spacer
spacer

SAS results for UniProt accession no. Q72JR0

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. Q72JR0 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q72JR0 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 29 unique sequences (including 19 consensus sequences) giving 174 sequence matches in all. The 12 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q72JR0 -----------------------------------------------------------------    50S ribosomal protein L31 OS=Thermus thermophilus (strain  ...
2hgj:3*-----------------------------------------------------------------×8  Crystal structure of the 70s thermus thermophilus ribosome  ...
3tve:4*-----------------------------------------------------------------×8  Crystal structure analysis of ribosomal decoding. This  ...
3tvh:4*-----------------------------------------------------------------×8  Crystal structure analysis of ribosomal decoding. This  ...
2wrj:4*-----------------------------------------------------------------×8  The structure of the ribosome with elongation factor g  ...
2xtg:4*-----------------------------------------------------------------×6  tRNA tranlocation on the 70s ribosome: the        pre-  ...
2xg0:4*-----------------------------------------------------------------×2  Structure of cytotoxic domain of colicin e3 bound to the  ...
2j01:4*-----------------------------------------------------------------×5  Structure of the thermus thermophilus 70s ribosome  ...
3knm:4*-----------------------------------------------------------------×2  The structures of capreomycin bound to the 70s ribosome.  ...
3uxq:4*-----------------------------------------------------------------×10 The structure of thermorubin in complex with the 70s  ...
2wro:4*-----------------------------------------------------------------×4  The crystal structure of the 70s ribosome bound to ef-tu  ...
2xqe:4*-----------------------------------------------------------------×9  The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
4ejc:4 -----------------------------------------------------------------    Crystal structure of the bacterial ribosome ram mutation  ...
1kc9:Y*-----------------------------------------------------------------×19 Crystal structure of the large ribosomal subunit from  ...
4kbu:4*-----------------------------------------------------------------×8  70s ribosome translocation intermediate gdpnp-ii containing  ...
1vs6:Z*-----------------------------------------------------------------×22 Crystal structure of the bacterial ribosome from  ...
2wdi:4*-----------------------------------------------------------------×14 Structure of the thermus thermophilus 70s ribosome in  ...
3oh5:4*-----------------------------------------------------------------×8  Structure of the thermus thermophilus 70s ribosome  ...
2wh4:4*-----------------------------------------------------------------×18 Insights into translational termination from the structure  ...
3bbo:1 -----------------------------------------------------------------    Homology model for the spinach chloroplast 50s subunit  ...
4her:A advfhlgltkamldgatlaivpgdpervkriaelmdnatflashreytsylayadgkpvvicstg    X-ray structure of uridine phosphorylase from shewanella  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q72JR0 ----------------------------------------------------mkegihpkl-vpa    50S ribosomal protein L31 OS=Thermus thermophilus (strain  ...
2hgj:3*----------------------------------------------------mkegihpkl-vpa×8  Crystal structure of the 70s thermus thermophilus ribosome  ...
3tve:4*----------------------------------------------------mkegihpkl-vpa×8  Crystal structure analysis of ribosomal decoding. This  ...
3tvh:4*----------------------------------------------------mkegihpkl-vpa×8  Crystal structure analysis of ribosomal decoding. This  ...
2wrj:4*----------------------------------------------------mkegihpkl-vpa×8  The structure of the ribosome with elongation factor g  ...
2xtg:4*----------------------------------------------------mkegihpkl-vpa×6  tRNA tranlocation on the 70s ribosome: the        pre-  ...
2xg0:4*------------------------------------------------------egihpkl-vpa×2  Structure of cytotoxic domain of colicin e3 bound to the  ...
2j01:4*----------------------------------------------------mkegihpkl-vpa×5  Structure of the thermus thermophilus 70s ribosome  ...
3knm:4*--------------------------------------------------------------vpa×2  The structures of capreomycin bound to the 70s ribosome.  ...
3uxq:4*----------------------------------------------------mkegihpkl-vpa×10 The structure of thermorubin in complex with the 70s  ...
2wro:4*-------------------------------------------------------gihpkl-vpa×4  The crystal structure of the 70s ribosome bound to ef-tu  ...
2xqe:4*-------------------------------------------------------gihpkl-vpa×9  The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
4ejc:4 ----------------------------------------------------mkegihpkl-vpa    Crystal structure of the bacterial ribosome ram mutation  ...
1kc9:Y*----------------------------------------------------mqkdlhpka-vpc×19 Crystal structure of the large ribosomal subunit from  ...
4kbu:4*----------------------------------------------------mkegihpkl-vpa×8  70s ribosome translocation intermediate gdpnp-ii containing  ...
1vs6:Z*----------------------------------------------------mkkdihpky-eei×22 Crystal structure of the bacterial ribosome from  ...
2wdi:4*--------------------------------------------------------------vpa×14 Structure of the thermus thermophilus 70s ribosome in  ...
3oh5:4*----------------------------------------------------mkegihpkl-vpa×8  Structure of the thermus thermophilus 70s ribosome  ...
2wh4:4*--------------------------------------------------------------vpa×18 Insights into translational termination from the structure  ...
3bbo:1 -----------------------------------------------------kkelhpefheda    Homology model for the spinach chloroplast 50s subunit  ...
4her:A iggpstsiaveelaqlgvntflrvgttgaiqphvnvgdvivtqasvrldgaslhfapmefp-ava    X-ray structure of uridine phosphorylase from shewanella  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q72JR0 riicgcgnvietyst-kpeiyvevcskchpfytgqqr--fvdtegrverfqrrygdsyrkgr---    50S ribosomal protein L31 OS=Thermus thermophilus (strain  ...
2hgj:3*riicgcgnvietyst-kpeiyvevcskchpfytgqqr--fvdtegrverfqrrygdsyrkgr---×8  Crystal structure of the 70s thermus thermophilus ribosome  ...
3tve:4*riicgcgnvietyst-kpeiyvevcskchpfytgqqr--fvdtegrverfqrrygds--------×8  Crystal structure analysis of ribosomal decoding. This  ...
3tvh:4*riicgcgnvietyst-kpeiyvevcskchpfytgqqr--fvdtegrverfqrry-----------×8  Crystal structure analysis of ribosomal decoding. This  ...
2wrj:4*riicgcgnvietyst-kpeiyvevcskchpfytgqqr--fvdtegrver----------------×8  The structure of the ribosome with elongation factor g  ...
2xtg:4*riicgcgnvietyst-kpeiyvevcskchpfytgqqr--fvdtegrve-----------------×6  tRNA tranlocation on the 70s ribosome: the        pre-  ...
2xg0:4*riicgcgnvietyst-kpeiyvevcskchpfytgqqr--fvdtegrver----------------×2  Structure of cytotoxic domain of colicin e3 bound to the  ...
2j01:4*riicgcgnvietyst-kpeiyvevcskchpfytgqqr--fv------------------------×5  Structure of the thermus thermophilus 70s ribosome  ...
3knm:4*riicgcgnvietyst-kpeiyvevcskchpfy--qqr--fvdtegrverfq--------------×2  The structures of capreomycin bound to the 70s ribosome.  ...
3uxq:4*riicgcgnvietyst-kpeiyvevcskchpfytgq------------------------------×10 The structure of thermorubin in complex with the 70s  ...
2wro:4*riicgcgnvietyst-kpeiyvevcskchpfytgqqr----------------------------×4  The crystal structure of the 70s ribosome bound to ef-tu  ...
2xqe:4*riicgcgnvietyst-kpeiyvevcskchpfytgqq-----------------------------×9  The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
4ejc:4 riicgcgnvietyst-kpeiyvevcskch------------------------------------    Crystal structure of the bacterial ribosome ram mutation  ...
1kc9:Y*kiiyqgqvvmetmst-rpeihvdvwsgvhpfwtgeer--fldtegrvdkfnkrfgdsyrrgskk-×19 Crystal structure of the large ribosomal subunit from  ...
4kbu:4*riicgcgnvietyst-kpeiyvev-----------------------------------------×8  70s ribosome translocation intermediate gdpnp-ii containing  ...
1vs6:Z*tascscgnvmkirstvghdlnldvcskchpfftgkqr--dvatggrvdrfnkrfnipgsk-----×22 Crystal structure of the bacterial ribosome from  ...
2wdi:4*riicgcgnvietyst-kpeiyvevcskch------------------------------------×14 Structure of the thermus thermophilus 70s ribosome in  ...
3oh5:4*riicgcgnvietyst-kpeiy--------------------------------------------×8  Structure of the thermus thermophilus 70s ribosome  ...
2wh4:4*riicgcgnvietyst-kpeiyvevcskc-------------------------------------×18 Insights into translational termination from the structure  ...
3bbo:1 kvycngelvmttggt-kkeyvvdvwsgnhpfylgnrsalmvdad-qvekfrkrfaglseime---    Homology model for the spinach chloroplast 50s subunit  ...
4her:A nfecttamvaacrda-gvephigvtassdtfypgqer--ydtvtgrvtr---rfagsmkewqdmg    X-ray structure of uridine phosphorylase from shewanella  ...

           2         2         2         2         2         2
           0         1         2         3         4         5
       6789012345678901234567890123456789012345678901234567890              Protein name
       ----+---------+---------+---------+---------+---------+              ------------
Q72JR0 -------------------------------------------------------              50S ribosomal protein L31 OS=Thermus thermophilus (strain  ...
2hgj:3*-------------------------------------------------------          ×8  Crystal structure of the 70s thermus thermophilus ribosome  ...
3tve:4*-------------------------------------------------------          ×8  Crystal structure analysis of ribosomal decoding. This  ...
3tvh:4*-------------------------------------------------------          ×8  Crystal structure analysis of ribosomal decoding. This  ...
2wrj:4*-------------------------------------------------------          ×8  The structure of the ribosome with elongation factor g  ...
2xtg:4*-------------------------------------------------------          ×6  tRNA tranlocation on the 70s ribosome: the        pre-  ...
2xg0:4*-------------------------------------------------------          ×2  Structure of cytotoxic domain of colicin e3 bound to the  ...
2j01:4*-------------------------------------------------------          ×5  Structure of the thermus thermophilus 70s ribosome  ...
3knm:4*-------------------------------------------------------          ×2  The structures of capreomycin bound to the 70s ribosome.  ...
3uxq:4*-------------------------------------------------------          ×10 The structure of thermorubin in complex with the 70s  ...
2wro:4*-------------------------------------------------------          ×4  The crystal structure of the 70s ribosome bound to ef-tu  ...
2xqe:4*-------------------------------------------------------          ×9  The structure of ef-tu and aminoacyl-tRNA bound to the 70s  ...
4ejc:4 -------------------------------------------------------              Crystal structure of the bacterial ribosome ram mutation  ...
1kc9:Y*-------------------------------------------------------          ×19 Crystal structure of the large ribosomal subunit from  ...
4kbu:4*-------------------------------------------------------          ×8  70s ribosome translocation intermediate gdpnp-ii containing  ...
1vs6:Z*-------------------------------------------------------          ×22 Crystal structure of the bacterial ribosome from  ...
2wdi:4*-------------------------------------------------------          ×14 Structure of the thermus thermophilus 70s ribosome in  ...
3oh5:4*-------------------------------------------------------          ×8  Structure of the thermus thermophilus 70s ribosome  ...
2wh4:4*-------------------------------------------------------          ×18 Insights into translational termination from the structure  ...
3bbo:1 -------------------------------------------------------              Homology model for the spinach chloroplast 50s subunit  ...
4her:A vlnyemesatlftmcatqgwraacvagvivnrtqqeipevsavsivvaaakklla              X-ray structure of uridine phosphorylase from shewanella  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q72JR0. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 71 - - Q72JR0 50S ribosomal protein L31 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpmE PE=1 SV=2
2. 505 100.0% 71 71 687.9 2.4e-31 2hgj:3 * Crystal structure of the 70s thermus thermophilus ribosome s the 16s 3'-end mimicks mRNA e and p codons. This entry 2hgj 50s ribosomal subunit. The 30s ribosomal subunit can be fou entry 2hgi.
3. " " " " " "  = 2hgq:3 *
Crystal structure of the 70s thermus thermophilus ribosome w translocated and rotated shine-dalgarno duplex. This entry contains 50s ribosomal subunit. The 30s ribosomal subunit c found in PDB entry 2hgp.
4. " " " " " "  = 2hgu:3 *
70s t.Th. Ribosome functional complex with mRNA and e- and p trnas at 4.5a. This entry 2hgu contains 50s ribosomal subun 30s ribosomal subunit can be found in PDB entry 2hgr.
5. " " " " " "  = 3i8f:4 *
Elongation complex of the 70s ribosome with three trnas and entry 3i8f contains 50s ribosomal subunit. The 30s ribosoma can be found in PDB entry 3i8g. Molecule b in the same asym unit is deposited as 3i8g (30s) and 3i8f (50s).
6. " " " " " "  = 3i8i:4 *
Elongation complex of the 70s ribosome with three trnas and entry 3i8i contains 50s ribosomal subnit. The 30s ribosomal can be found in PDB entry 3i8h. Molecule a in the same asym unit is deposited as 3i8f (50s) and 3i8g (30s).
7. " " " " " "  = 3i9c:4 *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9c contains 50s ribosomal subunit of molecule b. The 30s subunit can be found in PDB entry 3i9b. Molecule a in the s asymmetric unit is deposited as 3i9d (30s) and 3i9e (50s)
8. " " " " " "  = 3i9e:4 *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9e contains 50s ribosomal subunit of molecule a. The 30s subunit can be found in PDB entry 3i9d. Molecule b in the s asymmetric unit is deposited as 3i9b (30s) and 3i9c (50s)
9. " " " " " "  = 4btd:4 *
Thermus thermophilus ribosome
10. 469 100.0% 66 66 640.3 1.1e-28 3tve:4 * Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-leu complex
11. " " " " " "  = 3uye:4 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
12. " " " " " "  = 3uz1:4 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex with paromomycin
13. " " " " " "  = 3uz9:4 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-tyr complex.
14. " " " " " "  = 3uzf:4 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex
15. " " " " " "  = 3uzk:4 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex with paromomycin
16. " " " " " "  = 4g5l:4 *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule a.
17. " " " " " "  = 4g5u:4 *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule a.
18. 448 100.0% 63 63 612.6 3.7e-27 3tvh:4 * Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-leu complex
19. " " " " " "  = 3uyg:4 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
20. " " " " " "  = 3uz2:4 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-leu complex with paromomycin.
21. " " " " " "  = 3uz8:4 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-tyr complex.
22. " " " " " "  = 3uzh:4 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex.
23. " " " " " "  = 3uzn:4 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex with paromomycin
24. " " " " " "  = 4g5n:4 *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule b.
25. " " " " " "  = 4g5w:4 *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule b.
26. 411 100.0% 58 58 563.7 2e-24 2wrj:4 * The structure of the ribosome with elongation factor g trapped in the post-translocational state (part 2 of 4).
27. " " " " " "  = 2wrl:4 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state. (Part 4 of 4).
28. " " " " " "  = 3zn9:4 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
29. " " " " " "  = 3zne:4 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
30. " " " " " "  = 4b8g:4 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
31. " " " " " "  = 4b8i:4 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
32. " " " " " "  = 4byc:4 *
Structure of thermus thermophilus 50s ribosome
33. " " " " " "  = 4bye:4 *
Structure of thermus thermophilus 50s ribosome
34. 404 100.0% 57 57 554.5 6.5e-24 2xtg:4 * tRNA tranlocation on the 70s ribosome: the pre- translocational translocation intermediate ti(pre)
35. " " " " " "  = 2xux:4 *
tRNA translocation on the 70s ribosome: the post- translocational translocation intermediate ti(post)
36. " " " " " "  = 3kir:4 *
Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 2 of 4)
37. " " " " " "  = 3kit:4 *
Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 4 of 4)
38. " " " " " "  = 3kiw:4 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 2 of 4)
39. " " " " " "  = 3kiy:4 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 4 of 4)
40. 398 100.0% 56 56 546.6 1.8e-23 2xg0:4 * Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 2 of 4)
41. " " " " " "  = 2xg2:4 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 4 of 4)
42. 359 100.0% 50 50 495.2 1.3e-20 2j01:4 * Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 2 of 4). This file contains the 50s subunit from molecule i.
43. " " " " " "  = 2j03:4 *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50s subunit from molecule ii.
44. " " " " " "  = 2v47:4 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 2 of 4). This file contains the 50s subunit for molecule 1.
45. " " " " " "  = 2v49:4 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 4 of 4). This file contains the 50s subunit of molecule 2.
46. " " " " " "  = 3fin:4 *
T. Thermophilus 70s ribosome in complex with mRNA, trnas and tu.Gdp.Kirromycin ternary complex, fitted to a 6.4 a cryo-e this file contains the 50s subunit.
47. 336 96.1% 51 49 464.6 6.5e-19 3knm:4 * The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule i.
48. " " " " " "  = 3kno:4 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule ii
49. 332 100.0% 46 46 459.6 1.2e-18 3uxq:4 * The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
50. " " " " " "  = 3uxr:4 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
51. " " " " " "  = 3v23:4 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
52. " " " " " "  = 3v25:4 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 2nd ribosom asu
53. " " " " " "  = 3v27:4 *
Crystal structure of hpf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
54. " " " " " "  = 3v29:4 *
Crystal structure of hpf bound to the 70s ribosome. This ent contains the 50s subunit of the 2nd molecule in the asu.
55. " " " " " "  = 3v2d:4 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 1st ribosom asu
56. " " " " " "  = 3v2f:4 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 2nd ribosom asu
57. " " " " " "  = 4dha:4 *
Crystal structure of yaej bound to the 70s ribosome
58. " " " " " "  = 4dhc:4 *
Crystal structure of yaej bound to the 70s ribosome
59. 327 100.0% 45 45 453.1 2.9e-18 2wro:4 * The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 2 of 4).
60. " " " " " "  = 2wrr:4 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 4 of 4).
61. " " " " " "  = 3zvp:4 *
Crystal structure of the hybrid state of ribosome in complex the guanosine triphosphatase release factor 3
62. " " " " " "  = 4abs:4 *
Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin w 70s ribosome
63. 320 100.0% 44 44 443.9 9.4e-18 2xqe:4 * The structure of ef-tu and aminoacyl-tRNA bound to the 70s ribosome with a gtp analog
64. " " " " " "  = 2y0v:4 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
65. " " " " " "  = 2y0x:4 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
66. " " " " " "  = 2y0z:4 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
67. " " " " " "  = 2y11:4 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
68. " " " " " "  = 2y13:4 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
69. " " " " " "  = 2y15:4 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a cognate codon on the 70s ribosome.
70. " " " " " "  = 2y17:4 *
Ef-tu complex 3
71. " " " " " "  = 2y19:4 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
72. 286 100.0% 40 40 399.0 2.9e-15 4ejc:4 Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit.
73. 288 57.1% 70 73 398.6 3.1e-15 1kc9:Y * Crystal structure of the large ribosomal subunit from deinococcus radiodurans
74. " " " " " "  = 1kpj:Y *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
75. " " " " " "  = 1lnr:Y *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
76. " " " " " "  = 1nkw:Y *
Crystal structure of the large ribosomal subunit from deinococcus radiodurans
77. " " " " " "  = 1nwx:Y *
Complex of the large ribosomal subunit from deinococcus radiodurans with abt-773
78. " " " " " "  = 1nwy:Y *
Complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin
79. " " " " " "  = 1pnu:Y *
Crystal structure of a streptomycin dependent ribosome from escherichia coli, 50s subunit of 70s ribosome. This file, 1pnu, contains only molecules of the 50s ribosomal subunit. The 30s subunit, mRNA, p-site tRNA, and a-site tRNA are in the PDB file 1pns.
80. " " " " " "  = 1pny:Y *
Crystal structure of the wild type ribosome from e. Coli, 50s subunit of 70s ribosome. This file, 1pny, contains only molecules of the 50s ribosomal subunit. The 30s subunit is in the PDB file 1pnx.
81. " " " " " "  = 1sm1:Y *
Complex of the large ribosomal subunit from deinococcus radi with quinupristin and dalfopristin
82. " " " " " "  = 1vor:1 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
83. " " " " " "  = 1vou:1 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
84. " " " " " "  = 1vow:1 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
85. " " " " " "  = 1voy:1 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
86. " " " " " "  = 1vp0:1 *
Crystal structure of five 70s ribosomes from escherichia coli in complex with protein y. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains five 70s ribosomes and is described in remark 400.
87. " " " " " "  = 1xbp:Y *
Inhibition of peptide bond formation by pleuromutilins: the structure of the 50s ribosomal subunit from deinococcus radiodurans in complex with tiamulin
88. " " " " " "  = 1yl3:4 *
Crystal structure of 70s ribosome with thrs operator and trn subunit. The coordinates for the small subunit are in the p 1yl4.
89. " " " " " "  = 2b66:4 *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400
90. " " " " " "  = 2b9n:4 *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400.
91. " " " " " "  = 2b9p:4 *
50s ribosomal subunit from a crystal structure of the riboso complex with trnas and mRNA with a stop codon in the a-site file contains the 50s subunit from a crystal structure of t ribosome in complex with trnas and mRNA with a stop codon i site and is described in remark 400.
92. 239 100.0% 35 35 337.1 8.3e-12 4kbu:4 * 70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit a. The full asymmetric unit contains PDB entries 4kbt (30s subunit a), 4kbv (30s subuni 4kbw (50s subunit b).
93. " " " " " "  = 4kbw:4 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit b. The full asymmetric unit contains PDB entries 4kbv (30s subunit b), 4kbt (30s subuni 4kbu (50s subunit a).
94. " " " " " "  = 4kcz:4 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state.T contains the 50s ribosomal subunit a. The 30s subunit a can in 4kcy. Molecule b in the same asymmetric unit is deposite (30s) and 4kd2 (50s).G1 50s ribosomal subunit i
95. " " " " " "  = 4kd2:4 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains the 50s ribosomal subunit b. The 30s subunit b can in 4kd0. Molecule a in the same asymmetric unit is deposite (30s) and 4kcz (50s).
96. " " " " " "  = 4kd9:4 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kd8. Molecule b in the same asymmetric uni deposited as 4kda (30s) and 4kdb (50s).
97. " " " " " "  = 4kdb:4 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kda. Molecule a in the same asymmetric uni deposited as 4kd8 (30s) and 4kd9 (50s).
98. " " " " " "  = 4kdh:4 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kdg. Molecule b in the same asymmetric uni deposited as 4kdj (30s) and 4kdk (50s).
99. " " " " " "  = 4kdk:4 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kdj. Molecule a in the same asymmetric uni deposited as 4kdg (30s) and 4kdh (50s).
100. 233 51.6% 64 70 325.5 3.6e-11 1vs6:Z * Crystal structure of the bacterial ribosome from escherichia coli in complex with the antibiotic kasugamyin at 3.5a resolution. This file contains the 50s subunit of one 70s ribosome. The entire crystal structure contains two 70s ribosomes and is described in remark 400.
101. " " " " " "  = 1vs8:Z *
Crystal structure of the bacterial ribosome from escherichia complex with the antibiotic kasugamyin at 3.5a resolution. Contains the 50s subunit of one 70s ribosome. The entire cr structure contains two 70s ribosomes and is described in re
102. " " " " " "  = 2aw4:Z *
Crystal structure of the bacterial ribosome from escherichia 3.5 a resolution. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib is described in remark 400.
103. " " " " " "  = 2awb:Z *
Crystal structure of the bacterial ribosome from escherichia 3.5 a resolution. This file contains the 50s subunit of the 70s ribosome. The entire crystal structure contains two 70s and is described in remark 400.
104. " " " " " "  = 2j28:Z *
Model of e. Coli srp bound to 70s rncs
105. " " " " " "  = 2rdo:Z *
50s subunit with ef-g(gdpnp) and rrf bound
106. " " " " " "  = 2vhm:Z *
Structure of pdf binding helix in complex with the ribosome (part 1 of 4)
107. " " " " " "  = 2vhn:Z *
Structure of pdf binding helix in complex with the ribosome. (Part 2 of 4)
108. " " " " " "  = 3bbx:Z *
The hsp15 protein fitted into the low resolution cryo-em map 50s.Nc-tRNA.Hsp15 complex
109. " " " " " "  = 3e1b:S *
Structure of the 50s subunit of e. Coli ribosome in pre-acco state
110. " " " " " "  = 3e1d:S *
Structure of the 50s subunit of e. Coli ribosome in post-acc state
111. " " " " " "  = 3iyx:A *
Coordinates of the b1b bridge-forming protein structures fit the cryo-em map of e.Coli 70s ribosome (emd-1056)
112. " " " " " "  = 3iyy:A *
Coordinates of the b1b bridge-forming protein structures fit the cryo-em map of efg.Gdpnp-bound e.Coli 70s ribosome(emd-
113. " " " " " "  = 3izt:b *
Structural insights into cognate vs. Near-cognate discrimina during decoding. This entry contains the large subunit of a programmed with a near-cognate codon.
114. " " " " " "  = 3izu:b *
Structural insights into cognate vs. Near-cognate discrimina during decoding. This entry contains the large subunit of a programmed with a cognate codon
115. " " " " " "  = 3j0t:2 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class2 of the six classes)
116. " " " " " "  = 3j0w:2 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 4a of the six classes)
117. " " " " " "  = 3j0y:2 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 4b of the six classes)
118. " " " " " "  = 3j11:2 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 3 of the six classes)
119. " " " " " "  = 3j12:2 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 5 of the six classes)
120. " " " " " "  = 3j14:2 *
Structural characterization of mRNA-tRNA translocation inter (50s ribosome of class 6 of the six classes)
121. " " " " " "  = 3j37:4 *
Tetracycline resistance protein tet(o) bound to the ribosome
122. 223 100.0% 31 31 316.4 1.2e-10 2wdi:4 * Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule i.
123. " " " " " "  = 2wdj:4 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule ii.
124. " " " " " "  = 2wdl:4 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule i.
125. " " " " " "  = 2wdn:4 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule ii.
126. " " " " " "  = 2wh2:4 *
Insights into translational termination from the structure of rf2 bound to the ribosome
127. " " " " " "  = 2x9s:4 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
128. " " " " " "  = 2x9u:4 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
129. " " " " " "  = 3hux:4 *
Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule i.
130. " " " " " "  = 3huz:4 *
Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule ii.
131. " " " " " "  = 3kni:4 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule i
132. " " " " " "  = 3knk:4 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule ii.
133. " " " " " "  = 3v6w:4 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit
134. " " " " " "  = 3v6x:4 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit
135. " " " " " "  = 4ejb:4 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit.
136. 223 100.0% 32 32 316.2 1.2e-10 3oh5:4 * Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
137. " " " " " "  = 3oh7:4 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
138. " " " " " "  = 3ohj:4 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
139. " " " " " "  = 3ohk:4 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
140. " " " " " "  = 3ohz:4 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
141. " " " " " "  = 3oi1:4 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
142. " " " " " "  = 3oi3:4 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
143. " " " " " "  = 3oi5:4 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
144. 213 100.0% 30 30 303.2 6.4e-10 2wh4:4 * Insights into translational termination from the structure of rf2 bound to the ribosome
145. " " " " " "  = 3d5b:4 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of one 70s ribosome. The enti structure contains two 70s ribosomes as described in remark
146. " " " " " "  = 3d5d:4 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of the second 70s ribosome. T crystal structure contains two 70s ribosomes as described i 400.
147. " " " " " "  = 3f1f:4 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of o ribosome. The entire crystal structure contains two 70s rib described in remark 400.
148. " " " " " "  = 3f1h:4 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of t 70s ribosome. The entire crystal structure contains two 70s as described in remark 400.
149. " " " " " "  = 3mrz:1 *
Recognition of the amber stop codon by release factor rf1. T 3mrz contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3ms0. Molecule a in the same asymmetric deposited as 3mr8 (50s) and 3ms1 (30s).
150. " " " " " "  = 3ms1:1 *
Recognition of the amber stop codon by release factor rf1. T 3ms1 contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3mr8. Molecule b in the same asymmetric deposited as 3mrz (50s) and 3ms0 (30s).
151. " " " " " "  = 3pyo:1 *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the first 70s ribosome.
152. " " " " " "  = 3pyr:1 *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the second 70s ribosome.
153. " " " " " "  = 3pyt:1 *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the first 70s ribosome.
154. " " " " " "  = 3pyv:1 *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the second 70s ribosome.
155. " " " " " "  = 4jux:4 *
Crystal structure of the ribosome bound to elongation factor guanosine triphosphatase state (this file contains the 50s
156. " " " " " "  = 4k0m:4 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
157. " " " " " "  = 4k0q:4 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
158. " " " " " "  = 4kfi:4 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the a subunit
159. " " " " " "  = 4kfl:4 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the b subunit
160. " " " " " "  = 4l6j:1 *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the first 70s ribosome.
161. " " " " " "  = 4l6l:1 *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the second 70s ribosome
162. 126 36.9% 65 72 182.8 0.0032 3bbo:1 Homology model for the spinach chloroplast 50s subunit fitte cryo-em map of the 70s chlororibosome
163. 78 27.8% 54 243 112.6 26 4her:A X-ray structure of uridine phosphorylase from shewanella one mr-1 in complex with uridine at 1.6 a resolution

Number of sequences: 163

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 78 27.8% 54 247 112.5 27 4hen:A X-ray structure of uridine phosphorylase from shewanella one mr-1 at 0.95 a resolution
2. 71 40.0% 35 66 110.0 37 3j21:V * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
3. " " " " " "  = 3j44:V *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
4. 75 30.6% 49 191 109.9 38 3fdf:A Crystal structure of the serine phosphatase of RNA polymerase ii ctd (ssu72 superfamily) from drosophila melanogaster. Orthorhombic crystal form. Northeast structural genomics consortium target fr253.
5. 75 30.6% 49 190 109.9 38 3fmv:A * Crystal structure of the serine phosphatase of RNA polymerase ii ctd (ssu72 superfamily) from drosophila melanogaster. Monoclinic crystal form. Northeast structural genomics consortium target fr253.
6. " " " " " "  = 3omw:A *
Crystal structure of ssu72, an essential eukaryotic phosphat specific for thE C-terminal domain of RNA polymerase ii
7. " " " " " "  = 3omx:A *
Crystal structure of ssu72 with vanadate complex
8. 75 30.6% 49 190 109.9 38 4imj:B Novel modifications on c-terminal domain of RNA polymerase i fine-tune the phosphatase activity of ssu72
9. 75 30.6% 49 192 109.8 38 4imi:B Novel modifications on c-terminal domain of RNA polymerase i fine- tune the phosphatase activity of ssu72.
10. 75 30.6% 49 198 109.7 39 3p9y:A Crystal structure of the drosophila melanogaster ssu72-pctd
11. 73 32.2% 59 135 109.0 42 3sum:A Crystal structure of cerato-platanin 5 from m. Perniciosa (m
12. 73 35.7% 42 168 107.8 49 2d0w:A Crystal structure of cytochrome cl from hyphomicrobium denitrificans

Number of sequences: 12

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer