spacer
spacer

SAS results for UniProt accession no. P22452

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P22452 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P22452 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 18 unique sequences (including 10 consensus sequences) giving 97 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P22452 --------------------------------------------------------mgkkskatk    50S ribosomal protein L39e OS=Haloarcula marismortui  ...
1yj9:2*---------------------------------------------------------gkkskatk×2  Crystal structure of the mutant 50s ribosomal subunit of  ...
1s72:2*---------------------------------------------------------gkkskatk×45 Refined crystal structure of the haloarcula marismortui  ...
1jj2:1*---------------------------------------------------------gkkskatk×20 Fully refined crystal structure of the haloarcula  ...
1ffk:Y ---------------------------------------------------------gkkskatk    Crystal structure of the large ribosomal subunit from  ...
1vvk:f*-------------------------------------------------------marnkplakk×2  Structure of the methanococcus jannaschii  ...
3iz5:o*-------------------------------------------------------mpshktfrik×3  Localization of the large subunit ribosomal proteins into a  ...
3j39:l --------------------------------------------------------aahksfrik    Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:q --------------------------------------------------------grfkplaik    High-resolution cryo-electron microscopy structure of the  ...
2zkr:3 ---------------------------------------------------------shktfrik    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:l --------------------------------------------------------sshktfrik    Structure of the human 60s ribosomal proteins
3jyw:1*---------------------------------------------------------aqksfrik×3  Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:l*--------------------------------------------------------aaqksfrik×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:o*-------------------------------------------------------maaqksfrik×2  Localization of the large subunit ribosomal proteins into a  ...
4a18:B*--------------------------------------------------------ganktlnmk×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2ww9:O*-------------------------------------------------------maaqksfrik×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
3zf7:t vnypkkkkmhcpdercnahksfkvvqykagkarlyargkrrydrkqsgyggqtkpifhkkakttk    High-resolution cryo-electron microscopy structure of the  ...
1ql0:A ----------------------------------------------sidncavgcptggsskvsi    Sm endonuclease from seratia marcenscens at atomic  ...
3j7a:6 --------------------------------------------------------------gsl    Cryo-em structure of the plasmodium falciparum 80s ribosome  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P22452 krlakldnqns--rvpawvmlktdrevqrnhkrrhwrrndtde----------------------    50S ribosomal protein L39e OS=Haloarcula marismortui  ...
1yj9:2*krlakldnqns--rvpawvmlktdrevqrnhkrrhwrrndtde----------------------×2  Crystal structure of the mutant 50s ribosomal subunit of  ...
1s72:2*krlakldnqns--rvpawvmlktdr---rnhkrrhwrrndtde----------------------×45 Refined crystal structure of the haloarcula marismortui  ...
1jj2:1*krlakldnqns--rvpawvmlktd---ernhkrrhwrrndtde----------------------×20 Fully refined crystal structure of the haloarcula  ...
1ffk:Y krkakldnqns--rvpayvmlktde----------------------------------------    Crystal structure of the large ribosomal subunit from  ...
1vvk:f*lrlakalkqnr--rvpvwvivktnrrvlthpkrrywrrtklke----------------------×2  Structure of the methanococcus jannaschii  ...
3iz5:o*qklakkqrqnr--pipywirmrtdntirynakrrhwrrtklgf----------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j39:l qklakklkqnr--svpqwvrlrtgntirynakrrhwrrtklkl----------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:q kkyakklkqnr--pvpywirlrtgnrikwnekrrhwrrtklhy----------------------    High-resolution cryo-electron microscopy structure of the  ...
2zkr:3 rflakkqkqnr--pipqwirmktgnkirynskrrhwrrtklg-----------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:l rflakkqkqnr--pipqwirmktgnkirynskrrhwrrtklgl----------------------    Structure of the human 60s ribosomal proteins
3jyw:1*qkmakakkqnr--plpqwirlrtnntirynakrrnwrrtkmn-----------------------×3  Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:l*qkmakakkqnr--plpqwirlrtnntirynakrrnwrrtkmni----------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:o*qkmakakkqnr--plpqwirlrtnntirynakrrnwrrtkmni----------------------×2  Localization of the large subunit ribosomal proteins into a  ...
4a18:B*krfgrkikqnr--plpnwyryksdtnirynskrrnwrrtklkiy---------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2ww9:O*qkmakakkqnr--plpqwirlrtnntiry------------------------------------×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
3zf7:t kivlklqcsnc--ksiiqnvlkrtkhfelndkkktgnkdptw-----------------------    High-resolution cryo-electron microscopy structure of the  ...
1ql0:A vrhaytlnnnsttkfanwvayhitkdtpasgktrnwktdpalnpadtlapadytganaalkvdrg    Sm endonuclease from seratia marcenscens at atomic  ...
3j7a:6 aragkvknqtp--kvpk--ldkkkrltgrakkrqlynrrfsdng---------------------    Cryo-em structure of the plasmodium falciparum 80s ribosome  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P22452 -----------------------------------------------------------------    50S ribosomal protein L39e OS=Haloarcula marismortui  ...
1yj9:2*-----------------------------------------------------------------×2  Crystal structure of the mutant 50s ribosomal subunit of  ...
1s72:2*-----------------------------------------------------------------×45 Refined crystal structure of the haloarcula marismortui  ...
1jj2:1*-----------------------------------------------------------------×20 Fully refined crystal structure of the haloarcula  ...
1ffk:Y -----------------------------------------------------------------    Crystal structure of the large ribosomal subunit from  ...
1vvk:f*-----------------------------------------------------------------×2  Structure of the methanococcus jannaschii  ...
3iz5:o*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j39:l -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:q -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
2zkr:3 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:l -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3jyw:1*-----------------------------------------------------------------×3  Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:l*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:o*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
4a18:B*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2ww9:O*-----------------------------------------------------------------×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
3zf7:t -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
1ql0:A hqaplaslagvsdweslnylsnitpqksdlnqgawarledqerklidradissvytvtgplyerd    Sm endonuclease from seratia marcenscens at atomic  ...
3j7a:6 -----------------------------------------------------------------    Cryo-em structure of the plasmodium falciparum 80s ribosome  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P22452 -----------------------------------------------------------------    50S ribosomal protein L39e OS=Haloarcula marismortui  ...
1yj9:2*-----------------------------------------------------------------×2  Crystal structure of the mutant 50s ribosomal subunit of  ...
1s72:2*-----------------------------------------------------------------×45 Refined crystal structure of the haloarcula marismortui  ...
1jj2:1*-----------------------------------------------------------------×20 Fully refined crystal structure of the haloarcula  ...
1ffk:Y -----------------------------------------------------------------    Crystal structure of the large ribosomal subunit from  ...
1vvk:f*-----------------------------------------------------------------×2  Structure of the methanococcus jannaschii  ...
3iz5:o*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3j39:l -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:q -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
2zkr:3 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:l -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3jyw:1*-----------------------------------------------------------------×3  Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:l*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:o*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
4a18:B*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2ww9:O*-----------------------------------------------------------------×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
3zf7:t -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
1ql0:A mgklpgtqkahtipsaywkvifinnspavnhyaaflfdqntpkgadfcqfrvtvdeiekrtglii    Sm endonuclease from seratia marcenscens at atomic  ...
3j7a:6 -----------------------------------------------------------------    Cryo-em structure of the plasmodium falciparum 80s ribosome  ...

                2         2       
                7         8       
       123456789012345678901234567                                          Protein name
       ---------+---------+-------                                          ------------
P22452 ---------------------------                                          50S ribosomal protein L39e OS=Haloarcula marismortui  ...
1yj9:2*---------------------------                                      ×2  Crystal structure of the mutant 50s ribosomal subunit of  ...
1s72:2*---------------------------                                      ×45 Refined crystal structure of the haloarcula marismortui  ...
1jj2:1*---------------------------                                      ×20 Fully refined crystal structure of the haloarcula  ...
1ffk:Y ---------------------------                                          Crystal structure of the large ribosomal subunit from  ...
1vvk:f*---------------------------                                      ×2  Structure of the methanococcus jannaschii  ...
3iz5:o*---------------------------                                      ×3  Localization of the large subunit ribosomal proteins into a  ...
3j39:l ---------------------------                                          Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:q ---------------------------                                          High-resolution cryo-electron microscopy structure of the  ...
2zkr:3 ---------------------------                                          Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:l ---------------------------                                          Structure of the human 60s ribosomal proteins
3jyw:1*---------------------------                                      ×3  Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:l*---------------------------                                      ×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:o*---------------------------                                      ×2  Localization of the large subunit ribosomal proteins into a  ...
4a18:B*---------------------------                                      ×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2ww9:O*---------------------------                                      ×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
3zf7:t ---------------------------                                          High-resolution cryo-electron microscopy structure of the  ...
1ql0:A waglpddvqaslkskpgvlpelmgckn                                          Sm endonuclease from seratia marcenscens at atomic  ...
3j7a:6 ---------------------------                                          Cryo-em structure of the plasmodium falciparum 80s ribosome  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P22452. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 50 - - P22452 50S ribosomal protein L39e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl39e PE=1 SV=2
2. 335 100.0% 49 49 530.8 1.4e-22 1yj9:2 * Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
3. " " " " " "  = 4hub:2 *
The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
4. 301 93.9% 49 46 478.9 1.1e-19 1s72:2 * Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
5. " " " " " "  = 1vq4:2 *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
6. " " " " " "  = 1vq5:2 *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
7. " " " " " "  = 1vq6:2 *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
8. " " " " " "  = 1vq7:2 *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
9. " " " " " "  = 1vq8:2 *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
10. " " " " " "  = 1vq9:2 *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
11. " " " " " "  = 1vqk:2 *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
12. " " " " " "  = 1vql:2 *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
13. " " " " " "  = 1vqm:2 *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
14. " " " " " "  = 1vqn:2 *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
15. " " " " " "  = 1vqo:2 *
The structure of ccpmn bound to the large ribosomal subunit marismortui
16. " " " " " "  = 1vqp:2 *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
17. " " " " " "  = 1yhq:2 *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
18. " " " " " "  = 1yi2:2 *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
19. " " " " " "  = 1yij:2 *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
20. " " " " " "  = 1yit:2 *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
21. " " " " " "  = 1yjn:2 *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
22. " " " " " "  = 1yjw:2 *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
23. " " " " " "  = 2otj:2 *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
24. " " " " " "  = 2otl:2 *
Girodazole bound to the large subunit of haloarcula marismor
25. " " " " " "  = 2qa4:2 *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
26. " " " " " "  = 2qex:2 *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
27. " " " " " "  = 3cc2:2 *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
28. " " " " " "  = 3cc4:2 *
Co-crystal structure of anisomycin bound to the 50s ribosoma
29. " " " " " "  = 3cc7:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
30. " " " " " "  = 3cce:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
31. " " " " " "  = 3ccj:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
32. " " " " " "  = 3ccl:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
33. " " " " " "  = 3ccm:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
34. " " " " " "  = 3ccq:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
35. " " " " " "  = 3ccr:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
36. " " " " " "  = 3ccs:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
37. " " " " " "  = 3ccu:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
38. " " " " " "  = 3ccv:2 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
39. " " " " " "  = 3cd6:2 *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
40. " " " " " "  = 3cma:2 *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
41. " " " " " "  = 3cme:2 *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
42. " " " " " "  = 3cpw:1 *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
43. " " " " " "  = 3g4s:2 *
Co-crystal structure of tiamulin bound to the large ribosoma
44. " " " " " "  = 3g6e:2 *
Co-crystal structure of homoharringtonine bound to the large subunit
45. " " " " " "  = 3g71:2 *
Co-crystal structure of bruceantin bound to the large riboso subunit
46. " " " " " "  = 3i55:2 *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
47. " " " " " "  = 3i56:2 *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
48. " " " " " "  = 4adx:2 *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
49. 296 91.8% 49 46 471.2 2.9e-19 1jj2:1 * Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
50. " " " " " "  = 1k73:3 *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
51. " " " " " "  = 1k8a:3 *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
52. " " " " " "  = 1k9m:3 *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
53. " " " " " "  = 1kc8:3 *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
54. " " " " " "  = 1kd1:3 *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
55. " " " " " "  = 1kqs:1 *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
56. " " " " " "  = 1m1k:3 *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
57. " " " " " "  = 1m90:3 *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
58. " " " " " "  = 1n8r:3 *
Structure of large ribosomal subunit in complex with virginiamycin m
59. " " " " " "  = 1nji:3 *
Structure of chloramphenicol bound to the 50s ribosomal subunit
60. " " " " " "  = 1q7y:3 *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
61. " " " " " "  = 1q81:3 *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
62. " " " " " "  = 1q82:3 *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
63. " " " " " "  = 1q86:3 *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
64. " " " " " "  = 1qvf:1 *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
65. " " " " " "  = 1qvg:1 *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
66. " " " " " "  = 1w2b:1 *
Trigger factor ribosome binding domain in complex with 50s
67. " " " " " "  = 3cxc:1 *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
68. " " " " " "  = 3ow2:1 *
Crystal structure of enhanced macrolide bound to 50s ribosom
69. 172 93.3% 30 31 282.5 9.2e-09 1ffk:Y Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
70. 159 53.2% 47 51 260.0 1.7e-07 1vvk:f * Structure of the methanococcus jannaschii ribosome-secyebeta complex (secyebeta + 50s ribosomal proteins)
71. " " " " " "  = 3j21:f *
Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
72. 148 45.2% 42 51 243.1 1.4e-06 3iz5:o * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
73. " " " " " "  = 3izr:o *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
74. " " " " " "  = 3j61:l *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
75. 146 52.4% 42 50 240.1 2.1e-06 3j39:l Structure of the d. Melanogaster 60s ribosomal proteins
76. 144 50.0% 42 50 237.1 3.1e-06 3zf7:q High-resolution cryo-electron microscopy structure of the tr brucei ribosome
77. 142 45.2% 42 48 234.2 4.5e-06 2zkr:3 Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
78. 142 45.2% 42 50 234.0 4.7e-06 3j3b:l Structure of the human 60s ribosomal proteins
79. 137 41.9% 43 48 226.5 1.2e-05 3jyw:1 * Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
80. " " " " " "  = 3o58:e *
Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
81. " " " " " "  = 3o5h:e *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
82. 137 41.9% 43 50 226.3 1.3e-05 3u5e:l * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
83. " " " " " "  = 3u5i:l *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
84. " " " " " "  = 4b6a:l *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
85. " " " " " "  = 4byn:l *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
86. " " " " " "  = 4byu:l *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
87. 137 41.9% 43 51 226.2 1.3e-05 3izc:o * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
88. " " " " " "  = 3izs:o *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
89. 125 40.5% 42 51 207.7 0.00014 4a18:B * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
90. " " " " " "  = 4a19:B *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
91. " " " " " "  = 4a1b:B *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
92. " " " " " "  = 4a1d:B *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
93. 83 33.3% 33 37 144.8 0.43 2ww9:O * Cryo-em structure of the active yeast ssh1 complex bound to yeast 80s ribosome
94. " " " " " "  = 2wwa:O *
Cryo-em structure of idle yeast ssh1 complex bound to the yeast 80s ribosome
95. " " " " " "  = 2wwb:O *
Cryo-em structure of the mammalian sec61 complex bound to th actively translating wheat germ 80s ribosome
96. 71 30.4% 46 105 121.1 9.1 3zf7:t High-resolution cryo-electron microscopy structure of the tr brucei ribosome
97. 69 27.7% 47 241 113.8 23 1ql0:A Sm endonuclease from seratia marcenscens at atomic resolution
98. 61 33.3% 39 43 110.2 37 3j7a:6 Cryo-em structure of the plasmodium falciparum 80s ribosome the anti-protozoan drug emetine, small subunit

Number of sequences: 98

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer