spacer
spacer

SAS results for UniProt accession no. P12733

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P12733 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P12733 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 42 unique sequences (including 14 consensus sequences) giving 198 sequence matches in all. The 95 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P12733 -----------------------------------------------------------------    50S ribosomal protein L18e OS=Haloarcula marismortui  ...
1ffk:L*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:P*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1k5y:O*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:O -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3o58:R*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3izc:R*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:Q*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
4gdc:A ---------hpdisvdvlvigagptglgaakrlnqidgpswmivdsnetpgglastdvtpegfly    Crystal strucure of oxidized aspergillus fumigatus  ...
4gdd:A ---------hpdisvdvlvigagptglgaakrlnqidgpswmivdsnetpgglastdvtpegfly    Crystal strucure of oxidized aspergillus fumigatus  ...
3uka:A ---thpdisvdvlvigagptglgaakrlnqidgpswmivdsnetpgglastdvtpegflydvggh    Crystal structure of udp-galactopyranose mutase from  ...
3ukh:A -------thpdisvdvlvigagptglgaakrlnqidgpswmivdsnetpgglastdvtpegflyd    Crystal structure of udp-galactopyranose mutase from  ...
3ute:A*-hpdisvdvlvigagptglgaakrlnqidgpswmivdsnetpgglastdvtpegflydvgghvif×4  Crystal structure of aspergillus fumigatus udp  ...
4gde:A -hpdisvdvlvigagptglgaakrlnqidgpswmivdsnetpgglastdvtpegflydvgghvif    Crystal strucure of NADPH-reduced aspergillus fumigatus  ...
3ukf:A thpdisvdvlvigagptglgaakrlnqidgpswmivdsnetpgglastdvtpegflydvgghvif    Crystal structure of udp-galactopyranose mutase from  ...
3ukl:A thpdisvdvlvigagptglgaakrlnqidgpswmivdsnetpgglastdvtpegflydvgghvif    Crystal structure of udp-galactopyranose mutase from  ...
3ukp:A thpdisvdvlvigagptglgaakrlnqidgpswmivdsnetpgglastdvtpegflydvgghvif    Crystal structure of r327a udp-galactopyranose mutase from  ...
3ukq:A thpdisvdvlvigagptglgaakrlnqidgpswmivdsnetpgglastdvtpegflydvgghvif    Crystal structure of r327k udp-galactopyranose mutase from  ...
3ukk:A thpdisvdvlvigagptglgaakrlnqidgpswmivdsnetpgglastdvtpegflydvgghvif    Crystal structure of r182k-udp-galactopuranose mutase from  ...
1giy:O*-----------------------------------------------------------------×6  Crystal structure of the ribosome at 5.5 a resolution. This  ...
1zu4:A -----------------------------------pmekamlksafnfskdikklskkykqadde    Crystal structure of ftsy from mycoplasma mycoides- space  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P12733 -----------------------------------------------------------------    50S ribosomal protein L18e OS=Haloarcula marismortui  ...
1ffk:L*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:P*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1k5y:O*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:O -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3o58:R*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3izc:R*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:Q*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
4gdc:A dvgghvifshykyfddcldealpkeddwythqrisyvrcqgqwvpypfqnnismlpkeeqvkcid    Crystal strucure of oxidized aspergillus fumigatus  ...
4gdd:A dvgghvifshykyfddcldealpkeddwythqrisyvrcqgqwvpypfqnnismlpkeeqvkcid    Crystal strucure of oxidized aspergillus fumigatus  ...
3uka:A vifshykyfddcldealpkeddwythqrisyvrcqgqwvpypfqnnismlpkeeqvkcidgmida    Crystal structure of udp-galactopyranose mutase from  ...
3ukh:A vgghvifshykyfddcldealpkeddwythqrisyvrcqgqwvpypfqnnismlpkeeqvkcidg    Crystal structure of udp-galactopyranose mutase from  ...
3ute:A*shykyfddcldealpkeddwythqrisyvrcqgqwvpypfqnnismlpkeeqvkcidgmidaale×4  Crystal structure of aspergillus fumigatus udp  ...
4gde:A shykyfddcldealpkeddwythqrisyvrcqgqwvpypfqnnismlpkeeqvkcidgmidaale    Crystal strucure of NADPH-reduced aspergillus fumigatus  ...
3ukf:A shykyfddcldealpkeddwythqrisyvrcqgqwvpypfqnnismlpkeeqvkcidgmidaale    Crystal structure of udp-galactopyranose mutase from  ...
3ukl:A shykyfddcldealpkeddwythqrisyvrcqgqwvpypfqnnismlpkeeqvkcidgmidaale    Crystal structure of udp-galactopyranose mutase from  ...
3ukp:A shykyfddcldealpkeddwythqrisyvrcqgqwvpypfqnnismlpkeeqvkcidgmidaale    Crystal structure of r327a udp-galactopyranose mutase from  ...
3ukq:A shykyfddcldealpkeddwythqrisyvrcqgqwvpypfqnnismlpkeeqvkcidgmidaale    Crystal structure of r327k udp-galactopyranose mutase from  ...
3ukk:A shykyfddcldealpkeddwythqrisyvrcqgqwvpypfqnnismlpkeeqvkcidgmidaale    Crystal structure of r182k-udp-galactopuranose mutase from  ...
1giy:O*-----------------------------------------------------------------×6  Crystal structure of the ribosome at 5.5 a resolution. This  ...
1zu4:A ffeeledvliqtdmgmkmvlkvsnlvrkktkrdtsfenikdalveslyqaytdndwyridfkenr    Crystal structure of ftsy from mycoplasma mycoides- space  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P12733 ----------------------------------------------------------------m    50S ribosomal protein L18e OS=Haloarcula marismortui  ...
1ffk:L*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:P*-------------------------------------------------------------mkrt×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1k5y:O*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:O -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3o58:R*--------------------------------------------------------------tap×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3izc:R*----------------------------------------------mgidhtskqhkrsghrtap×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:Q*-----------------------------------------------gidhtskqhkrsghrtap×5  The structure of the eukaryotic ribosome at 3.0 a  ...
4gdc:A gmidaalearvantkpktfdewivrmmgtgiadlfmrpynfkvwavpttkmqcawlgervaapnl    Crystal strucure of oxidized aspergillus fumigatus  ...
4gdd:A gmidaalearvantkpktfdewivrmmgtgiadlfmrpynfkvwavpttkmqcawlgervaapnl    Crystal strucure of oxidized aspergillus fumigatus  ...
3uka:A alearvantkpktfdewivrmmgtgiadlfmrpynfkvwavpttkmqcawlgervaapnlkavtt    Crystal structure of udp-galactopyranose mutase from  ...
3ukh:A midaalearvantkpktfdewivrmmgtgiadlfmrpynfkvwavpttkmqcawlgervaapnlk    Crystal structure of udp-galactopyranose mutase from  ...
3ute:A*arvantkpktfdewivrmmgtgiadlfmrpynfkvwavpttkmqcawlgervaapnlkavttnvi×4  Crystal structure of aspergillus fumigatus udp  ...
4gde:A arvantkpktfdewivrmmgtgiadlfmrpynfkvwavpttkmqcawlgervaapnlkavttnvi    Crystal strucure of NADPH-reduced aspergillus fumigatus  ...
3ukf:A arvantkpktfdewivrmmgtgiadlfmrpynfkvwavpttkmqcawlgervaapnlkavttnvi    Crystal structure of udp-galactopyranose mutase from  ...
3ukl:A arvantkpktfdewivrmmgtgiadlfmrpynfkvwavpttkmqcawlgervaapnlkavttnvi    Crystal structure of udp-galactopyranose mutase from  ...
3ukp:A arvantkpktfdewivrmmgtgiadlfmrpynfkvwavpttkmqcawlgervaapnlkavttnvi    Crystal structure of r327a udp-galactopyranose mutase from  ...
3ukq:A arvantkpktfdewivrmmgtgiadlfmrpynfkvwavpttkmqcawlgervaapnlkavttnvi    Crystal structure of r327k udp-galactopyranose mutase from  ...
3ukk:A arvantkpktfdewivrmmgtgiadlfmrpynfkvwavpttkmqcawlgekvaapnlkavttnvi    Crystal structure of r182k-udp-galactopuranose mutase from  ...
1giy:O*-----------------------------------------------------------------×6  Crystal structure of the ribosome at 5.5 a resolution. This  ...
1zu4:A lnifmlvgvngtgkttslakmanyyaelgykvliaaadtfragatqqleewiktrlnnkvdlvka    Crystal structure of ftsy from mycoplasma mycoides- space  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P12733 sktnprlssliad-lksaarssggavwgdvaerlekprrthaevn-----lgrier-yaqe---d    50S ribosomal protein L18e OS=Haloarcula marismortui  ...
1ffk:L*sktnprlssliad-lksaarssggavwgdvaerlekprrthaevn-----lgrier-yaqe---d×68 Crystal structure of the large ribosomal subunit from  ...
3j21:P*gptdpnlrrliry-lrkksneygvkiwkdvawrlerprrqraevn-----vskinr-yand---g×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1k5y:O*--dnvylkllvkl-ytflarrtdapfnkvvlkalflskinrppvs-----vsriaralkqegaan×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:O -sdnvylkllvkl-ytflarrtdapfnkvvlkalflskinrppvs-----vsriaralkqegaan    Structure of the 60s proteins for eukaryotic ribosome based  ...
3o58:R*ksdnvylkllvkl-ytflarrtdapfnkvvlkalflskinrppvs-----vsriaralkqegaan×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3izc:R*ksdnvylkllvkl-ytflarrtdapfnkvvlkalflskinrppvs-----vsriaralkqegaan×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:Q*ksdnvylkllvkl-ytflarrtdapfnkvvlkalflskinrppvs-----vsriaralkqegaan×5  The structure of the eukaryotic ribosome at 3.0 a  ...
4gdc:A kavttnvilgkat-frfparggtggiwiavantlpkektrfgek-------gkvtk-vnan---n    Crystal strucure of oxidized aspergillus fumigatus  ...
4gdd:A kavttnvilgkat-frfparggtggiwiavantlpkektrfgek-------gkvtk-vnan---n    Crystal strucure of oxidized aspergillus fumigatus  ...
3uka:A nvilgktagpnat-frfparggtggiwiavantlpkektrfgek-------gkvtk-vnan---n    Crystal structure of udp-galactopyranose mutase from  ...
3ukh:A avttnvilgktat-frfparggtggiwiavantlpkektrfgek-------gkvtk-vnan---n    Crystal structure of udp-galactopyranose mutase from  ...
3ute:A*lgktagnwgpnat-frfparggtggiwiavantlpkektrfgek-------gkvtk-vnan---n×4  Crystal structure of aspergillus fumigatus udp  ...
4gde:A lgktagnwgpnat-frfparggtggiwiavantlpkektrfgek-------gkvtk-vnan---n    Crystal strucure of NADPH-reduced aspergillus fumigatus  ...
3ukf:A lgktagnwgpnat-frfparggtggiwiavantlpkektrfgek-------gkvtk-vnan---n    Crystal structure of udp-galactopyranose mutase from  ...
3ukl:A lgktagnwgpnat-frfparggtggiwiavantlpkektrfgek-------gkvtk-vnan---n    Crystal structure of udp-galactopyranose mutase from  ...
3ukp:A lgktagnwgpnat-frfparggtggiwiavantlpkektrfgek-------gkvtk-vnan---n    Crystal structure of r327a udp-galactopyranose mutase from  ...
3ukq:A lgktagnwgpnat-frfparggtggiwiavantlpkektrfgek-------gkvtk-vnan---n    Crystal structure of r327k udp-galactopyranose mutase from  ...
3ukk:A lgktagnwgpnat-frfparggtggiwiavantlpkektrfgek-------gkvtk-vnan---n    Crystal structure of r182k-udp-galactopuranose mutase from  ...
1giy:O*------------------fkrpqkvqeeaatidvreidenvtlla-----addvae-dvrd---v×6  Crystal structure of the ribosome at 5.5 a resolution. This  ...
1zu4:A nklnadpasvvfdaikkakeqnydlllidtagrlqnktnlmaelekmnkiiqqvek-saph---e    Crystal structure of ftsy from mycoplasma mycoides- space  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P12733 etvvvp-gkvlgsgvlqk--dvtvaavdfsgtaetkidqvg-eavsleqaiennpegshvrvir-    50S ribosomal protein L18e OS=Haloarcula marismortui  ...
1ffk:L*etvvvp-gkvlgsgvlqk--dvtvaavdfsgtaetkidqvg-eavsleqaiennpegshvrvir-×68 Crystal structure of the large ribosomal subunit from  ...
3j21:P*emivvp-gsvlgagklek--kvivaawkfsetarrkiieaggeaitieeliernptgsgvrime-×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1k5y:O*ktvvvv-gtvtddarifefpkttvaalrftagarakivkaggecitldqlavrapkgqntlilr-×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:O ktvvvv-gtvtddarifefpkttvaalrftagarakivkaggecitldqlavrapkgqntlilr-    Structure of the 60s proteins for eukaryotic ribosome based  ...
3o58:R*ktvvvv-gtvtddarifefpkttvaalrftagarakivkaggecitldqlavrapkgqntlilrg×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3izc:R*ktvvvv-gtvtddarifefpkttvaalrftagarakivkaggecitldqlavrapkgqntlilrg×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:Q*ktvvvv-gtvtddarifefpkttvaalrftagarakivkaggecitldqlavrapkgqntlilrg×5  The structure of the eukaryotic ribosome at 3.0 a  ...
4gdc:A ktvtlqdgttig---ykk--lvstmavdflaeamndqelvg-ltkqlfyssthvigvgvrgsrpe    Crystal strucure of oxidized aspergillus fumigatus  ...
4gdd:A ktvtlqdgttig---ykk--lvstmavdflaeamndqelvg-ltkqlfyssthvigvgvrgsrpe    Crystal strucure of oxidized aspergillus fumigatus  ...
3uka:A ktvtlqdgttig---ykk--lvstmavdflaeamndqelvg-ltkqlfyssthvigvgvrgsrpe    Crystal structure of udp-galactopyranose mutase from  ...
3ukh:A ktvtlqdgttig---ykk--lvstmavdflaeamndqelvg-ltkqlfyssthvigvgvrgsrpe    Crystal structure of udp-galactopyranose mutase from  ...
3ute:A*ktvtlqdgttig---ykk--lvstmavdflaeamndqelvg-ltkqlfyssthvigvgvrgsrpe×4  Crystal structure of aspergillus fumigatus udp  ...
4gde:A ktvtlqdgttig---ykk--lvstmavdflaeamndqelvg-ltkqlfyssthvigvgvrgsrpe    Crystal strucure of NADPH-reduced aspergillus fumigatus  ...
3ukf:A ktvtlqdgttig---ykk--lvstmavdflaeamndqelvg-ltkqlfyssthvigvgvrgsrpe    Crystal structure of udp-galactopyranose mutase from  ...
3ukl:A ktvtlqdgttig---ykk--lvstmavdflaeamndqelvg-ltkqlfyssthvigvgvrgsrpe    Crystal structure of udp-galactopyranose mutase from  ...
3ukp:A ktvtlqdgttig---ykk--lvstmavdflaeamndqelvg-ltkqlfyssthvigvgvrgsrpe    Crystal structure of r327a udp-galactopyranose mutase from  ...
3ukq:A ktvtlqdgttig---ykk--lvstmavdflaeamndqelvg-ltkqlfyssthvigvgvrgsrpe    Crystal structure of r327k udp-galactopyranose mutase from  ...
3ukk:A ktvtlqdgttig---ykk--lvstmavdflaeamndqelvg-ltkqlfyssthvigvgvrgsrpe    Crystal structure of r182k-udp-galactopuranose mutase from  ...
1giy:O*addady-vkvlgagqvrh--eltliaddfsegarekvegag-gsveltdl---------------×6  Crystal structure of the ribosome at 5.5 a resolution. This  ...
1zu4:A vllvid-attgqngviqa--eefskvadvsgiiltkmdsts-kggiglaikellnipikmigvge    Crystal structure of ftsy from mycoplasma mycoides- space  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P12733 -----------------------------------------------------------------    50S ribosomal protein L18e OS=Haloarcula marismortui  ...
1ffk:L*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:P*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1k5y:O*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:O -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3o58:R*prnsreavrhfgmgphk------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3izc:R*prnsreavrhfgmgphkgk----------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:Q*prnsreavrhfgmgphkgkaprilstgrkferargrrrskgfkv---------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
4gdc:A rigdkcwlyfpedncpfyratifsnyspynqpeasaalptmqladgsrpqsteakegpywsimle    Crystal strucure of oxidized aspergillus fumigatus  ...
4gdd:A gdkcwlyfpedncpfyratifsnyspynqpeasaalptmqladgsrpqsteakegpywsimlevs    Crystal strucure of oxidized aspergillus fumigatus  ...
3uka:A rigdkcwlyfpedncpfyratifsnyspynqpeaskklptmqladgsrpqsteakegpywsimle    Crystal structure of udp-galactopyranose mutase from  ...
3ukh:A rigdkcwlyfpedncpfyratifsnyspynqpeaskklptmqladgsrpqsteakegpywsimle    Crystal structure of udp-galactopyranose mutase from  ...
3ute:A*rigdkcwlyfpedncpfyratifsnyspynqpeasaalptmqladgsrpqsteakegpywsimle×4  Crystal structure of aspergillus fumigatus udp  ...
4gde:A rigdkcwlyfpedncpfyratifsnyspynqpeasaalptmqladgsrpqsteakegpywsimle    Crystal strucure of NADPH-reduced aspergillus fumigatus  ...
3ukf:A rigdkcwlyfpedncpfyratifsnyspynqpeaskklptmqladgsrpqsteakegpywsimle    Crystal structure of udp-galactopyranose mutase from  ...
3ukl:A rigdkcwlyfpedncpfyratifsnyspynqpeaskklptmqladgsrpqsteakegpywsimle    Crystal structure of udp-galactopyranose mutase from  ...
3ukp:A rigdkcwlyfpedncpfyaatifsnyspynqpeaskklptmqladgsrpqsteakegpywsimle    Crystal structure of r327a udp-galactopyranose mutase from  ...
3ukq:A rigdkcwlyfpedncpfykatifsnyspynqpeaskklptmqladgsrpqsteakegpywsimle    Crystal structure of r327k udp-galactopyranose mutase from  ...
3ukk:A rigdkcwlyfpedncpfyratifsnyspynqpeaskklptmqladgsrpqsteakegpywsimle    Crystal structure of r182k-udp-galactopuranose mutase from  ...
1giy:O*-----------------------------------------------------------------×6  Crystal structure of the ribosome at 5.5 a resolution. This  ...
1zu4:A kvddllafdidqyivhlssgfmq------------------------------------------    Crystal structure of ftsy from mycoplasma mycoides- space  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P12733 -----------------------------------------------------------------    50S ribosomal protein L18e OS=Haloarcula marismortui  ...
1ffk:L*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:P*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1k5y:O*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:O -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3o58:R*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3izc:R*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:Q*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
4gdc:A vsessmkpvnqetiladciqglvntemlkptdeivstyhrrfdhgyptptleregtltqilpklq    Crystal strucure of oxidized aspergillus fumigatus  ...
4gdd:A essmkpvnqetiladciqglvntemlkptdeivstyhrrfdhgyptptleregtltqilpklqdk    Crystal strucure of oxidized aspergillus fumigatus  ...
3uka:A vsessmkpvnqetiladciqglvntemlkptdeivstyhrrfdhgyptptleregaltqilpklq    Crystal structure of udp-galactopyranose mutase from  ...
3ukh:A vsessmkpvnqetiladciqglvntemlkptdeivstyhrrfdhgyptptleregaltqilpklq    Crystal structure of udp-galactopyranose mutase from  ...
3ute:A*vsessmkpvnqetiladciqglvntemlkptdeivstyhrrfdhgyptptleregtltqilpklq×4  Crystal structure of aspergillus fumigatus udp  ...
4gde:A vsessmkpvnqetiladciqglvntemlkptdeivstyhrrfdhgyptptleregtltqilpklq    Crystal strucure of NADPH-reduced aspergillus fumigatus  ...
3ukf:A vsessmkpvnqetiladciqglvntemlkptdeivstyhrrfdhgyptptleregaltqilpklq    Crystal structure of udp-galactopyranose mutase from  ...
3ukl:A vsessmkpvnqetiladciqglvntemlkptdeivstyhrrfdhgyptptleregaltqilpklq    Crystal structure of udp-galactopyranose mutase from  ...
3ukp:A vsessmkpvnqetiladciqglvntemlkptdeivstyhrrfdhgyptptleregaltqilpklq    Crystal structure of r327a udp-galactopyranose mutase from  ...
3ukq:A vsessmkpvnqetiladciqglvntemlkptdeivstyhrrfdhgyptptleregaltqilpklq    Crystal structure of r327k udp-galactopyranose mutase from  ...
3ukk:A vsessmkpvnqetiladciqglvntemlkptdeivstyhrrfdhgyptptleregaltqilpklq    Crystal structure of r182k-udp-galactopuranose mutase from  ...
1giy:O*-----------------------------------------------------------------×6  Crystal structure of the ribosome at 5.5 a resolution. This  ...
1zu4:A -----------------------------------------------------------------    Crystal structure of ftsy from mycoplasma mycoides- space  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P12733 -----------------------------------------------------------------    50S ribosomal protein L18e OS=Haloarcula marismortui  ...
1ffk:L*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:P*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1k5y:O*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:O -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3o58:R*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3izc:R*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:Q*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
4gdc:A dkdiwsrgrfgswryevgnqdhsfmlgveavdnivngaveltlnypdfvngrqnterrlvdgaqv    Crystal strucure of oxidized aspergillus fumigatus  ...
4gdd:A diwsrgrfgswryevgnqdhsfmlgveavdnivngaveltlnypdfvngrqnterrlvdgaqvfa    Crystal strucure of oxidized aspergillus fumigatus  ...
3uka:A dkdiwsrgrfgswryevgnqdhsfmlgveavdnivngaveltlnypdfvngrqnterrlvdgaqv    Crystal structure of udp-galactopyranose mutase from  ...
3ukh:A dkdiwsrgrfgswryevgnqdhsfmlgveavdnivngaveltlnypdfvngrqnterrlvdgaqv    Crystal structure of udp-galactopyranose mutase from  ...
3ute:A*dkdiwsrgrfgswryevgnqdhsfmlgveavdnivngaveltlnypdfvngrqnterrlvdgaqv×4  Crystal structure of aspergillus fumigatus udp  ...
4gde:A dkdiwsrgrfgswryevgnqdhsfmlgveavdnivngaveltlnypdfvngrqnterrlvdgaqv    Crystal strucure of NADPH-reduced aspergillus fumigatus  ...
3ukf:A dkdiwsrgrfgswryevgnqdhsfmlgveavdnivngaveltlnypdfvngrqnterrlvdgaqv    Crystal structure of udp-galactopyranose mutase from  ...
3ukl:A dkdiwsrgrfgswryevgnqdhsfmlgveavdnivngaveltlnypdfvngrqnterrlvdgaqv    Crystal structure of udp-galactopyranose mutase from  ...
3ukp:A dkdiwsrgrfgswryevgnqdhsfmlgveavdnivngaveltlnypdfvngrqnterrlvdgaqv    Crystal structure of r327a udp-galactopyranose mutase from  ...
3ukq:A dkdiwsrgrfgswryevgnqdhsfmlgveavdnivngaveltlnypdfvngrqnterrlvdgaqv    Crystal structure of r327k udp-galactopyranose mutase from  ...
3ukk:A dkdiwsrgrfgswryevgnqdhsfmlgveavdnivngaveltlnypdfvngrqnterrlvdgaqv    Crystal structure of r182k-udp-galactopuranose mutase from  ...
1giy:O*-----------------------------------------------------------------×6  Crystal structure of the ribosome at 5.5 a resolution. This  ...
1zu4:A -----------------------------------------------------------------    Crystal structure of ftsy from mycoplasma mycoides- space  ...

                5     
                3     
       123456789012345                                                      Protein name
       ---------+-----                                                      ------------
P12733 ---------------                                                      50S ribosomal protein L18e OS=Haloarcula marismortui  ...
1ffk:L*---------------                                                  ×68 Crystal structure of the large ribosomal subunit from  ...
3j21:P*---------------                                                  ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1k5y:O*---------------                                                  ×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:O ---------------                                                      Structure of the 60s proteins for eukaryotic ribosome based  ...
3o58:R*---------------                                                  ×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3izc:R*---------------                                                  ×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:Q*---------------                                                  ×5  The structure of the eukaryotic ribosome at 3.0 a  ...
4gdc:A fa-------------                                                      Crystal strucure of oxidized aspergillus fumigatus  ...
4gdd:A k--------------                                                      Crystal strucure of oxidized aspergillus fumigatus  ...
3uka:A fakskaq--------                                                      Crystal structure of udp-galactopyranose mutase from  ...
3ukh:A fakskaqle------                                                      Crystal structure of udp-galactopyranose mutase from  ...
3ute:A*faks-----------                                                  ×4  Crystal structure of aspergillus fumigatus udp  ...
4gde:A fak------------                                                      Crystal strucure of NADPH-reduced aspergillus fumigatus  ...
3ukf:A fakskaq--------                                                      Crystal structure of udp-galactopyranose mutase from  ...
3ukl:A fakskaql-------                                                      Crystal structure of udp-galactopyranose mutase from  ...
3ukp:A fakskaq--------                                                      Crystal structure of r327a udp-galactopyranose mutase from  ...
3ukq:A fakskaql-------                                                      Crystal structure of r327k udp-galactopyranose mutase from  ...
3ukk:A fakskaqlehhhhhh                                                      Crystal structure of r182k-udp-galactopuranose mutase from  ...
1giy:O*---------------                                                  ×6  Crystal structure of the ribosome at 5.5 a resolution. This  ...
1zu4:A ---------------                                                      Crystal structure of ftsy from mycoplasma mycoides- space  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P12733. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 116 - - P12733 50S ribosomal protein L18e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl18e PE=1 SV=2
2. 720 100.0% 115 115 965.4 8.4e-47 1ffk:L * Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
3. " " " " " "  = 1jj2:N *
Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
4. " " " " " "  = 1k73:P *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
5. " " " " " "  = 1k8a:P *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
6. " " " " " "  = 1k9m:P *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
7. " " " " " "  = 1kc8:P *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
8. " " " " " "  = 1kd1:P *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
9. " " " " " "  = 1kqs:N *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
10. " " " " " "  = 1m1k:P *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
11. " " " " " "  = 1m90:P *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
12. " " " " " "  = 1n8r:P *
Structure of large ribosomal subunit in complex with virginiamycin m
13. " " " " " "  = 1nji:P *
Structure of chloramphenicol bound to the 50s ribosomal subunit
14. " " " " " "  = 1q7y:P *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
15. " " " " " "  = 1q81:P *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
16. " " " " " "  = 1q82:P *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
17. " " " " " "  = 1q86:P *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
18. " " " " " "  = 1qvf:N *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
19. " " " " " "  = 1qvg:N *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
20. " " " " " "  = 1s72:O *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
21. " " " " " "  = 1vq4:O *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
22. " " " " " "  = 1vq5:O *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
23. " " " " " "  = 1vq6:O *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
24. " " " " " "  = 1vq7:O *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
25. " " " " " "  = 1vq8:O *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
26. " " " " " "  = 1vq9:O *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
27. " " " " " "  = 1vqk:O *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
28. " " " " " "  = 1vql:O *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
29. " " " " " "  = 1vqm:O *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
30. " " " " " "  = 1vqn:O *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
31. " " " " " "  = 1vqo:O *
The structure of ccpmn bound to the large ribosomal subunit marismortui
32. " " " " " "  = 1vqp:O *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1w2b:N *
Trigger factor ribosome binding domain in complex with 50s
34. " " " " " "  = 1yhq:O *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
35. " " " " " "  = 1yi2:O *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
36. " " " " " "  = 1yij:O *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
37. " " " " " "  = 1yit:O *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
38. " " " " " "  = 1yj9:O *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
39. " " " " " "  = 1yjn:O *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
40. " " " " " "  = 1yjw:O *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
41. " " " " " "  = 2otj:O *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
42. " " " " " "  = 2otl:O *
Girodazole bound to the large subunit of haloarcula marismor
43. " " " " " "  = 2qa4:O *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
44. " " " " " "  = 2qex:O *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
45. " " " " " "  = 3cc2:O *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
46. " " " " " "  = 3cc4:O *
Co-crystal structure of anisomycin bound to the 50s ribosoma
47. " " " " " "  = 3cc7:O *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
48. " " " " " "  = 3cce:O *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
49. " " " " " "  = 3ccj:O *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
50. " " " " " "  = 3ccl:O *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
51. " " " " " "  = 3ccm:O *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
52. " " " " " "  = 3ccq:O *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
53. " " " " " "  = 3ccr:O *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
54. " " " " " "  = 3ccs:O *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
55. " " " " " "  = 3ccu:O *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
56. " " " " " "  = 3ccv:O *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
57. " " " " " "  = 3cd6:O *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
58. " " " " " "  = 3cma:O *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
59. " " " " " "  = 3cme:O *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
60. " " " " " "  = 3cpw:N *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
61. " " " " " "  = 3cxc:N *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
62. " " " " " "  = 3g4s:O *
Co-crystal structure of tiamulin bound to the large ribosoma
63. " " " " " "  = 3g6e:O *
Co-crystal structure of homoharringtonine bound to the large subunit
64. " " " " " "  = 3g71:O *
Co-crystal structure of bruceantin bound to the large riboso subunit
65. " " " " " "  = 3i55:O *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
66. " " " " " "  = 3i56:O *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
67. " " " " " "  = 3ow2:N *
Crystal structure of enhanced macrolide bound to 50s ribosom
68. " " " " " "  = 4adx:O *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
69. " " " " " "  = 4hub:O *
The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
70. 352 51.3% 113 120 477.0 1.4e-19 3j21:P * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
71. " " " " " "  = 3j44:P *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
72. 103 33.8% 80 120 146.7 0.34 1k5y:O * Structure of the translating 80s ribosome from yeast, obtained by docking atomic models for RNA and protein components into a 15a cryo-em map. This file 1k5y contains the 60s ribosomal subunit. The file 1k5x contains the 40s ribosomal subunit, the p-site bound tRNA and the mRNA codon.
73. " " " " " "  = 1s1i:O *
Structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 a cryo-em map. This file, 1s1i, contains 60s subunit. The 40s ribosomal subunit is in file 1s1h.
74. 103 33.8% 80 121 146.6 0.34 3jyw:O Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
75. 103 33.8% 80 143 145.5 0.39 3o58:R * Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
76. " " " " " "  = 3o5h:R *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
77. 103 33.8% 80 161 144.7 0.44 3izc:R * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
78. " " " " " "  = 3izs:R *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
79. 103 33.8% 80 185 143.8 0.49 3u5e:Q * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
80. " " " " " "  = 3u5i:Q *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
81. " " " " " "  = 4b6a:Q *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
82. " " " " " "  = 4byn:Q *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
83. " " " " " "  = 4byu:Q *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
84. 101 28.9% 83 495 134.5 1.6 4gdc:A Crystal strucure of oxidized aspergillus fumigatus udp-galac mutase complexed with NADPH
85. 101 28.9% 83 494 134.5 1.6 4gdd:A Crystal strucure of oxidized aspergillus fumigatus udp-galac mutase complexed with nadh
86. 101 28.9% 83 506 134.4 1.7 3uka:A Crystal structure of udp-galactopyranose mutase from aspergi fumigatus
87. 101 28.9% 83 504 134.4 1.6 3ukh:A Crystal structure of udp-galactopyranose mutase from aspergi fumigatus in complex with udpgalp (non-reduced)
88. 101 28.9% 83 505 134.4 1.6 3ute:A * Crystal structure of aspergillus fumigatus udp galactopyrano sulfate complex
89. " " " " " "  = 3utf:A *
Crystal structure of aspergillus fumigatus udp galactopyrano in reduced state
90. " " " " " "  = 3utg:A *
Crystal structure of aspergillus fumigatus udp galactopyrano complexed with udp in reduced state
91. " " " " " "  = 3uth:A *
Crystal structure of aspergillus fumigatus udp galactopyrano complexed with substrate udp-galp in reduced state
92. 101 28.9% 83 504 134.4 1.6 4gde:A Crystal strucure of NADPH-reduced aspergillus fumigatus udp- galactopyranose
93. 101 28.9% 83 509 134.3 1.7 3ukf:A Crystal structure of udp-galactopyranose mutase from aspergi fumigatus in complex with udpgalp (reduced)
94. 101 28.9% 83 510 134.3 1.7 3ukl:A Crystal structure of udp-galactopyranose mutase from aspergi fumigatus in complex with udp
95. 101 28.9% 83 509 134.3 1.7 3ukp:A Crystal structure of r327a udp-galactopyranose mutase from a fumigatus in complex with udpgalp
96. 101 28.9% 83 510 134.3 1.7 3ukq:A Crystal structure of r327k udp-galactopyranose mutase from a fumigatus in complex with udpgalp
97. 101 28.9% 83 517 134.2 1.7 3ukk:A Crystal structure of r182k-udp-galactopuranose mutase from a fumigatus in complex with udpgalp
98. 86 41.7% 36 84 126.5 4.5 1giy:O * Crystal structure of the ribosome at 5.5 a resolution. This file, 1giy, contains the 50s ribosome subunit. The 30s ribosome subunit, three tRNA, and mRNA molecules are in the file 1gix
99. " " " " " "  = 1ml5:o *
Structure of the e. Coli ribosomal termination complex with factor 2
100. " " " " " "  = 1yl3:O *
Crystal structure of 70s ribosome with thrs operator and trn subunit. The coordinates for the small subunit are in the p 1yl4.
101. " " " " " "  = 2b66:P *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400
102. " " " " " "  = 2b9n:P *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400.
103. " " " " " "  = 2b9p:P *
50s ribosomal subunit from a crystal structure of the riboso complex with trnas and mRNA with a stop codon in the a-site file contains the 50s subunit from a crystal structure of t ribosome in complex with trnas and mRNA with a stop codon i site and is described in remark 400.
104. 92 24.0% 100 305 125.8 4.9 1zu4:A Crystal structure of ftsy from mycoplasma mycoides- space group p21212

Number of sequences: 104

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 92 24.0% 100 309 125.7 5 1zu5:A Crystal structure of ftsy from mycoplasma mycoides- space group h32
2. 87 35.6% 59 149 124.0 6.2 4hub:L The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
3. 88 25.5% 94 187 123.8 6.4 3j39:Q Structure of the d. Melanogaster 60s ribosomal proteins
4. 83 44.7% 47 75 123.3 6.8 2egc:A Solution structure of the fifth sh3 domain from human kiaa0418 protein
5. 86 41.7% 36 140 123.1 7 4adx:L The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
6. 86 41.7% 36 143 123.0 7.1 1ffk:J Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
7. 86 41.7% 36 145 122.9 7.2 1jj2:K * Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
8. " " " " " "  = 1k73:M *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
9. " " " " " "  = 1k8a:M *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
10. " " " " " "  = 1k9m:M *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
11. " " " " " "  = 1kc8:M *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
12. " " " " " "  = 1kd1:M *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
13. " " " " " "  = 1kqs:K *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
14. " " " " " "  = 1m1k:M *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
15. " " " " " "  = 1m90:M *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
16. " " " " " "  = 1n8r:M *
Structure of large ribosomal subunit in complex with virginiamycin m
17. " " " " " "  = 1nji:M *
Structure of chloramphenicol bound to the 50s ribosomal subunit
18. " " " " " "  = 1q7y:M *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
19. " " " " " "  = 1q81:M *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
20. " " " " " "  = 1q82:M *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
21. " " " " " "  = 1q86:M *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
22. " " " " " "  = 1qvf:K *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
23. " " " " " "  = 1qvg:K *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
24. " " " " " "  = 1s72:L *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
25. " " " " " "  = 1vq4:L *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
26. " " " " " "  = 1vq5:L *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
27. " " " " " "  = 1vq6:L *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
28. " " " " " "  = 1vq7:L *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
29. " " " " " "  = 1vq8:L *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
30. " " " " " "  = 1vq9:L *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
31. " " " " " "  = 1vqk:L *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
32. " " " " " "  = 1vql:L *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1vqm:L *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
34. " " " " " "  = 1vqn:L *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
35. " " " " " "  = 1vqo:L *
The structure of ccpmn bound to the large ribosomal subunit marismortui
36. " " " " " "  = 1vqp:L *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
37. " " " " " "  = 1yhq:L *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
38. " " " " " "  = 1yi2:L *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
39. " " " " " "  = 1yij:L *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
40. " " " " " "  = 1yit:L *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
41. " " " " " "  = 1yj9:L *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
42. " " " " " "  = 1yjn:L *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
43. " " " " " "  = 1yjw:L *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
44. " " " " " "  = 2otj:L *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
45. " " " " " "  = 2otl:L *
Girodazole bound to the large subunit of haloarcula marismor
46. " " " " " "  = 2qa4:L *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
47. " " " " " "  = 2qex:L *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
48. " " " " " "  = 3cc2:L *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
49. " " " " " "  = 3cc4:L *
Co-crystal structure of anisomycin bound to the 50s ribosoma
50. " " " " " "  = 3cc7:L *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
51. " " " " " "  = 3cce:L *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
52. " " " " " "  = 3ccj:L *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
53. " " " " " "  = 3ccl:L *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
54. " " " " " "  = 3ccm:L *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
55. " " " " " "  = 3ccq:L *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
56. " " " " " "  = 3ccr:L *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
57. " " " " " "  = 3ccs:L *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
58. " " " " " "  = 3ccu:L *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
59. " " " " " "  = 3ccv:L *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
60. " " " " " "  = 3cd6:L *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
61. " " " " " "  = 3cma:L *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
62. " " " " " "  = 3cme:L *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
63. " " " " " "  = 3cpw:K *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
64. " " " " " "  = 3cxc:K *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
65. " " " " " "  = 3g4s:L *
Co-crystal structure of tiamulin bound to the large ribosoma
66. " " " " " "  = 3g6e:L *
Co-crystal structure of homoharringtonine bound to the large subunit
67. " " " " " "  = 3g71:L *
Co-crystal structure of bruceantin bound to the large riboso subunit
68. " " " " " "  = 3i55:L *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
69. " " " " " "  = 3i56:L *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
70. " " " " " "  = 3ow2:K *
Crystal structure of enhanced macrolide bound to 50s ribosom
71. 86 41.7% 36 146 122.8 7.3 1w2b:K Trigger factor ribosome binding domain in complex with 50s
72. 93 30.7% 101 146 120.2 10 3j3v:L * Atomic model of the immature 50s subunit from bacillus subti i-a)
73. " " " " " "  = 3j3w:L *
Atomic model of the immature 50s subunit from bacillus subti ii-a)
74. 82 48.6% 35 147 117.5 14 3j21:L * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
75. " " " " " "  = 3j44:L *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
76. 83 23.5% 119 180 117.4 14 4a17:N * T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 2.
77. " " " " " "  = 4a1a:N *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 3.
78. " " " " " "  = 4a1c:N *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 4.
79. " " " " " "  = 4a1e:N *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 1
80. 79 40.3% 72 122 114.8 20 2zkr:l Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
81. 80 41.9% 62 147 114.8 20 3j3b:a Structure of the human 60s ribosomal proteins
82. 82 29.1% 86 281 113.1 25 2iss:A Structure of the plp synthase holoenzyme from thermotoga mar
83. 78 41.4% 58 148 112.1 29 4a17:K * T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 2.
84. " " " " " "  = 4a1a:K *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 3.
85. " " " " " "  = 4a1c:K *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 4.
86. " " " " " "  = 4a1e:K *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 1
87. 79 34.9% 63 212 111.0 33 3cdk:B Crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis
88. 74 39.1% 46 85 110.6 35 3eus:A The crystal structure of the DNA binding protein from silici pomeroyi
89. 71 36.6% 41 63 108.5 46 4b2j:A * Complexes of dodecin with flavin and flavin-like ligands
90. " " " " " "  = 4b2k:A *
Complexes of dodecin with flavin and flavin-like ligands
91. " " " " " "  = 4b2m:A *
Complexes of dodecin with flavin and flavin-like ligands
92. 77 27.7% 83 214 108.3 47 2ij9:A Crystal structure of uridylate kinase from archaeoglobus ful
93. 77 24.0% 75 216 108.3 47 3t9q:A Structure of the phosphatase domain of the cell fate determi spoiie from bacillus subtilis (mn presoaked)
94. 80 26.1% 88 390 108.3 47 4ehj:A An x-ray structure of a putative phosphogylcerate kinase fro francisella tularensis subsp. Tularensis schu s4
95. 80 26.1% 88 392 108.2 47 4fey:A An x-ray structure of a putative phosphogylcerate kinase wit adp from francisella tularensis subsp. Tularensis schu s4

Number of sequences: 95

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer