regulator styr from  ...
3smh:A lregepdl-snnfgklfevkpdkknpqlqdldmmlt--xveikegalvlphfnskamvivvvnkg   Crystal structure of major peanut allergen ara h 1
1wz8:A l-avedek-vye--kaleva-erlaqgpkealhhtk--halnhwyrsflphfelslaleflgfsg   Crystal structure of probable enoyl-coa dehydratase from  ...
3i12:A lrpsaisl---a--qvpgkh-qhqlinaqngqplpt--vdvifpivhgtlgedgslqgmlrvanl   The crystal structure of the d-alanyl-alanine synthetase a  ...
3q1k:A lrpsaisl---a--qvpgkh-qhqlinaqngqplpt--vdvifpivhgtlgedgslqgmlrvanl   The crystal structure of the d-alanyl-alanine synthetase a  ...
4hzs:A lrdf---l-lea--qptdmr-alqdfeepdklhiqmndvitviegraenywwrgqntrtlcvgpf   Crystal structure of ack1 kinase domain with c-terminal sh3
1dd1:A avhkiyps-ayi--kvfdlr-qchrqmqqqaataqa--aaaaaagigvddlrrlcilrmsfvkgw   Crystal structure analysis of the smad4 active fragment
1g88:A avhkiyps-ayi--kvfdlr-qchrqmqqqaataqa--aaaaaagigvddlrrlcilrmsfvkgw   S4afl3arg515 mutant

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P0A800 -----------------------------------------------------------------   DNA-directed RNA polymerase subunit omega OS=Escherichia  ...
3iyd:E*-----------------------------------------------------------------×8 Three-dimensional em structure of an intact  ...
4mex:E*-----------------------------------------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
3lu0:E*-----------------------------------------------------------------×5 Molecular model of escherichia coli core RNA polymerase
4ljz:K*-----------------------------------------------------------------×4 Crystal structure analysis of the e.Coli holoenzyme
4igc:J*-----------------------------------------------------------------×6 X-ray crystal structure of escherichia coli sigma70 holoenzy
4mex:K*-----------------------------------------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
1yio:A*tvkvhrhnimqklnvrslanlvhlveky-------------------------------------×2 Crystallographic structure of response regulator styr from  ...
3smh:A tgnlelvavrkeqrevrrytarlkegdvfimpaahpvainasselhllgfginaennhriflagd   Crystal structure of major peanut allergen ara h 1
1wz8:A keleeglkalkekrppefp----------------------------------------------   Crystal structure of probable enoyl-coa dehydratase from  ...
3i12:A pfvgsdvlssaacmdkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqg   The crystal structure of the d-alanyl-alanine synthetase a  ...
3q1k:A pfvgsdvlssaacmdkdvakrllrdaglniapfitltrtnrhafsfaevesrlglplfvkpanqg   The crystal structure of the d-alanyl-alanine synthetase a  ...
4hzs:A prnvvtsv---------------------------------------------------------   Crystal structure of ack1 kinase domain with c-terminal sh3
1dd1:A gpdyprqsiketpcwieihlhralqlldevlhtmpi-----------------------------   Crystal structure analysis of the smad4 active fragment
1g88:A gpdypsqsiketpcwieihlhralqlldevlhtmpi-----------------------------   S4afl3arg515 mutant

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P0A800 -----------------------------------------------------------------   DNA-directed RNA polymerase subunit omega OS=Escherichia  ...
3iyd:E*-----------------------------------------------------------------×8 Three-dimensional em structure of an intact  ...
4mex:E*-----------------------------------------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
3lu0:E*-----------------------------------------------------------------×5 Molecular model of escherichia coli core RNA polymerase
4ljz:K*-----------------------------------------------------------------×4 Crystal structure analysis of the e.Coli holoenzyme
4igc:J*-----------------------------------------------------------------×6 X-ray crystal structure of escherichia coli sigma70 holoenzy
4mex:K*-----------------------------------------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
1yio:A*-----------------------------------------------------------------×2 Crystallographic structure of response regulator styr from  ...
3smh:A kdnvidqiekqakdlafpgsgeqvekliknqkeshfvsa--------------------------   Crystal structure of major peanut allergen ara h 1
1wz8:A -----------------------------------------------------------------   Crystal structure of probable enoyl-coa dehydratase from  ...
3i12:A ssvgvskvaneaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefyd   The crystal structure of the d-alanyl-alanine synthetase a  ...
3q1k:A ssvgvskvaneaqyqqavalafefdhkvvveqgikgreiecavlgndnpqastcgeivlnsefky   The crystal structure of the d-alanyl-alanine synthetase a  ...
4hzs:A -----------------------------------------------------------------   Crystal structure of ack1 kinase domain with c-terminal sh3
1dd1:A -----------------------------------------------------------------   Crystal structure analysis of the smad4 active fragment
1g88:A -----------------------------------------------------------------   S4afl3arg515 mutant

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P0A800 -----------------------------------------------------------------   DNA-directed RNA polymerase subunit omega OS=Escherichia  ...
3iyd:E*-----------------------------------------------------------------×8 Three-dimensional em structure of an intact  ...
4mex:E*-----------------------------------------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
3lu0:E*-----------------------------------------------------------------×5 Molecular model of escherichia coli core RNA polymerase
4ljz:K*-----------------------------------------------------------------×4 Crystal structure analysis of the e.Coli holoenzyme
4igc:J*-----------------------------------------------------------------×6 X-ray crystal structure of escherichia coli sigma70 holoenzy
4mex:K*-----------------------------------------------------------------×2 Crystal structure of escherichia coli RNA polymerase in  ...
1yio:A*-----------------------------------------------------------------×2 Crystallographic structure of response regulator styr from  ...
3smh:A -----------------------------------------------------------------   Crystal structure of major peanut allergen ara h 1
1wz8:A -----------------------------------------------------------------   Crystal structure of probable enoyl-coa dehydratase from  ...
3i12:A tkyiddngaqvvvpaqipsevndkiraiaiqayqtlgcagmarvdvfltadnevvineintlpgf   The crystal structure of the d-alanyl-alanine synthetase a  ...
3q1k:A iddngaqvvvpaqipsevndkiraiaiqayqtlgcagmarvdvfltadnevvineintlpgftni   The crystal structure of the d-alanyl-alanine synthetase a  ...
4hzs:A -----------------------------------------------------------------   Crystal structure of ack1 kinase domain with c-terminal sh3
1dd1:A -----------------------------------------------------------------   Crystal structure analysis of the smad4 active fragment
1g88:A -----------------------------------------------------------------   S4afl3arg515 mutant

                5         5         5         5 
                3         4         5         6 
       12345678901234567890123456789012345678901                           Protein name
       ---------+---------+---------+---------+-                           ------------
P0A800 -----------------------------------------                           DNA-directed RNA polymerase subunit omega OS=Escherichia  ...
3iyd:E*-----------------------------------------                        ×8 Three-dimensional em structure of an intact  ...
4mex:E*-----------------------------------------                        ×2 Crystal structure of escherichia coli RNA polymerase in  ...
3lu0:E*-----------------------------------------                        ×5 Molecular model of escherichia coli core RNA polymerase
4ljz:K*-----------------------------------------                        ×4 Crystal structure analysis of the e.Coli holoenzyme
4igc:J*-----------------------------------------                        ×6 X-ray crystal structure of escherichia coli sigma70 holoenzy
4mex:K*-----------------------------------------                        ×2 Crystal structure of escherichia coli RNA polymerase in  ...
1yio:A*-----------------------------------------                        ×2 Crystallographic structure of response regulator styr from  ...
3smh:A -----------------------------------------                           Crystal structure of major peanut allergen ara h 1
1wz8:A -----------------------------------------                           Crystal structure of probable enoyl-coa dehydratase from  ...
3i12:A tnismypklwqasglgytdlisrlielalerhtannalktt                           The crystal structure of the d-alanyl-alanine synthetase a  ...
3q1k:A smypklwqasglgytdlisrlielalerhtannalktt---                           The crystal structure of the d-alanyl-alanine synthetase a  ...
4hzs:A -----------------------------------------                           Crystal structure of ack1 kinase domain with c-terminal sh3
1dd1:A -----------------------------------------                           Crystal structure analysis of the smad4 active fragment
1g88:A -----------------------------------------                           S4afl3arg515 mutant

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P0A800. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 91 - - P0A800 DNA-directed RNA polymerase subunit omega OS=Escherichia coli (strain K12) GN=rpoZ PE=1 SV=1
2. 556 100.0% 90 90 771.0 5.7e-36 3iyd:E * Three-dimensional em structure of an intact activator-depend transcription initiation complex
3. " " " " " "  = 4igc:E *
X-ray crystal structure of escherichia coli sigma70 holoenzy
4. " " " " " "  = 4jk1:E *
X-ray crystal structure of escherichia coli sigma70 holoenzy complex with guanosine tetraphosphate (ppgpp)
5. " " " " " "  = 4jk2:E *
X-ray crystal structure of escherichia coli sigma70 holoenzy complex with guanosine pentaphosphate (pppgpp)
6. " " " " " "  = 4jkr:E *
Crystal structure of e. Coli RNA polymerase in complex with
7. " " " " " "  = 4kmu:E *
X-ray crystal structure of the escherichia coli RNA polymera complex with rifampin
8. " " " " " "  = 4kn4:E *
X-ray crystal structure of the escherichia coli RNA polymera complex with benzoxazinorifamycin-2b
9. " " " " " "  = 4kn7:E *
X-ray crystal structure of the escherichia coli RNA polymera complex with benzoxazinorifamycin-2c
10. 551 100.0% 89 89 764.2 1.4e-35 4mex:E * Crystal structure of escherichia coli RNA polymerase in comp salinamide a
11. " " " " " "  = 4mey:E *
Crystal structure of escherichia coli RNA polymerase holoenz
12. 549 100.0% 89 89 761.5 1.9e-35 3lu0:E * Molecular model of escherichia coli core RNA polymerase
13. " " " " " "  = 4ljz:E *
Crystal structure analysis of the e.Coli holoenzyme
14. " " " " " "  = 4lk0:E *
Crystal structure analysis of the e.Coli holoenzyme/t7 gp2 c
15. " " " " " "  = 4lk1:E *
Crystal structure analysis of the e.Coli holoenzyme
16. " " " " " "  = 4llg:E *
Crystal structure analysis of the e.Coli holoenzyme/gp2 comp
17. 491 100.0% 79 79 683.3 4.4e-31 4ljz:K * Crystal structure analysis of the e.Coli holoenzyme
18. " " " " " "  = 4lk0:K *
Crystal structure analysis of the e.Coli holoenzyme/t7 gp2 c
19. " " " " " "  = 4lk1:K *
Crystal structure analysis of the e.Coli holoenzyme
20. " " " " " "  = 4llg:K *
Crystal structure analysis of the e.Coli holoenzyme/gp2 comp
21. 475 100.0% 76 76 661.7 7e-30 4igc:J * X-ray crystal structure of escherichia coli sigma70 holoenzy
22. " " " " " "  = 4jk1:J *
X-ray crystal structure of escherichia coli sigma70 holoenzy complex with guanosine tetraphosphate (ppgpp)
23. " " " " " "  = 4jk2:J *
X-ray crystal structure of escherichia coli sigma70 holoenzy complex with guanosine pentaphosphate (pppgpp)
24. " " " " " "  = 4kmu:J *
X-ray crystal structure of the escherichia coli RNA polymera complex with rifampin
25. " " " " " "  = 4kn4:J *
X-ray crystal structure of the escherichia coli RNA polymera complex with benzoxazinorifamycin-2b
26. " " " " " "  = 4kn7:J *
X-ray crystal structure of the escherichia coli RNA polymera complex with benzoxazinorifamycin-2c
27. 470 100.0% 75 75 655.0 1.7e-29 4mex:K * Crystal structure of escherichia coli RNA polymerase in comp salinamide a
28. " " " " " "  = 4mey:K *
Crystal structure of escherichia coli RNA polymerase holoenz
29. 80 25.9% 81 198 117.3 15 1yio:A * Crystallographic structure of response regulator styr from pseudomonas fluorescens
30. " " " " " "  = 1zn2:A *
Low resolution structure of response regulator styr
31. 80 27.7% 83 372 113.2 25 3smh:A Crystal structure of major peanut allergen ara h 1
32. 77 29.3% 58 263 111.4 32 1wz8:A Crystal structure of probable enoyl-coa dehydratase from the thermophilus hb8
33. 78 28.4% 81 360 110.7 34 3i12:A The crystal structure of the d-alanyl-alanine synthetase a f salmonella enterica subsp. Enterica serovar typhimurium str
34. 78 28.4% 81 357 110.7 34 3q1k:A The crystal structure of the d-alanyl-alanine synthetase a f salmonella enterica typhimurium complexed with adp
35. 77 34.0% 53 319 110.1 37 4hzs:A Crystal structure of ack1 kinase domain with c-terminal sh3
36. 75 39.3% 28 221 109.8 39 1dd1:A Crystal structure analysis of the smad4 active fragment
37. 75 39.3% 28 221 109.8 39 1g88:A S4afl3arg515 mutant

Number of sequences: 37

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer