spacer
spacer

SAS results for UniProt accession no. Q8VVE2

Sequence annotated by structure

Key:
Sec. struc: By homology Predicted
  Helix Strand   Helix Strand
Residue contacts:   to ligand   to DNA/RNA
Active sites:   (from PDB SITE records)

Predicted secondary structure (green) comes from the DSC program. The lighter the green the less certain the prediction. Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. Q8VVE2 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q8VVE2 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 20 unique sequences (including 6 consensus sequences) giving 36 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q8VVE2 -----------------------------------------------------------------   50S ribosomal protein L7/L12 OS=Thermus thermophilus  ...
1dd3:A*-----------------------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
4kbu:e*-----------------------------------------------------------------×8 70s ribosome translocation intermediate gdpnp-ii containing  ...
2gya:3*-----------------------------------------------------------------×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*-----------------------------------------------------------------×2 Nmr structure of l7 dimer from e.Coli
2zjq:5 -----------------------------------------------------------------   Interaction of l7 with l11 induced by microccocin binding  ...
1rqs:A -----------------------------------------------------------------   Nmr structure of c-terminal domain of ribosomal protein l7  ...
1ctf:A*-----------------------------------------------------------------×3 Structure of thE C-terminal domain of the ribosomal protein  ...
2xtg:L*-----------------------------------------------------------------×2 tRNA tranlocation on the 70s ribosome: the        pre-  ...
3i8i:I -----------------------------------------------------------------   Elongation complex of the 70s ribosome with three trnas and  ...
2ftc:E -----------------------------------------------------------------   Structural model for the large subunit of the mammalian  ...
1dd4:D -----------------------------------------------------------------   Crystal structure of ribosomal protein l12 from thermotoga  ...
  " :C -----------------------------------------------------------------   Crystal structure of ribosomal protein l12 from thermotoga  ...
2zkr:g -----------------------------------------------------------------   Structure of a mammalian ribosomal 60s subunit within an  ...
2max:A -----------------------------------------------------------------   Nmr structure of the RNA polymerase alpha subunit  ...
1rqt:A -----------------------------------------------------------------   Nmr structure of dimeric n-terminal domain of ribosomal  ...
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
  " :B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3k3p:A -----------ketlvllyggrsaerdvsvlsaesvmrainydnflvktyfitqagdfiktqefd   Crystal structure of the apo form of d-alanine:d-alanine  ...
3jyw:M vvidgkghlvgrlasvvakqllngqkivvvraeelnisgeffrnklkyhdflrkatafnktrgpf   Structure of the 60s proteins for eukaryotic ribosome based  ...
2y44:A ---------------------------------------kveevqtmcdvarqlraletasqsav   Crystal structure of garp from trypanosoma congolense

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q8VVE2 --------------------------------------------------maldierikeelsqa   50S ribosomal protein L7/L12 OS=Thermus thermophilus  ...
1dd3:A*----------------------------------------------------MTIDEIIEAIEKL×5 Crystal structure of ribosomal protein l12 from thermotoga m
4kbu:e*-----------------------------------------------------------------×8 70s ribosome translocation intermediate gdpnp-ii containing  ...
2gya:3*----------------------------------------------------itkdqiieavaam×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*---------------------------------------------------sitkdqiieavaam×2 Nmr structure of l7 dimer from e.Coli
2zjq:5 -----------------------------------------------------------------   Interaction of l7 with l11 induced by microccocin binding  ...
1rqs:A -----------------------------------------------------------------   Nmr structure of c-terminal domain of ribosomal protein l7  ...
1ctf:A*-----------------------------------------------------------------×3 Structure of thE C-terminal domain of the ribosomal protein  ...
2xtg:L*-----------------------------------------------------------------×2 tRNA tranlocation on the 70s ribosome: the        pre-  ...
3i8i:I --------------------------------------------------maldierikeelsqa   Elongation complex of the 70s ribosome with three trnas and  ...
2ftc:E ----------------------------------------------------pkiqqlvqdiasl   Structural model for the large subunit of the mammalian  ...
1dd4:D ----------------------------------------------------mtideiieaiekl   Crystal structure of ribosomal protein l12 from thermotoga  ...
  " :C ----------------------------------------------------mtideiieaiekl   Crystal structure of ribosomal protein l12 from thermotoga  ...
2zkr:g -----------------------------------------------------------------   Structure of a mammalian ribosomal 60s subunit within an  ...
2max:A -----------------------------------------------------------------   Nmr structure of the RNA polymerase alpha subunit  ...
1rqt:A ---------------------------------------------------sitkdqiieavaam   Nmr structure of dimeric n-terminal domain of ribosomal  ...
4beh:A ---------------masvselaciysalilhddevtvtedkinalikaagvnvepfwpglfaka   Solution structure of human ribosomal protein p1.P2 heterodi
  " :B ------------------amryvasyllaalggnsspsakdikkildsvgieadddrlnkvise-   Solution structure of human ribosomal protein p1.P2 heterodi
3k3p:A sqpsdklmtndtiiasqkikpsdiyeeeavvfpvlhgpmgedgsiqgflevlkmpyvgtnilsss   Crystal structure of the apo form of d-alanine:d-alanine  ...
3jyw:M hfrapsrifykalrgmvshktargkaalerlkvfegipppydkkkrvvvpqalrvlrlkpgrkyt   Structure of the 60s proteins for eukaryotic ribosome based  ...
2y44:A aavvssareaseakeraekaverakskkrgvdtateaaaraaaaaqraetvvsdarkhaadltaa   Crystal structure of garp from trypanosoma congolense

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q8VVE2 tvlelkqlidalkeaw-----gvtaaap----vava--aap-----aagaaaapa-e------ek   50S ribosomal protein L7/L12 OS=Thermus thermophilus  ...
1dd3:A*TVSELAELVKKLEDKF-----GVTAAAP----VAVA--AAP-----VAGAAAGAAQE------EK×5 Crystal structure of ribosomal protein l12 from thermotoga m
4kbu:e*-----xxxxxxxxxxx-----xxxxxxx----xxxx--xxx-----xxxxxaapa-e------ek×8 70s ribosome translocation intermediate gdpnp-ii containing  ...
2gya:3*svmdvvelisameekf-----gvsaaaa----vava--agp-----veaa------e------ek×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*svmdvvelisameekf-----gvsaaaa----vava--agp-----veaa------e------ek×2 Nmr structure of l7 dimer from e.Coli
2zjq:5 --------------------------------------------------------e------ek   Interaction of l7 with l11 induced by microccocin binding  ...
1rqs:A -----------------------------------------------------aa-e------ek   Nmr structure of c-terminal domain of ribosomal protein l7  ...
1ctf:A*-----------------------------------------------------------------×3 Structure of thE C-terminal domain of the ribosomal protein  ...
2xtg:L*-----------------------------------------------------------------×2 tRNA tranlocation on the 70s ribosome: the        pre-  ...
3i8i:I tvlelkqlidalkea--------------------------------------------------   Elongation complex of the 70s ribosome with three trnas and  ...
2ftc:E tlleisdlnellkktlkiqdvglmpmgg----mvpg--aap-----aptapeaae-edvpkqker   Structural model for the large subunit of the mammalian  ...
1dd4:D tvselaelvkkledkf-----gvtaaap----vava-----------------------------   Crystal structure of ribosomal protein l12 from thermotoga  ...
  " :C tvselaelvkkledkf-----gvtaaa--------------------------------------   Crystal structure of ribosomal protein l12 from thermotoga  ...
2zkr:g ---laekvkafladps-----afvaaap----vaaattaap-----aaaaapakv-e------ak   Structure of a mammalian ribosomal 60s subunit within an  ...
2max:A lgvfgerpianteysg-----dyaqrdd----akdl--sak-----iesmnlsar-c------fn   Nmr structure of the RNA polymerase alpha subunit  ...
1rqt:A svmdvvelisameekf-----gvsaaaa-------------------------------------   Nmr structure of dimeric n-terminal domain of ribosomal  ...
4beh:A lanvnigslicnvgag-----gpapaag----aapa--ggp-----apstaaapa-e------ek   Solution structure of human ribosomal protein p1.P2 heterodi
  " :B --lngkniedviaqgi-----gklasvpaggavavs--aapgsaapaagsapaaa-e------ek   Solution structure of human ribosomal protein p1.P2 heterodi
3k3p:A vamdkittnqvlesat-----tipqvay----vali--ege-----plesklaev-e------ek   Crystal structure of the apo form of d-alanine:d-alanine  ...
3jyw:M tlgklstsv-----gw-----kaaaaaa----aaaa--aaa-----aaaaaaaaa-a------aa   Structure of the 60s proteins for eukaryotic ribosome based  ...
2y44:A skdaiettdeslrlla-----txeadep----irta--akk-----ctgaaaevt-s------ks   Crystal structure of garp from trypanosoma congolense

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q8VVE2 te--fdvilkeag-akklevikelra-itglglk-eakdlaek----g-g-p---vkegvskqea   50S ribosomal protein L7/L12 OS=Thermus thermophilus  ...
1dd3:A*TE--FDVVLKSFG-QNKIQVIKVVRE-ITGLGLK-EAKDLVEK----A-GSPDAVIKSGVSKEEA×5 Crystal structure of ribosomal protein l12 from thermotoga m
4kbu:e*te--fdvilkeag-akklevikelra-itglglk-eakdl-------------------------×8 70s ribosome translocation intermediate gdpnp-ii containing  ...
2gya:3*te--fdvilkaag-ankvavikavrg-atglglk-eakdlves----apa-a---lkegvskdda×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*te--fdvilkaag-ankvavikavrg-atglglk-eakdlves----apa-a---lkegvskdda×2 Nmr structure of l7 dimer from e.Coli
2zjq:5 te--fdvvlidag-askinvikeirg-itglglk-eakdmsek----g-g-v---lkegvakdea   Interaction of l7 with l11 induced by microccocin binding  ...
1rqs:A te--fdvilkaag-ankvavikavrg-atglglk-eakdlves----apa-a---lkegvskdda   Nmr structure of c-terminal domain of ribosomal protein l7  ...
1ctf:A*-E--FDVILKAAG-ANKVAVIKAVRG-ATGLGLK-EAKDLVES----APA-A---LKEGVSKDDA×3 Structure of thE C-terminal domain of the ribosomal protein  ...
2xtg:L*----fdvilkaag-ankvavikavrg-atglglk-eakdlves----apa-a---lkegvskdda×2 tRNA tranlocation on the 70s ribosome: the        pre-  ...
3i8i:I -----------------------------------------------------------------   Elongation complex of the 70s ribosome with three trnas and  ...
2ftc:E th--ftvrlteakpvdkvklikeiknyvqginlv-qakklvesl---p-q-e---ikanvakaea   Structural model for the large subunit of the mammalian  ...
1dd4:D -----------------------------------------------------------------   Crystal structure of ribosomal protein l12 from thermotoga  ...
  " :C -----------------------------------------------------------------   Crystal structure of ribosomal protein l12 from thermotoga  ...
2zkr:g ee--seesd--------------------------------------------------------   Structure of a mammalian ribosomal 60s subunit within an  ...
2max:A cl--dkigikyvg-elvlmseeelkg-vknmgkk-sydeiaeklndlg-y-p---vgtelspeqr   Nmr structure of the RNA polymerase alpha subunit  ...
1rqt:A -----------------------------------------------------------------   Nmr structure of dimeric n-terminal domain of ribosomal  ...
4beh:A kv--eakkeesee-sdddmgfglfd----------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
  " :B kd--ekkeesees-dddmgfglfd-----------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3k3p:A li--ypvfvkpan-iskaenrtdlkq-aialalkydsrvlieq----g-v-d---areievgilg   Crystal structure of the apo form of d-alanine:d-alanine  ...
3jyw:M aa--aaaaaaaaa----------------------------------------------------   Structure of the 60s proteins for eukaryotic ribosome based  ...
2y44:A lesafda-laell-pdgaddirehga-vfvkglk-sleddvrt----a-g-e---akyeaeka--   Crystal structure of garp from trypanosoma congolense

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q8VVE2 eeikkkleavgavvelk------------------------------------------------   50S ribosomal protein L7/L12 OS=Thermus thermophilus  ...
1dd3:A*EEIKKKLEEAGAEVELK------------------------------------------------×5 Crystal structure of ribosomal protein l12 from thermotoga m
4kbu:e*-----------------------------------------------------------------×8 70s ribosome translocation intermediate gdpnp-ii containing  ...
2gya:3*ealkkaleeagaevevk------------------------------------------------×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*ealkkaleeagaevevk------------------------------------------------×2 Nmr structure of l7 dimer from e.Coli
2zjq:5 ekmkaqleaagarvelk------------------------------------------------   Interaction of l7 with l11 induced by microccocin binding  ...
1rqs:A ealkkaleeagaevevk------------------------------------------------   Nmr structure of c-terminal domain of ribosomal protein l7  ...
1ctf:A*EALKKALEEAGAEVEVK------------------------------------------------×3 Structure of thE C-terminal domain of the ribosomal protein  ...
2xtg:L*ealkkaleeagaevevk------------------------------------------------×2 tRNA tranlocation on the 70s ribosome: the        pre-  ...
3i8i:I -----------------------------------------------------------------   Elongation complex of the 70s ribosome with three trnas and  ...
2ftc:E ekikaaleavggtvvle------------------------------------------------   Structural model for the large subunit of the mammalian  ...
1dd4:D -----------------------------------------------------------------   Crystal structure of ribosomal protein l12 from thermotoga  ...
  " :C -----------------------------------------------------------------   Crystal structure of ribosomal protein l12 from thermotoga  ...
2zkr:g -----------------------------------------------------------------   Structure of a mammalian ribosomal 60s subunit within an  ...
2max:A eslkkrlekledkggnd------------------------------------------------   Nmr structure of the RNA polymerase alpha subunit  ...
1rqt:A -----------------------------------------------------------------   Nmr structure of dimeric n-terminal domain of ribosomal  ...
4beh:A -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
  " :B -----------------------------------------------------------------   Solution structure of human ribosomal protein p1.P2 heterodi
3k3p:A ntdvkttlpgeivtmaipaeidpvivekmrdyaatafrtlgccglsrcdffltedgkvylnelnt   Crystal structure of the apo form of d-alanine:d-alanine  ...
3jyw:M -----------------------------------------------------------------   Structure of the 60s proteins for eukaryotic ribosome based  ...
2y44:A -----------------------------------------------------------------   Crystal structure of garp from trypanosoma congolense

           3         3         3         3    
           3         4         5         6    
       678901234567890123456789012345678901234                             Protein name
       ----+---------+---------+---------+----                             ------------
Q8VVE2 ---------------------------------------                             50S ribosomal protein L7/L12 OS=Thermus thermophilus  ...
1dd3:A*---------------------------------------                          ×5 Crystal structure of ribosomal protein l12 from thermotoga m
4kbu:e*---------------------------------------                          ×8 70s ribosome translocation intermediate gdpnp-ii containing  ...
2gya:3*---------------------------------------                          ×2 Structure of the 50s subunit of a pre-translocational e.  ...
1rqu:A*---------------------------------------                          ×2 Nmr structure of l7 dimer from e.Coli
2zjq:5 ---------------------------------------                             Interaction of l7 with l11 induced by microccocin binding  ...
1rqs:A ---------------------------------------                             Nmr structure of c-terminal domain of ribosomal protein l7  ...
1ctf:A*---------------------------------------                          ×3 Structure of thE C-terminal domain of the ribosomal protein  ...
2xtg:L*---------------------------------------                          ×2 tRNA tranlocation on the 70s ribosome: the        pre-  ...
3i8i:I ---------------------------------------                             Elongation complex of the 70s ribosome with three trnas and  ...
2ftc:E ---------------------------------------                             Structural model for the large subunit of the mammalian  ...
1dd4:D ---------------------------------------                             Crystal structure of ribosomal protein l12 from thermotoga  ...
  " :C ---------------------------------------                             Crystal structure of ribosomal protein l12 from thermotoga  ...
2zkr:g ---------------------------------------                             Structure of a mammalian ribosomal 60s subunit within an  ...
2max:A ---------------------------------------                             Nmr structure of the RNA polymerase alpha subunit  ...
1rqt:A ---------------------------------------                             Nmr structure of dimeric n-terminal domain of ribosomal  ...
4beh:A ---------------------------------------                             Solution structure of human ribosomal protein p1.P2 heterodi
  " :B ---------------------------------------                             Solution structure of human ribosomal protein p1.P2 heterodi
3k3p:A mpgftsmypllwenmglsysvlieelvslakemfdkres                             Crystal structure of the apo form of d-alanine:d-alanine  ...
3jyw:M ---------------------------------------                             Structure of the 60s proteins for eukaryotic ribosome based  ...
2y44:A ---------------------------------------                             Crystal structure of garp from trypanosoma congolense

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q8VVE2. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 125 - - Q8VVE2 50S ribosomal protein L7/L12 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rplL PE=1 SV=4
2. 449 64.1% 128 128 553.7 7.1e-24 1dd3:A * Crystal structure of ribosomal protein l12 from thermotoga m
3. " " " " " "  = 1dd4:A *
Crystal structure of ribosomal protein l12 from thermotoga maritim
4. " " " " " "  = 1giy:I *
Crystal structure of the ribosome at 5.5 a resolution. This file, 1giy, contains the 50s ribosome subunit. The 30s ribosome subunit, three tRNA, and mRNA molecules are in the file 1gix
5. " " " " " "  = 1l1u:3 *
Ternary complex docked in the decoding site of the 30s ribosomal subunit
6. " " " " " "  = 1yl3:I *
Crystal structure of 70s ribosome with thrs operator and trn subunit. The coordinates for the small subunit are in the p 1yl4.
7. 430 100.0% 72 72 532.3 1.1e-22 4kbu:e * 70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit a. The full asymmetric unit contains PDB entries 4kbt (30s subunit a), 4kbv (30s subuni 4kbw (50s subunit b).
8. " " " " " "  = 4kbw:e *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit b. The full asymmetric unit contains PDB entries 4kbv (30s subunit b), 4kbt (30s subuni 4kbu (50s subunit a).
9. " " " " " "  = 4kcz:e *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state.T contains the 50s ribosomal subunit a. The 30s subunit a can in 4kcy. Molecule b in the same asymmetric unit is deposite (30s) and 4kd2 (50s).G1 50s ribosomal subunit i
10. " " " " " "  = 4kd2:e *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains the 50s ribosomal subunit b. The 30s subunit b can in 4kd0. Molecule a in the same asymmetric unit is deposite (30s) and 4kcz (50s).
11. " " " " " "  = 4kd9:e *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kd8. Molecule b in the same asymmetric uni deposited as 4kda (30s) and 4kdb (50s).
12. " " " " " "  = 4kdb:e *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kda. Molecule a in the same asymmetric uni deposited as 4kd8 (30s) and 4kd9 (50s).
13. " " " " " "  = 4kdh:e *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kdg. Molecule b in the same asymmetric uni deposited as 4kdj (30s) and 4kdk (50s).
14. " " " " " "  = 4kdk:e *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kdj. Molecule a in the same asymmetric uni deposited as 4kdg (30s) and 4kdh (50s).
15. 366 55.4% 121 119 454.1 2.5e-18 2gya:3 * Structure of the 50s subunit of a pre-translocational e. Coli ribosome obtained by fitting atomic models for RNA and protein components into cryo-em map emd-1056
16. " " " " " "  = 2gyc:3 *
Structure of the 50s subunit of a secm-stalled e. Coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-em map emd-1143
17. 366 55.4% 121 120 454.0 2.5e-18 1rqu:A * Nmr structure of l7 dimer from e.Coli
18. " " " " " "  = 1rqv:A *
Spatial model of l7 dimer from e.Coli with one hinge region in helical state
19. 319 71.8% 71 71 400.8 2.4e-15 2zjq:5 Interaction of l7 with l11 induced by microccocin binding to deinococcus radiodurans 50s subunit
20. 276 67.1% 73 74 348.7 1.9e-12 1rqs:A Nmr structure of c-terminal domain of ribosomal protein l7 from e.Coli
21. 248 64.7% 68 68 315.4 1.3e-10 1ctf:A * Structure of thE C-terminal domain of the ribosomal protein l7/l12 from escherichia coli at 1.7 angstroms
22. " " " " " "  = 2bcw:B *
Coordinates of the n-terminal domain of ribosomal protein l11,c-terminal domain of ribosomal protein l7/l12 and a portion of the g' domain of elongation factor g, as fitted into cryo-em map of an escherichia coli 70s Ef- g Gdp Fusidic acid complex
23. " " " " " "  = 3j5w:L *
Structure of the ribosome with elongation factor g trapped i translocation state (pre-translocation 70s tRNA Ef-g struct subunit)
24. 242 64.2% 67 67 308.3 3.3e-10 2xtg:L * tRNA tranlocation on the 70s ribosome: the pre- translocational translocation intermediate ti(pre)
25. " " " " " "  = 2xux:L *
tRNA translocation on the 70s ribosome: the post- translocational translocation intermediate ti(post)
26. 172 100.0% 30 30 229.1 8.6e-06 3i8i:I Elongation complex of the 70s ribosome with three trnas and entry 3i8i contains 50s ribosomal subnit. The 30s ribosomal can be found in PDB entry 3i8h. Molecule a in the same asym unit is deposited as 3i8f (50s) and 3i8g (30s).
27. 182 34.8% 135 137 215.7 4.8e-05 2ftc:E Structural model for the large subunit of the mammalian mito ribosome
28. 114 50.0% 40 40 157.3 0.086 1dd4:D Crystal structure of ribosomal protein l12 from thermotoga maritim
29. 84 42.9% 35 35 122.0 7.9 1dd4:C Crystal structure of ribosomal protein l12 from thermotoga maritim
30. 85 66.7% 27 48 121.2 8.8 2zkr:g Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
31. 89 33.3% 57 114 120.4 9.7 2max:A Nmr structure of the RNA polymerase alpha subunit c-terminal from helicobacter pylori
32. 77 37.5% 32 37 113.2 24 1rqt:A Nmr structure of dimeric n-terminal domain of ribosomal protein l7 from e.Coli
33. 83 57.1% 28 114 113.2 25 4beh:A Solution structure of human ribosomal protein p1.P2 heterodi
34. 88 36.9% 65 116 113.1 25 4beh:B Solution structure of human ribosomal protein p1.P2 heterodi
35. 88 26.4% 91 317 112.6 26 3k3p:A Crystal structure of the apo form of d-alanine:d-alanine lig from streptococcus mutans
36. 84 39.6% 53 178 111.5 30 3jyw:M Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
37. 84 26.4% 106 183 111.3 31 2y44:A Crystal structure of garp from trypanosoma congolense

Number of sequences: 37

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer