spacer
spacer

SAS results for UniProt accession no. Q980B8

Sequence annotated by structure
>

Key:
Sec. struc: Predicted
  Helix Strand

Predicted secondary structure (green) comes from the DSC program. The lighter the green the less certain the prediction.

 

FASTA alignment for UniProt accession no. Q980B8 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q980B8 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 18 unique sequences (including 2 consensus sequences) giving 23 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q980B8 -----------------------------------------------------------------   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q -----------------------------------------------------------------   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y -----------------------------------------------------------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J -----------------------------------------------------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A -----------------------------------------------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A -----------------------------------------------------------------   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C msdletvakflaesviastaktsernlrqletqdgfgltllhviastnlplstrlagalffknfi   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A -----------------------------------------------------------------   Hypotetical protein p76
2apy:A -----------------------------------------------------------------   Hypotetical protein p76 model
3exa:A -----------------------------------------------------------------   Crystal structure of the full-length tRNA  ...
1pie:A -----------------------------------------------------------------   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A -----------------------------------------------------------------   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q980B8 -----------------------------------------------------------------   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q -----------------------------------------------------------------   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y -----------------------------------------------------------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J -----------------------------------------------------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A -----------------------------------------------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A -----------------------------------------------------------------   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C krkwvdengnhllpannvelikkeivplmislpnnlqvqigeaissiadsdfpdrwptllsdlas   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A -----------------------------------------------------------------   Hypotetical protein p76
2apy:A -----------------------------------------------------------------   Hypotetical protein p76 model
3exa:A ----------------------------------------keklvaivgptavgktktsvmlakr   Crystal structure of the full-length tRNA  ...
1pie:A -----------------------------------------------------------------   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A -----------------------------------------------------------------   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q980B8 -----------------------------------------------------------------   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q -----------------------------------------------------------------   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y -----------------------------------------------------------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J -----------------------------------------------------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A -----------------------------------------------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A ------------------------------keklvaivgptavgktktsvmlakrlngevisgds   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C rlsnddmvtnkgvltvahsifkrwrplfrsdelfleiklvldvftapflnllktvdeqitaneka   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A ------------------------------------------------mnyileklnkqviwint   Hypotetical protein p76
2apy:A ------------------------------------------------mnyileklnkqviwint   Hypotetical protein p76 model
3exa:A lngevisgdsmqvyrgmdigtakitaeemdgvphhlidikdpsesfsvadfqdlatpliteiher   Crystal structure of the full-length tRNA  ...
1pie:A -----------------------------------------------------------------   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A -----------------------------------------------------------------   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q980B8 -----------------------------------------------------------------   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q -----------------------------------------------------------------   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y -----------------------------------------------------------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J -----------------------------------------------------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A -----------------------------------------------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A mqvyrgmdigtakitaeemdgvphhlidikdpsesfsvadfqdlatpliteihergrlpflvggt   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C slnilfdvllvliklyydfncqdipeffedniqvgmgifhkylsysnpllehasvlikvkssiqe   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A dpnrlvgekawgnfkpnqheivyslhynpeiretfvaeikdgvaqdftlqkvynkisgeerilqs   Hypotetical protein p76
2apy:A dpnrlvgekawgnfkpnqheivyslhynpeiretfvaeikdgvaqdftlqkvynkisgeerilqs   Hypotetical protein p76 model
3exa:A grlpflvggtglyvnavihqfnlgdiradedyrheleafvnsygvqalhdklskidpkaaaaihp   Crystal structure of the full-length tRNA  ...
1pie:A ------------------------------------------------tvlsaltekfaevfgdt   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A --------------------------------------qnkerrqkiltcsldlfiekgyyntsi   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q980B8 ---------------------mvsgmstdeekegtsd-eevneekeveetsedefpk-l---siq   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q ------------------------------------------------------fpk-l---siq   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------efpk-l---siq   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J ------------------------------------------------------fpk-l---siq   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y ---------------------------------------------------------------iq   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q ---------------------------------------------------------------iq   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J ----------------------------------------------------------------q   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A -----------------------------------------------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A glyvnavihqfnlgetpspynlvmigltmerdvlydr-inrrvdqmveeglideakk-lydrgir   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C lvqlyttryedvfgpminefiqitwnlltsisnqpky-dilvskslsfltavtripkyf---eif   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A wedkidseieteiepfkdsagnlveyqkytdsgwmid-qerkkeslleknsqtfysk-l---dsy   Hypotetical protein p76
2apy:A wedkidseieteiepfkdsagnlveyqkytdsgwmid-qerkkeslleknsqtfysk-l---dsy   Hypotetical protein p76 model
3exa:A nnyrrviraleiikltgspynlvmigltmerdvlydr-inrrvdqmveeglideakk-lydrgir   Crystal structure of the full-length tRNA  ...
1pie:A keveyffspgrinligehtdynggyvfpasitigttglarlredkkvklysen-fpk-l---gvi   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A rdiialsevgtgtfynyfvdkedilknlledfakqii-ssiseyylvekdlyerfie-t---krl   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*--------------------gvkayelrtkskeqlas-qlvdlkkelaelkvqklsr-p---slp×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*-------------------agvkayelrtkskeqlas-qlvdlkkelaelkvqklsr-p---slp×5 The structure of the eukaryotic ribosome at 3.0 a  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q980B8 diel---l--mrn---teiwdnllngkitl-eeakklfednykeyekrdsrrkakkavskkvkkt   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q diel---l--mkn---teiwdnllngkisv-deakrlfednykdyekrdsrr-------------   Rnap at 3.2ang
4b1o:Q diel---l--mkn---teiwdnllngkisv-deakrlfednykdyekrdsr--------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J diel---l--mkn---teiwdnllngkisv-deakrlfednykdyekrdsr--------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y diel---l--mrn---teiwdnllngkitl-eeakklfednykeyekrdsrr-------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q iiel---l--mkn---teiwdnllngkisv-deakrlfednykdyekrdsrr-------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J niel---l--mkn---teiwdnllngkisv-deakrlfednykdyek------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J ------------n---teiwdnllngkisv-deakrlfednykdyekrdsr--------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q ----------mkn---teiwdnllngkisv-deakrlfednykdyek------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A ---n---a--mrq---sgswmtiwddri-l-eiiheegngspkeledrdeiriskssvsrrlkkl   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A dcqs---vqaigy---kemyd-yldgnvtl-eeaidtlkrnsrryakrqltwfrnkanvtwfdmt   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C nnes---a--mnn-----iteqiilpnvtlreedvelfeddpieyirrdlegtrrractdflkel   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A rskv---v--yrn---t-lwds---gktyl-eniqktltlynkqriisipewrdandqfhslsve   Hypotetical protein p76
2apy:A rskv---v--yrn---t-lwds---gktyl-eniqktltlynkqriisipewrdandqfhslsve   Hypotetical protein p76 model
3exa:A dcqs---vqaigy---kemyd-yldgnvtl-eeaidtlkrnsrryakrqltwfrnkanvtwfdmt   Crystal structure of the full-length tRNA  ...
1pie:A efdldeve--kkd---gelwsnyvkgmivm-lkgagyeidkgfellikgeiptasglsssaslel   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A tmev---f--aqnetlseiysrvagssapi-dqclkqfedrllefysrnieygikkgvfknvpvs   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*kikt---v--rks---iacvltvineq-qr-eavrqlykg--kkyqpkdlrakktralrraltkf×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*kikt---v--rks---iacvltvineq-qr-eavrqlykg--kkyqpkdlrakktralrraltkf×5 The structure of the eukaryotic ribosome at 3.0 a  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q980B8 kkkeksveg--------------------------------------------------------   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q -----------------------------------------------------------------   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y -----------------------------------------------------------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J -----------------------------------------------------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A adhdllqplangvyviteegeaylngeydagkeryi-----------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A dvdfdkkimeihnfiagkleeksk-----------------------------------------   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C keknevlvtniflahmkgfvdqymsnwkfkdlyiylftalaingnitnagvsstnnllnvvdfft   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A elselldlieldlfnagrilytkkwemeekirhla------------------------------   Hypotetical protein p76
2apy:A elselldlieldlfnagrilytkkwemeekirhlapqefldlsiewnls----------------   Hypotetical protein p76 model
3exa:A dvdfdkkimeihnfiagkleeksklehh-------------------------------------   Crystal structure of the full-length tRNA  ...
1pie:A lvgvvlddlfnlnvprlelvqlgqktendyigvnsgildqfaigfgevkkaieldcntlkyemvp   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A piahsilaiekfslykwvvlkaitkeemiemvlsfhktlavgllvvn------------------   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*easqvtekqrkkqiafpqrkyaika----------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*easqvtekqrkkqiafpqrkyaika----------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q980B8 -----------------------------------------------------------------   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q -----------------------------------------------------------------   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y -----------------------------------------------------------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J -----------------------------------------------------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A -----------------------------------------------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A -----------------------------------------------------------------   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C keiapdltsnniphiilrvdaikyiytfrnqltkaqlielmpilatflqtdeyvvytyaaitiek   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A -----------------------------------------------------------------   Hypotetical protein p76
2apy:A -----------------------------------------------------------------   Hypotetical protein p76 model
3exa:A -----------------------------------------------------------------   Crystal structure of the full-length tRNA  ...
1pie:A velrdydivimntnkpralteskynerfaetrealkrmqtrldiqslgelsneefdantdligde   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A -----------------------------------------------------------------   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q980B8 -----------------------------------------------------------------   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q -----------------------------------------------------------------   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y -----------------------------------------------------------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J -----------------------------------------------------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A -----------------------------------------------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A -----------------------------------------------------------------   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C iltiresntspafifhkedisnsteillknlialilkhgsspeklaeneflmrsifrvlqtseds   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A -----------------------------------------------------------------   Hypotetical protein p76
2apy:A -----------------------------------------------------------------   Hypotetical protein p76 model
3exa:A -----------------------------------------------------------------   Crystal structure of the full-length tRNA  ...
1pie:A tlikrarhavyennrtkiaqkafvagnltkfgellnashaslkddyevtgleldtlaetaqkqag   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A -----------------------------------------------------------------   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q980B8 -----------------------------------------------------------------   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q -----------------------------------------------------------------   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y -----------------------------------------------------------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J -----------------------------------------------------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A -----------------------------------------------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A -----------------------------------------------------------------   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C iqplfpqllaqfieivtimaknpsnprfthytfesigailnytqrqnlpllvdsmmptfltvfse   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A -----------------------------------------------------------------   Hypotetical protein p76
2apy:A -----------------------------------------------------------------   Hypotetical protein p76 model
3exa:A -----------------------------------------------------------------   Crystal structure of the full-length tRNA  ...
1pie:A vlgarmtgagfggcaialvahdnvsafrkavgqvyeevvgypasfyvaqigsgstkl--------   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A -----------------------------------------------------------------   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...

                6         6         6         6         7         7     
                6         7         8         9         0         1     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q980B8 -----------------------------------------------------------------   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q -----------------------------------------------------------------   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y -----------------------------------------------------------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J -----------------------------------------------------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A -----------------------------------------------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A -----------------------------------------------------------------   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C diqefipyvfqiiafvveqsatipesikplaqpllapnvwelkgnipavtrllksfiktdssifp   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A -----------------------------------------------------------------   Hypotetical protein p76
2apy:A -----------------------------------------------------------------   Hypotetical protein p76 model
3exa:A -----------------------------------------------------------------   Crystal structure of the full-length tRNA  ...
1pie:A -----------------------------------------------------------------   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A -----------------------------------------------------------------   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...

           7         7         7         7         7         7         7
           2         3         4         5         6         7         8
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q980B8 -----------------------------------------------------------------   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q -----------------------------------------------------------------   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y -----------------------------------------------------------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J -----------------------------------------------------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A -----------------------------------------------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A -----------------------------------------------------------------   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C dlvpvlgifqrliaskayevhgfdllehimllidmnrlrpyikqiavlllqrlqnskteryvkkl   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A -----------------------------------------------------------------   Hypotetical protein p76
2apy:A -----------------------------------------------------------------   Hypotetical protein p76 model
3exa:A -----------------------------------------------------------------   Crystal structure of the full-length tRNA  ...
1pie:A -----------------------------------------------------------------   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A -----------------------------------------------------------------   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...

                7         8         8         8         8         8     
                9         0         1         2         3         4     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
Q980B8 -----------------------------------------------------------------   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q -----------------------------------------------------------------   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y -----------------------------------------------------------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J -----------------------------------------------------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A -----------------------------------------------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A -----------------------------------------------------------------   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C tvffglisnklgsdflihfidevqdglfqqiwgnfiittlptignlldrkialigvlnmvingqf   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A -----------------------------------------------------------------   Hypotetical protein p76
2apy:A -----------------------------------------------------------------   Hypotetical protein p76 model
3exa:A -----------------------------------------------------------------   Crystal structure of the full-length tRNA  ...
1pie:A -----------------------------------------------------------------   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A -----------------------------------------------------------------   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...

           8         8         8         8         8         9         9
           5         6         7         8         9         0         1
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
Q980B8 -----------------------------------------------------------------   Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q -----------------------------------------------------------------   Rnap at 3.2ang
4b1o:Q -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J -----------------------------------------------------------------   Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y -----------------------------------------------------------------   The x-ray crystal structure of RNA polymerase from archaea
2waq:Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J -----------------------------------------------------------------   Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q -----------------------------------------------------------------   The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A -----------------------------------------------------------------   Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A -----------------------------------------------------------------   Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C fqskyptlisstmnsiietassqsianlkndyveeistfgshfsklvsisekpfdplpeidvnng   Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A -----------------------------------------------------------------   Hypotetical protein p76
2apy:A -----------------------------------------------------------------   Hypotetical protein p76 model
3exa:A -----------------------------------------------------------------   Crystal structure of the full-length tRNA  ...
1pie:A -----------------------------------------------------------------   Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A -----------------------------------------------------------------   Crystal structure of putative tetr-family transcriptional  ...
3izc:c*-----------------------------------------------------------------×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*-----------------------------------------------------------------×5 The structure of the eukaryotic ribosome at 3.0 a  ...

                9         9         9         9  
                2         3         4         5  
       123456789012345678901234567890123456789012                          Protein name
       ---------+---------+---------+---------+--                          ------------
Q980B8 ------------------------------------------                          Uncharacterized protein OS=Sulfolobus solfataricus (strain  ...
4ayb:Q ------------------------------------------                          Rnap at 3.2ang
4b1o:Q ------------------------------------------                          Archaeal rnap-DNA binary complex at 4.32ang
4b1p:J ------------------------------------------                          Archaeal rnap-DNA binary complex at 4.32ang
3hkz:Y ------------------------------------------                          The x-ray crystal structure of RNA polymerase from archaea
2waq:Q ------------------------------------------                          The complete structure of the archaeal 13-subunit DNA-  ...
2y0s:J ------------------------------------------                          Crystal structure of sulfolobus shibatae RNA polymerase in  ...
2wb1:J ------------------------------------------                          The complete structure of the archaeal 13-subunit DNA-  ...
  " :Q ------------------------------------------                          The complete structure of the archaeal 13-subunit DNA-  ...
3b73:A ------------------------------------------                          Crystal structure of the phih1 repressor-like protein from  ...
2qgn:A ------------------------------------------                          Crystal structure of tRNA isopentenylpyrophosphate  ...
1wa5:C vrlyvaealnkynaisgntflntilpqltqenqvklnqllvg                          Crystal structure of the exportin cse1p complexed with its  ...
2d1d:A ------------------------------------------                          Hypotetical protein p76
2apy:A ------------------------------------------                          Hypotetical protein p76 model
3exa:A ------------------------------------------                          Crystal structure of the full-length tRNA  ...
1pie:A ------------------------------------------                          Crystal structure of lactococcus lactis galactokinase  ...
3lwj:A ------------------------------------------                          Crystal structure of putative tetr-family transcriptional  ...
3izc:c*------------------------------------------                       ×2 Localization of the large subunit ribosomal proteins into a  ...
3u5e:h*------------------------------------------                       ×5 The structure of the eukaryotic ribosome at 3.0 a  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q980B8. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 104 - - Q980B8 Uncharacterized protein OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0396 PE=1 SV=1
2. 303 88.0% 50 50 387.2 1.4e-14 4ayb:Q Rnap at 3.2ang
3. 302 88.0% 50 50 386.0 1.6e-14 4b1o:Q Archaeal rnap-DNA binary complex at 4.32ang
4. 296 87.8% 49 49 378.8 4e-14 4b1p:J Archaeal rnap-DNA binary complex at 4.32ang
5. 291 100.0% 45 45 373.1 8.3e-14 3hkz:Y The x-ray crystal structure of RNA polymerase from archaea
6. 257 84.4% 45 45 331.8 1.7e-11 2waq:Q The complete structure of the archaeal 13-subunit DNA- directed RNA polymerase
7. 224 82.1% 39 39 292.4 2.6e-09 2y0s:J Crystal structure of sulfolobus shibatae RNA polymerase in p21 space group
8. 211 85.7% 35 35 277.1 1.8e-08 2wb1:J The complete structure of the archaeal 13-subunit DNA- directed RNA polymerase
9. 194 81.8% 33 33 256.7 2.5e-07 2wb1:Q The complete structure of the archaeal 13-subunit DNA- directed RNA polymerase
10. 82 34.0% 50 88 115.5 19 3b73:A Crystal structure of the phih1 repressor-like protein from haloarcula marismortui
11. 83 35.5% 62 244 111.4 31 2qgn:A Crystal structure of tRNA isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
12. 88 32.0% 75 938 110.6 35 1wa5:C Crystal structure of the exportin cse1p complexed with its cargo (kap60p) and rangtp
13. 82 33.3% 51 229 110.6 35 2d1d:A Hypotetical protein p76
14. 82 33.3% 51 243 110.3 36 2apy:A Hypotetical protein p76 model
15. 83 35.5% 62 303 110.3 36 3exa:A Crystal structure of the full-length tRNA isopentenylpyrophosphate transferase (bh2366) from bacillus halodurans, northeast structural genomics consortium target bhr41.
16. 83 32.1% 53 388 109.1 42 1pie:A Crystal structure of lactococcus lactis galactokinase complexed with galactose
17. 80 24.7% 77 193 109.0 43 3lwj:A Crystal structure of putative tetr-family transcriptional re (yp_752756.1) from syntrophomonas wolfei str. Goettingen at resolution
18. 77 21.4% 84 118 107.9 49 3izc:c * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
19. " " " " " "  = 3izs:c *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
20. 77 21.4% 84 119 107.8 50 3u5e:h * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
21. " " " " " "  = 3u5i:h *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
22. " " " " " "  = 4b6a:h *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
23. " " " " " "  = 4byn:h *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
24. " " " " " "  = 4byu:h *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex

Number of sequences: 24

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer