spacer
spacer

SAS results for UniProt accession no. Q5SIH3

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. Q5SIH3 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q5SIH3 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 7 unique sequences (including 3 consensus sequences) giving 232 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345     Protein name
       ---------+---------+---------+---------+---------+---------+-----     ------------
Q5SIH3 -----------------------------------------------------------------     30S ribosomal protein Thx OS=Thermus thermophilus (strain  ...
1vvl:U*-----------------------------------------------------------------×107 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1fjf:V*-----------------------------------------------------------------×107 Structure of the thermus thermophilus 30s ribosomal subunit
3uxs:U*-----------------------------------------------------------------×14  The structure of thermorubin in complex with the 70s  ...
4hvm:A glrrasflqrgawrwlreappaaafaargllgsgridddrlaaaadevldafpllrvnfvdddgl     Crystal structure of tallysomycin biosynthesis protein tlmii
  " :B glrrasflqrgawrwlreappaaafaargllgsgridddrlaaaadevldafpllrvnfvdddgl     Crystal structure of tallysomycin biosynthesis protein tlmii
2ghj:A -----------------------------------------------------------------     Crystal structure of folded and partially unfolded forms of  ...
3qyb:A -----------------------------------------------------------------     X-ray crystal structure of human tbc1d4 (as160) rabgap domai

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890     Protein name
       ----+---------+---------+---------+---------+---------+---------+     ------------
Q5SIH3 -----------------------------------------------------------------     30S ribosomal protein Thx OS=Thermus thermophilus (strain  ...
1vvl:U*-----------------------------------------------------------------×107 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1fjf:V*-----------------------------------------------------------------×107 Structure of the thermus thermophilus 30s ribosomal subunit
3uxs:U*-----------------------------------------------------------------×14  The structure of thermorubin in complex with the 70s  ...
4hvm:A wmrtrenadalvrsdlrghpdpqarcvellradrdrptdperdplvrlhlvrlsetdvvlgvvah     Crystal structure of tallysomycin biosynthesis protein tlmii
  " :B wmrtrenadalvrsdlrghpdpqarcvellradrdrptdperdplvrlhlvrlsetdvvlgvvah     Crystal structure of tallysomycin biosynthesis protein tlmii
2ghj:A ------------------------------------------------------------lakgy     Crystal structure of folded and partially unfolded forms of  ...
3qyb:A ----------------------hmkvkldyeevgacqkevlitwdkkllncrakircdmedihtl     X-ray crystal structure of human tbc1d4 (as160) rabgap domai

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345     Protein name
       ---------+---------+---------+---------+---------+---------+-----     ------------
Q5SIH3 mgkgdrrtrr---gk--iwrgtygkyrprkkk---------------------------------     30S ribosomal protein Thx OS=Thermus thermophilus (strain  ...
1vvl:U*-gkgdrrtrr---gk--iwrgtygkyrprkk----------------------------------×107 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1fjf:V*-gkgdrrtrr---gk--iwrgtygkyrprk-----------------------------------×107 Structure of the thermus thermophilus 30s ribosomal subunit
3uxs:U*-gkgdrrtrr---gk--iwrgtygkyrpr------------------------------------×14  The structure of thermorubin in complex with the 70s  ...
4hvm:A qmlldarsrymvlga--vwqayygrfrpaqyrdfaevadfhpldretvrvarhrwwsrrlpalpv     Crystal structure of tallysomycin biosynthesis protein tlmii
  " :B qmlldarsrymvlga--vwqayygrfrpaqyrdfaevadfhpldretvrvarhrwwsrrlpalpv     Crystal structure of tallysomycin biosynthesis protein tlmii
2ghj:A rgqrsrsyrr---akeavmralyyqyrdrklrkrefrrlwiarinaavrayglnystfinglkka     Crystal structure of folded and partially unfolded forms of  ...
3qyb:A lkegvpksrr---ge--iwqflalqyrlrhrlpnkqqppdisykellkqltaqqhailvdlgrtf     X-ray crystal structure of human tbc1d4 (as160) rabgap domai

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890     Protein name
       ----+---------+---------+---------+---------+---------+---------+     ------------
Q5SIH3 -----------------------------------------------------------------     30S ribosomal protein Thx OS=Thermus thermophilus (strain  ...
1vvl:U*-----------------------------------------------------------------×107 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1fjf:V*-----------------------------------------------------------------×107 Structure of the thermus thermophilus 30s ribosomal subunit
3uxs:U*-----------------------------------------------------------------×14  The structure of thermorubin in complex with the 70s  ...
4hvm:A rgppetsrlrvpgsrwqaltepngslamaaltawwlwtqdslylstevdlrdhlqlgsvvgpltd     Crystal structure of tallysomycin biosynthesis protein tlmii
  " :B rgppetsrlrvpgsrwqaltepggplggngslamaaltawwlwtqdslylstevdlrdhlqlgsv     Crystal structure of tallysomycin biosynthesis protein tlmii
2ghj:A gieldrkiladmavrdpqafeqvvnkvkealqvq-------------------------------     Crystal structure of folded and partially unfolded forms of  ...
3qyb:A pthpyfsvqlgpgqlslfnllkayslldkevgycqgisfvagvlllhmseeqafemlkflmydlg     X-ray crystal structure of human tbc1d4 (as160) rabgap domai

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345     Protein name
       ---------+---------+---------+---------+---------+---------+-----     ------------
Q5SIH3 -----------------------------------------------------------------     30S ribosomal protein Thx OS=Thermus thermophilus (strain  ...
1vvl:U*-----------------------------------------------------------------×107 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1fjf:V*-----------------------------------------------------------------×107 Structure of the thermus thermophilus 30s ribosomal subunit
3uxs:U*-----------------------------------------------------------------×14  The structure of thermorubin in complex with the 70s  ...
4hvm:A rvvfgvdltglrepsfrdlmsrtqagfldavvhylpyhdvvdlavdlgvvtpprvaarwdvavhl     Crystal structure of tallysomycin biosynthesis protein tlmii
  " :B vgpltdrvvfgvdltglrepsfrdlmsrtqagfldavvhylpyhdvvdlavdlgvvtpprvaarw     Crystal structure of tallysomycin biosynthesis protein tlmii
2ghj:A -----------------------------------------------------------------     Crystal structure of folded and partially unfolded forms of  ...
3qyb:A frkqyrpdmmslqiqmyqlsrllhdyhrdlynhleeneispslyaapwfltlfasqfslgfvarv     X-ray crystal structure of human tbc1d4 (as160) rabgap domai

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890     Protein name
       ----+---------+---------+---------+---------+---------+---------+     ------------
Q5SIH3 -----------------------------------------------------------------     30S ribosomal protein Thx OS=Thermus thermophilus (strain  ...
1vvl:U*-----------------------------------------------------------------×107 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1fjf:V*-----------------------------------------------------------------×107 Structure of the thermus thermophilus 30s ribosomal subunit
3uxs:U*-----------------------------------------------------------------×14  The structure of thermorubin in complex with the 70s  ...
4hvm:A vsielfreadligdtwdgtdtwdgtttdlsvgelgedmvivldqrrsalldgldaamaqavadps     Crystal structure of tallysomycin biosynthesis protein tlmii
  " :B dvavhlcrnapsssltsielfreadliggdtrsatdtwdgtdtwdgtttdlsvgelgedmvivld     Crystal structure of tallysomycin biosynthesis protein tlmii
2ghj:A -----------------------------------------------------------------     Crystal structure of folded and partially unfolded forms of  ...
3qyb:A fdiiflqgtevifkvalsllssqetlimecesfeniveflkntlpdmntsemekiitqvfemdi-     X-ray crystal structure of human tbc1d4 (as160) rabgap domai

                4         4      
                0         1      
       12345678901234567890123456                                            Protein name
       ---------+---------+------                                            ------------
Q5SIH3 --------------------------                                            30S ribosomal protein Thx OS=Thermus thermophilus (strain  ...
1vvl:U*--------------------------                                       ×107 Crystal structure of frameshift suppressor tRNA sufa6 bound  ...
1fjf:V*--------------------------                                       ×107 Structure of the thermus thermophilus 30s ribosomal subunit
3uxs:U*--------------------------                                       ×14  The structure of thermorubin in complex with the 70s  ...
4hvm:A aplph---------------------                                            Crystal structure of tallysomycin biosynthesis protein tlmii
  " :B qrrsalldgldaamaqavadpsaplp                                            Crystal structure of tallysomycin biosynthesis protein tlmii
2ghj:A --------------------------                                            Crystal structure of folded and partially unfolded forms of  ...
3qyb:A --------------------------                                            X-ray crystal structure of human tbc1d4 (as160) rabgap domai

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q5SIH3. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 27 - - Q5SIH3 30S ribosomal protein Thx OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsU PE=1 SV=3
2. 183 100.0% 25 25 327.7 2.8e-11 1vvl:U * Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u on the ribosome
3. " " " " " "  = 1vvn:U *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u on the ribosome
4. " " " " " "  = 1vvp:U *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-a on the ribosome
5. " " " " " "  = 1vvr:U *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-a on the ribosome
6. " " " " " "  = 1vvt:U *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccg-g on the ribosome
7. " " " " " "  = 1vvv:U *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccg-g on the ribosome
8. " " " " " "  = 1vvx:U *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u in the absence of paromomycin
9. " " " " " "  = 1vvz:U *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u in the absence of paromomycin
10. " " " " " "  = 1vx8:U *
Crystal structure of tRNA proline (cgg) bound to codon ccc-u ribosome
11. " " " " " "  = 1vxi:U *
Crystal structure of tRNA proline (cgg) bound to codon ccc-u ribosome
12. " " " " " "  = 1vxk:U *
Crystal structure of tRNA proline (cgg) bound to codon ccg-g ribosome
13. " " " " " "  = 1vxm:U *
Crystal structure of tRNA proline (cgg) bound to codon ccg-g ribosome
14. " " " " " "  = 1vxp:U *
Crystal structure of tRNA proline (cgg) bound to codon ccc-g ribosome
15. " " " " " "  = 1vxs:U *
Crystal structure of tRNA proline (cgg) bound to codon ccc-g ribosome
16. " " " " " "  = 1vy0:U *
Crystal structure of unmodified tRNA proline (cgg) bound to on the ribosome
17. " " " " " "  = 1vy2:U *
Crystal structure of unmodified tRNA proline (cgg) bound to on the ribosome
18. " " " " " "  = 2j00:U *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 1 of 4). This file contains the 30s subunit, mRNA, a-, p- and e-site trnas and paromomycin for molecule i.
19. " " " " " "  = 2j02:U *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 3 of 4) this file contains the 30s subunit, mRNA, a-, p- and e-site trnas and paromomycin for molecule ii.
20. " " " " " "  = 2jl5:U *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 1 of 4). This file contains the 30s subunit.
21. " " " " " "  = 2jl7:U *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 3 of 4). This file contains the 30s subunit.
22. " " " " " "  = 2uu9:U *
Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mRNA with a gug-codon in the a-site and paromomycin.
23. " " " " " "  = 2uua:U *
Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mRNA with a guc-codon in the a-site and paromomycin.
24. " " " " " "  = 2uub:U *
Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mRNA with a guu-codon in the a-site and paromomycin.
25. " " " " " "  = 2uuc:U *
Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mRNA with a gua-codon in the a-site and paromomycin.
26. " " " " " "  = 2uxb:U *
Crystal structure of an extended tRNA anticodon stem loop in complex with its cognate mRNA gggu in the context of the thermus thermophilus 30s subunit.
27. " " " " " "  = 2uxc:U *
Crystal structure of an extended tRNA anticodon stem loop in complex with its cognate mRNA ucgu in the context of the thermus thermophilus 30s subunit.
28. " " " " " "  = 2uxd:V *
Crystal structure of an extended tRNA anticodon stem loop in complex with its cognate mRNA cggg in the context of the thermus thermophilus 30s subunit.
29. " " " " " "  = 2v46:U *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 1 of 4). This file contains the 30s subunit, mRNA, p-site asl, e-site tRNA and rrf for molecule 1.
30. " " " " " "  = 2v48:U *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 3 of 4). This file contains the 30s subunit, mRNA, p-site asl, e-site tRNA and rrf for molecule 2.
31. " " " " " "  = 2vqe:U *
Modified uridines with c5-methylene substituents at the first position of the tRNA anticodon stabilize u-g wobble pairing during decoding
32. " " " " " "  = 2vqf:U *
Modified uridines with c5-methylene substituents at the first position of the tRNA anticodon stabilize u-g wobble pairing during decoding
33. " " " " " "  = 2wdg:U *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 30s subunit a-,p-, and e-site trnas and paromomycin for molecule i.
34. " " " " " "  = 2wdh:U *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 30s subunit a-,p-, and e-site trnas and paromomycin for molecule ii.
35. " " " " " "  = 2wdk:U *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 30s subunit a-,p-, and e-site trnas and paromomycin for molecule i.
36. " " " " " "  = 2wdm:U *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 30s subunit a-,p-, and e-site trnas and paromomycin for molecule ii.
37. " " " " " "  = 2wh1:U *
Insights into translational termination from the structure of rf2 bound to the ribosome
38. " " " " " "  = 2wh3:U *
Insights into translational termination from the structure of rf2 bound to the ribosome). This file contains the 30s subunit.
39. " " " " " "  = 2wri:U *
The structure of the ribosome with elongation factor g trapped in the post-translocational state (part 1 of 4).
40. " " " " " "  = 2wrk:U *
The structure of the ribosome with elongation factor g trapped in the post-translocational state (part 3 of 4).
41. " " " " " "  = 2wrn:U *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 1 of 4).
42. " " " " " "  = 2wrq:U *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 3 of 4).
43. " " " " " "  = 2x9r:U *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
44. " " " " " "  = 2x9t:U *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
45. " " " " " "  = 2xfz:U *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 1 of 4)
46. " " " " " "  = 2xg1:U *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 3 of 4)
47. " " " " " "  = 3fic:U *
T. Thermophilus 70s ribosome in complex with mRNA, trnas and tu.Gdp.Kirromycin ternary complex, fitted to a 6.4 a cryo-e this file contains the 30s subunit and the ligands
48. " " " " " "  = 3huw:U *
Structure of ef-p bound to the 70s ribosome; this file conta 30s subunit, mRNA, p-site tRNA and ef-p for molecule i.
49. " " " " " "  = 3huy:U *
Structure of ef-p bound to the 70s ribosome; this file conta 30s subunit, mRNA, p-site tRNA and ef-p for molecule ii.
50. " " " " " "  = 3i8g:X *
Elongation complex of the 70s ribosome with three trnas and entry 3i8g contains 30s ribosomal subnit.The 50s ribosomal can be found in PDB entry 3i8f. Molecule b in the same asym unit is deposited as 3i8g (30s) and 3i8f (50s).
51. " " " " " "  = 3i8h:X *
Elongation complex of the 70s ribosome with three trnas and entry 3i8h contains 30s ribosomal subnit. The 50s ribosomal can be found in PDB entry 3i8i. Molecule a in the same asym unit is deposited as 3i8f (50s) and 3i8g (30s).
52. " " " " " "  = 3i9b:X *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9b contains 30s ribosomal subunit of molecule b. The 50s subunit can be found in PDB entry 3i9c. Molecule a in the s asymmetric unit is deposited as 3i9d (30s) and 3i9e (50s)
53. " " " " " "  = 3i9d:X *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9d contains 30s ribosomal subunit of molecule a. The 50s subunit can be found in PDB entry 3i9e. Molecule b in the s asymmetric unit is deposited as 3i9b (30s) and 3i9c (50s)
54. " " " " " "  = 3knh:U *
The structures of viomycin bound to the 70s ribosome. This f contains the 30s subunit for molecule i
55. " " " " " "  = 3knj:U *
The structures of viomycin bound to the 70s ribosome. This f contains the 30s subunit for molecule ii'
56. " " " " " "  = 3knl:U *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 30s subunit for molecule i
57. " " " " " "  = 3knn:U *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 30s subunit for molecule ii
58. " " " " " "  = 3oge:U *
Structure of the thermus thermophilus ribosome complexed wit chloramphenicol. This file contains the 30s subunit of one ribosome. The entire crystal structure contains two 70s rib
59. " " " " " "  = 3ogy:U *
Structure of the thermus thermophilus ribosome complexed wit chloramphenicol. This file contains the 30s subunit of one ribosome. The entire crystal structure contains two 70s rib
60. " " " " " "  = 3ohc:U *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 30s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
61. " " " " " "  = 3ohd:U *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 30s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
62. " " " " " "  = 3ohy:U *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 30s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
63. " " " " " "  = 3oi0:U *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 30s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
64. " " " " " "  = 3oi2:U *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 30s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
65. " " " " " "  = 3oi4:U *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 30s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
66. " " " " " "  = 3tvf:X *
Crystal structure analysis of ribosomal decoding. This entry the 30s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-leu complex
67. " " " " " "  = 3tvg:X *
Crystal structure analysis of ribosomal decoding. This entry the 30s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-leu complex
68. " " " " " "  = 3uyd:X *
Crystal structure analysis of ribosomal decoding. This entry the 30s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
69. " " " " " "  = 3uyf:X *
Crystal structure analysis of ribosomal decoding. This entry the 30s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
70. " " " " " "  = 3uz3:X *
Crystal structure analysis of ribosomal decoding. This entry the 30s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex with paromomycin
71. " " " " " "  = 3uz4:X *
Crystal structure analysis of ribosomal decoding. This entry the 30s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-leu complex with paromomycin.
72. " " " " " "  = 3uz6:X *
Structure analysis of ribosomal decoding. This entry contain ribosomal subunit of the first 70s molecule in the asymmetr for the cognate tRNA-tyr complex
73. " " " " " "  = 3uz7:X *
Crystal structure analysis of ribosomal decoding. This entry the 30s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-tyr complex.
74. " " " " " "  = 3uzg:X *
Crystal structure analysis of ribosomal decoding. This entry the 30s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex
75. " " " " " "  = 3uzi:X *
Crystal structure analysis of ribosomal decoding. This entry the 30s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex
76. " " " " " "  = 3uzl:X *
Crystal structure analysis of ribosomal decoding. This entry the 30s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex with paromomycin
77. " " " " " "  = 3uzm:X *
Crystal structure analysis of ribosomal decoding. This entry the 30s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex with paromomycin
78. " " " " " "  = 3v6u:U *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 30s ribosomal subunit of the first 70s m the asymmetric unit
79. " " " " " "  = 3v6v:U *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 30s ribosomal subunit of the second 70s in the asymmetric unit
80. " " " " " "  = 3zn7:U *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
81. " " " " " "  = 3znd:U *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
82. " " " " " "  = 3zvo:U *
Crystal structure of the hybrid state of ribosome in complex the guanosine triphosphatase release factor 3
83. " " " " " "  = 4abr:U *
Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin with the 70s ribosome
84. " " " " " "  = 4b3m:V *
Crystal structure of the 30s ribosome in complex with compou
85. " " " " " "  = 4b3r:V *
Crystal structure of the 30s ribosome in complex with compou
86. " " " " " "  = 4b3s:V *
Crystal structure of the 30s ribosome in complex with compou
87. " " " " " "  = 4b3t:V *
Crystal structure of the 30s ribosome in complex with compou
88. " " " " " "  = 4b8f:U *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex
89. " " " " " "  = 4b8h:U *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex
90. " " " " " "  = 4btc:U *
Thermus thermophilus ribosome
91. " " " " " "  = 4byb:U *
Structure of thermus thermophilus 30s ribosome
92. " " " " " "  = 4byd:U *
Structure of thermus thermophilus 30s ribosome
93. " " " " " "  = 4cr1:U *
Thermus thermophilus ribosome
94. " " " " " "  = 4dh9:U *
Crystal structure of yaej bound to the 70s ribosome
95. " " " " " "  = 4dr2:U *
Crystal structure of the thermus thermophilus (hb8) 30s ribo subunit with multiple copies of paromomycin molecules bound
96. " " " " " "  = 4dr4:U *
Crystal structure of the thermus thermophilus (hb8) 30s ribo subunit with codon, cognate transfer RNA anticodon stem-loo multiple copies of paromomycin molecules bound
97. " " " " " "  = 4dr5:U *
Crystal structure of the thermus thermophilus (hb8) 30s ribo subunit with codon, crystallographically disordered cognate RNA anticodon stem-loop and streptomycin bound
98. " " " " " "  = 4dr6:U *
Crystal structure of the thermus thermophilus (hb8) 30s ribo subunit with codon, near-cognate transfer RNA anticodon ste mismatched at the first codon position and streptomycin bou
99. " " " " " "  = 4dr7:U *
Crystal structure of the thermus thermophilus (hb8) 30s ribo subunit with codon, crystallographically disordered near-co transfer RNA anticodon stem-loop mismatched at the second c position, and streptomycin bound
100. " " " " " "  = 4ej9:U *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 30s ribosomal subunit of the first 70s m the asymmetric unit
101. " " " " " "  = 4eja:U *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 30s ribosomal subunit of the second 70s in the asymmetric unit
102. " " " " " "  = 4g5k:X *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 30s subunit of molecule a.
103. " " " " " "  = 4g5m:X *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 30s subunit of molecule b.
104. " " " " " "  = 4g5t:X *
Crystal structure of the 70s ribosome with tigecycline. This contains the 30s subunit of molecule a.
105. " " " " " "  = 4g5v:X *
Crystal structure of the 70s ribosome with tigecycline. This contains the 30s subunit of molecule b.
106. " " " " " "  = 4k0k:U *
Crystal structure of the thermus thermophilus 30s ribosomal complexed with a serine-asl and mRNA containing a stop codo
107. " " " " " "  = 4kwz:U *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-g on the ribosome
108. " " " " " "  = 4kx1:U *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-g on the ribosome
109. 177 100.0% 24 24 317.7 1e-10 1fjf:V * Structure of the thermus thermophilus 30s ribosomal subunit
110. " " " " " "  = 1fjg:V *
Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
111. " " " " " "  = 1gix:X *
Crystal structure of the ribosome at 5.5 a resolution. This 1gix, contains the 30s ribosome subunit, three tRNA, and mr molecules. 50s ribosome subunit is in the file 1giy
112. " " " " " "  = 1hnw:V *
Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
113. " " " " " "  = 1hnx:V *
Structure of the thermus thermophilus 30s ribosomal subunit with pactamycin
114. " " " " " "  = 1hnz:V *
Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
115. " " " " " "  = 1hr0:V *
Crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
116. " " " " " "  = 1i94:U *
Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
117. " " " " " "  = 1i95:U *
Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with edeine
118. " " " " " "  = 1i96:U *
Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)
119. " " " " " "  = 1i97:U *
Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline
120. " " " " " "  = 1ibk:V *
Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
121. " " " " " "  = 1ibl:V *
Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger RNA fragment and cognate transfer RNA anticodon stem-loop bound at the a site and with the antibiotic paromomycin
122. " " " " " "  = 1ibm:V *
Structure of the thermus thermophilus 30s ribosomal subunit in complex with a messenger RNA fragment and cognate transfer RNA anticodon stem-loop bound at the a site
123. " " " " " "  = 1j5e:V *
Structure of the thermus thermophilus 30s ribosomal subunit
124. " " " " " "  = 1jgo:X *
The path of messenger RNA through the ribosome. This file, 1 contains the 30s ribosome subunit, three tRNA, and mRNA mol 50s ribosome subunit is in the file 1giy
125. " " " " " "  = 1jgp:X *
The path of messenger RNA through the ribosome. This file, 1 contains the 30s ribosome subunit, three tRNA, and mRNA mol 50s ribosome subunit is in the file 1giy
126. " " " " " "  = 1jgq:X *
The path of messenger RNA through the ribosome. This file, 1 contains the 30s ribosome subunit, three tRNA, and mRNA mol 50s ribosome subunit is in the file 1giy
127. " " " " " "  = 1l1u:V *
Ternary complex docked in the decoding site of the 30s ribosomal subunit
128. " " " " " "  = 1ml5:X *
Structure of the e. Coli ribosomal termination complex with factor 2
129. " " " " " "  = 1n32:V *
Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer RNA anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
130. " " " " " "  = 1n33:V *
Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position at the a site with paromomycin
131. " " " " " "  = 1n34:V *
Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer RNA anticodon stem-loop mismatched at the first codon position
132. " " " " " "  = 1n36:V *
Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer RNA anticodon stem-loop mismatched at the second codon position
133. " " " " " "  = 1twt:X *
Model structure of the t. Thermophilus 70s ribosome, 30s subunit of 70s robosome. This file, 1twt, contains only molecules of the 30s ribosomal subunit. The 50s subunit is in the PDB file 1twv.
134. " " " " " "  = 1xmo:V *
Crystal structure of mnm5u34t6a37-trnalysuuu complexed with in the decoding center
135. " " " " " "  = 1xmq:V *
Crystal structure of t6a37-asllysuuu aaa-mRNA bound to the d center
136. " " " " " "  = 1xnq:V *
Structure of an inosine-adenine wobble base pair complex in the context of the decoding center
137. " " " " " "  = 1xnr:V *
Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
138. " " " " " "  = 1yl4:X *
Crystal structure of 70s ribosome with thrs operator and trn subunit. The coordinates for the 50s subunit are in the PDB 1yl3
139. " " " " " "  = 2b64:U *
30s ribosomal subunit, trnas, mRNA and release factor rf1 fr crystal structure of the whole ribosomal complex. This file the 30s subunit, trnas, mRNA and release factor rf1 from a structure of the whole ribosomal complex". The entire cryst structure contains one 70s ribosome, trnas, mRNA and releas rf1 and is described in remark 400.
140. " " " " " "  = 2b9m:U *
30s ribosomal subunit, trnas, mRNA and release factor rf2 fr crystal structure of the whole ribosomal complex. This file the 30s ribosomal subunit, trnas, mRNA and release factor r crystal structure of the whole ribosomal complex". The enti structure contains one 70s ribosome, trnas, mRNA and releas rf2 and is described in remark 400.
141. " " " " " "  = 2b9o:U *
30s ribosomal subunit, trnas and mRNA from a crystal structu whole ribosomal complex with a stop codon in the a-site. Th contains the 30s subunit, trnas and mRNA from a crystal str the whole ribosomal complex with a stop codon in the a-site described in remark 400.
142. " " " " " "  = 2e5l:V *
A snapshot of the 30s ribosomal subunit capturing mRNA via the shine- dalgarno interaction
143. " " " " " "  = 2hgi:X *
Crystal structure of the 70s thermus thermophilus ribosome s the 16s 3'-end mimicks mRNA e and p codons. This entry 2hgi 30s ribosomal subunit. The 50s ribosomal subunit can be fou entry 2hgj.
144. " " " " " "  = 2hgp:X *
Crystal structure of the 70s thermus thermophilus ribosome w translocated and rotated shine-dalgarno duplex. This entry contains 30s ribosomal subunit. The 50s ribosomal subunit c found in PDB entry 2hgq.
145. " " " " " "  = 2hgr:X *
70s t.Th. Ribosome functional complex with mRNA and e- and p trnas at 4.5a. This entry 2hgr contains 30s ribosomal subun 50s ribosomal subunit can be found in PDB entry 2hgu.
146. " " " " " "  = 2hhh:U *
Crystal structure of kasugamycin bound to the 30s ribosomal
147. " " " " " "  = 2i1c:v *
Crystal structure of a 70s ribosome-tRNA complex reveals functional interactions and rearrangements. This file, 2i1c, contains the 30s ribosome subunit, two tRNA, and mRNA molecules. 50s ribosome subunit is in the file 1vs9
148. " " " " " "  = 2ow8:v *
Crystal structure of a 70s ribosome-tRNA complex reveals fun interactions and rearrangements. This file, 2ow8, contains ribosome subunit, two tRNA, and mRNA molecules. 50s ribosom is in the file 1vsa.
149. " " " " " "  = 2qnh:v *
Interactions and dynamics of the shine-dalgarno helix in the ribosome. This file, 2qnh, contains the 30s ribosome subuni tRNA, and mRNA molecules. 50s ribosome subunit is in the fi
150. " " " " " "  = 2xqd:U *
The structure of ef-tu and aminoacyl-tRNA bound to the 70s ribosome with a gtp analog
151. " " " " " "  = 2xsy:U *
tRNA tranlocation on the 70s ribosome: the pre- translocational translocation intermediate ti(pre)
152. " " " " " "  = 2xuy:U *
tRNA translocation on the 70s ribosome: the post- translocational translocation intermediate ti(post)
153. " " " " " "  = 2y0u:U *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
154. " " " " " "  = 2y0w:U *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
155. " " " " " "  = 2y0y:U *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
156. " " " " " "  = 2y10:U *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
157. " " " " " "  = 2y12:U *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
158. " " " " " "  = 2y14:U *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a cognate codon on the 70s ribosome.
159. " " " " " "  = 2y16:U *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a cognate codon on the 70s ribosome.
160. " " " " " "  = 2y18:U *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
161. " " " " " "  = 2zm6:V *
Crystal structure of the thermus thermophilus 30s ribosomal subunit
162. " " " " " "  = 3d5a:U *
Structural basis for translation termination on the 70s ribo file contains the 30s subunit, release factor 1 (rf1), two mRNA molecules of one 70s ribosome. The entire crystal stru contains two 70s ribosomes as described in remark 400.
163. " " " " " "  = 3d5c:U *
Structural basis for translation termination on the 70s ribo file contains the 30s subunit, release factor 1 (rf1), two mRNA molecules of the second 70s ribosome. The entire cryst structure contains two 70s ribosomes as described in remark
164. " " " " " "  = 3f1e:U *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 30s subunit, rf2 tRNA, and mRNA molecules of one 70s ribosome. The entire cr structure contains two 70s ribosomes as described in remark
165. " " " " " "  = 3f1g:U *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 30s subunit, rf2 tRNA, and mRNA molecules of the second 70s ribosome. The en crystal structure contains two 70s ribosomes as described i 400.
166. " " " " " "  = 3kiq:u *
Structure of rele nuclease bound to the 70s ribosome (precle state; part 1 of 4)
167. " " " " " "  = 3kis:u *
Structure of rele nuclease bound to the 70s ribosome (precle state; part 3 of 4)
168. " " " " " "  = 3kiu:u *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 1 of 4)
169. " " " " " "  = 3kix:u *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 3 of 4)
170. " " " " " "  = 3mr8:U *
Recognition of the amber stop codon by release factor rf1. T 3mr8 contains 30s ribosomal subunit. The 50s ribosomal subu found in PDB entry 3ms1. Molecule b in the same asymmetric deposited as 3mrz (50s) and 3ms0 (30s).
171. " " " " " "  = 3ms0:U *
Recognition of the amber stop codon by release factor rf1. T 3ms0 contains 30s ribosomal subunit. The 50s ribosomal subu found in PDB entry 3mrz. Molecule a in the same asymmetric deposited as 3mr8 (30s) and 3ms1 (50s).
172. " " " " " "  = 3oto:U *
Crystal structure of the 30s ribosomal subunit from a ksga m thermus thermophilus (hb8)
173. " " " " " "  = 3pyn:U *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the first 70s ribosome.
174. " " " " " "  = 3pyq:U *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the second 70s ribosome.
175. " " " " " "  = 3pys:U *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 30s s the first 70s ribosome.
176. " " " " " "  = 3pyu:U *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 30s s the second 70s ribosome.
177. " " " " " "  = 3t1h:V *
Structure of the thermus thermophilus 30s ribosomal subunit with a human anti-codon stem loop (hasl) of transfer RNA ly (trnalys3) bound to an mRNA with an aaa-codon in the a-site paromomycin
178. " " " " " "  = 3t1y:V *
Structure of the thermus thermophilus 30s ribosomal subunit with a human anti-codon stem loop (hasl) of transfer RNA ly (trnalys3) bound to an mRNA with an aag-codon in the a-site paromomycin
179. " " " " " "  = 4aqy:V *
Structure of ribosome-apramycin complexes
180. " " " " " "  = 4dr1:U *
Crystal structure of the apo 30s ribosomal subunit from ther thermophilus (hb8)
181. " " " " " "  = 4dr3:U *
Crystal structure of the thermus thermophilus (hb8) 30s ribo subunit with streptomycin bound
182. " " " " " "  = 4duy:U *
Crystal structure of the thermus thermophilus 30s ribosomal with a 16s rrna mutation, u13c
183. " " " " " "  = 4duz:U *
Crystal structure of the thermus thermophilus 30s ribosomal with a 16s rrna mutation, u13c, bound with streptomycin
184. " " " " " "  = 4dv0:U *
Crystal structure of the thermus thermophilus 30s ribosomal with a 16s rrna mutation, u20g
185. " " " " " "  = 4dv1:U *
Crystal structure of the thermus thermophilus 30s ribosomal with a 16s rrna mutation, u20g, bound with streptomycin
186. " " " " " "  = 4dv2:U *
Crystal structure of the thermus thermophilus 30s ribosomal with a 16s rrna mutation, c912a
187. " " " " " "  = 4dv3:U *
Crystal structure of the thermus thermophilus 30s ribosomal with a 16s rrna mutation, c912a, bound with streptomycin
188. " " " " " "  = 4dv4:U *
Crystal structure of the thermus thermophilus 30s ribosomal with a 16s rrna mutation, a914g
189. " " " " " "  = 4dv5:U *
Crystal structure of the thermus thermophilus 30s ribosomal with a 16s rrna mutation, a914g, bound with streptomycin
190. " " " " " "  = 4dv6:U *
Crystal structure of the thermus thermophilus 30s ribosomal with a 16s rrna mutation, a915g
191. " " " " " "  = 4dv7:U *
Crystal structure of the thermus thermophilus 30s ribosomal with a 16s rrna mutation, a915g, bound with streptomycin
192. " " " " " "  = 4gkj:V *
Structure of the thermus thermophilus 30s ribosomal subunit with a human mitochondrial anticodon stem loop (asl) of tra methionine (trnamet) bound to an mRNA with an aug-codon in and paromomycin.
193. " " " " " "  = 4gkk:V *
Structure of the thermus thermophilus 30s ribosomal subunit with a human mitochondrial anticodon stem loop (asl) of tra methionine (trnamet) bound to an mRNA with an aua-codon in and paromomycin
194. " " " " " "  = 4ji0:U *
Crystal structure of 30s ribosomal subunit from thermus ther
195. " " " " " "  = 4ji1:U *
Crystal structure of 30s ribosomal subunit from thermus ther
196. " " " " " "  = 4ji2:U *
Crystal structure of 30s ribosomal subunit from thermus ther
197. " " " " " "  = 4ji3:U *
Crystal structure of 30s ribosomal subunit from thermus ther
198. " " " " " "  = 4ji4:U *
Crystal structure of 30s ribosomal subunit from thermus ther
199. " " " " " "  = 4ji5:U *
Crystal structure of 30s ribosomal subunit from thermus ther
200. " " " " " "  = 4ji6:U *
Crystal structure of 30s ribosomal subunit from thermus ther
201. " " " " " "  = 4ji7:U *
Crystal structure of 30s ribosomal subunit from thermus ther
202. " " " " " "  = 4ji8:U *
Crystal structure of 30s ribosomal subunit from thermus ther
203. " " " " " "  = 4juw:U *
Crystal structure of the ribosome bound to elongation factor guanosine triphosphatase state (this file contains the 30s
204. " " " " " "  = 4jv5:U *
Crystal structures of pseudouridinilated stop codons with as
205. " " " " " "  = 4jya:U *
Crystal structures of pseudouridinilated stop codons with as
206. " " " " " "  = 4k0l:U *
Crystal structure of thermus thermophilus 70s in complex wit and mRNA containing a pseudouridine in a stop codon
207. " " " " " "  = 4k0p:U *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
208. " " " " " "  = 4kfh:U *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 30s of the a subunit
209. " " " " " "  = 4kfk:U *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 30s of the b subunit
210. " " " " " "  = 4khp:U *
Structure of the thermus thermophilus 30s ribosomal subunit with de-6-msa-pactamycin
211. " " " " " "  = 4l6k:U *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 30s subunit, tRNA and mRNA from the first 70s ribosome.
212. " " " " " "  = 4l6m:U *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 30s subunit, tRNA and mRNA from the second 70s ribosome.
213. " " " " " "  = 4nxm:U *
Crystal structure of the 30s ribosomal subunit from a gidb ( mutant of thermus thermophilus (hb8)
214. " " " " " "  = 4nxn:U *
Crystal structure of the 30s ribosomal subunit from a gidb ( mutant of thermus thermophilus (hb8), bound with streptomyc
215. " " " " " "  = 4ox9:V *
Crystal structure of the aminoglycoside resistance methyltra npma bound to the 30s ribosomal subunit
216. 171 100.0% 23 23 307.8 3.6e-10 3uxs:U * The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 30s subunit of ribosome. The entire crystal structure contains two 70s rib
217. " " " " " "  = 3uxt:U *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 30s subunit of ribosome. The entire crystal structure contains two 70s rib
218. " " " " " "  = 3v22:U *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 30s subunit with bound rmf of ribosome in the asu
219. " " " " " "  = 3v24:U *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 30s subunit with bound rmf of ribosome in the asu
220. " " " " " "  = 3v26:U *
Crystal structure of hpf bound to the 70s ribosome. This PDB contains coordinates for the 30s subunit with bound hpf of ribosome in the asu
221. " " " " " "  = 3v28:U *
Crystal structure of hpf bound to the 70s ribosome. This PDB contains coordinates for the 30s subunit with bound hpf of ribosome in the asu
222. " " " " " "  = 3v2c:U *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 30s subunit with bound yfia of ribosome in the asu
223. " " " " " "  = 3v2e:U *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 30s subunit with bound yfia of ribosome in the asu
224. " " " " " "  = 4dhb:U *
Crystal structure of yaej bound to the 70s ribosome
225. " " " " " "  = 4nvu:U *
Crystal structure of antibiotic dityromycin bound to 70s rib
226. " " " " " "  = 4nvw:U *
Crystal structure of antibiotic dityromycin bound to 70s rib
227. " " " " " "  = 4nvy:U *
Crystal structure of antibiotic ge82832 bound to 70s ribosom
228. " " " " " "  = 4nw0:U *
Crystal structure of antibiotic ge82832 bound to 70s ribosom
229. " " " " " "  = 4qco:U *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing acylated substrates in the a and p sites. This entry contains the 30 of the second 70s ribosome in the asu.
230. 71 34.6% 26 393 119.6 11 4hvm:A Crystal structure of tallysomycin biosynthesis protein tlmii
231. 71 34.6% 26 414 119.3 11 4hvm:B Crystal structure of tallysomycin biosynthesis protein tlmii
232. 60 42.3% 26 101 109.6 40 2ghj:A Crystal structure of folded and partially unfolded forms of aquifex aeolicus ribosomal protein l20
233. 64 34.6% 26 297 109.5 40 3qyb:A X-ray crystal structure of human tbc1d4 (as160) rabgap domai

Number of sequences: 233

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer