spacer
spacer

SAS results for UniProt accession no. P18138

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P18138 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P18138 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 34 unique sequences (including 12 consensus sequences) giving 115 sequence matches in all. The 18 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P18138 -----------------------------------------------------------------    50S ribosomal protein L31e OS=Haloarcula marismortui  ...
4hub:X -----------------------------------------------------------------    The re-refined crystal structure of the haloarcula  ...
1ffk:U -----------------------------------------------------------------    Crystal structure of the large ribosomal subunit from  ...
1w2b:W -----------------------------------------------------------------    Trigger factor ribosome binding domain in complex with 50s
1jj2:W*-----------------------------------------------------------------×65 Fully refined crystal structure of the haloarcula  ...
3j21:a -----------------------------------------------------------------    Promiscuous behavior of proteins in archaeal ribosomes  ...
3j44:a -----------------------------------------------------------------    Structure of the methanococcus jannaschii  ...
2zkr:x -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:d -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
1k5y:W*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:W -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
2ww9:M*-----------------------------------------------------------------×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
3o58:a*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3j39:d -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3u5e:d*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:g*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3zf7:h mtragfkgkvlgkekklallearkkaaearksrddrrwkrvlakmdpekrkkyhgvgntaehsrv    High-resolution cryo-electron microscopy structure of the  ...
2go5:6*-----------------------------------------------------------------×2  Structure of signal recognition particle receptor (sr) in  ...
4a17:W*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
1xex:A --------------------------pyieklelkgfksygnkkvvipfskgftaivgangsgks    Structural biochemistry of atp-driven dimerization and DNA  ...
4i99:A --------------------------pyieklelkgfksygnkkvvipfskgftaivgangsgks    Crystal structure of the smchead bound to thE C-winged  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P18138 -------------msasdfeervvtiplrdara-epnhkradkamilirehla-khfsvdedav-    50S ribosomal protein L31e OS=Haloarcula marismortui  ...
4hub:X ---------------asdfeervvtiplrdara-epnhkradkamilirehla-khfsvdedav-    The re-refined crystal structure of the haloarcula  ...
1ffk:U -----------------dfeervvtiplrdara-epnhkradkamilirehla-khfsvdedav-    Crystal structure of the large ribosomal subunit from  ...
1w2b:W --------------------ervvtiplrdara-epnhkradkamilirehla-khfsvdedav-    Trigger factor ribosome binding domain in complex with 50s
1jj2:W*--------------------ervvtiplrdara-epnhkradkamilirehla-khfsvdedav-×65 Fully refined crystal structure of the haloarcula  ...
3j21:a ----------------kageeviftvpikkikkivprwkrapravkfvrefva-rhakaqe--v-    Promiscuous behavior of proteins in archaeal ribosomes  ...
3j44:a ----------------kageeviftvpikkikkivprwkrapravkfvrefva-rhakaqe--v-    Structure of the methanococcus jannaschii  ...
2zkr:x -------------------treytinihkrihg-vgfkkrapralkeirkfam-kemgtpd--v-    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:d ---------kgrsainevvtreytinihkrihg-vgfkkrapralkeirkfam-kemgtpd--v-    Structure of the human 60s ribosomal proteins
1k5y:W*----------------dvvtreytinlhkrlhg-vsfkkrapravkeikkfak-lhmgtdd--v-×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:W -------------------treytinlhkrlhg-vsfkkrapravkeikkfak-lhmgtdd--v-    Structure of the 60s proteins for eukaryotic ribosome based  ...
2ww9:M*-------------------treytinlhkrlhg-vsfkkrapravkeikkfak-lhmgtdd--v-×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
3o58:a*-------------glkdvvtreytinlhkrlhg-vsfkkrapravkeikkfak-lhmgtdd--v-×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3j39:d --------------inevvtrectihlakrvhn-igfkkrapraikeirkfae-remgttd--v-    Structure of the d. Melanogaster 60s ribosomal proteins
3u5e:d*--------------lkdvvtreytinlhkrlhg-vsfkkrapravkeikkfak-lhmgtdd--v-×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:g*-----------maglkdvvtreytinlhkrlhg-vsfkkrapravkeikkfak-lhmgtdd--v-×2  Localization of the large subunit ribosomal proteins into a  ...
3zf7:h rgctraslfkrtgrkpdnivmeasihlskllkk-rtfhkrapiaikrirsfvg-klmktkdn---    High-resolution cryo-electron microscopy structure of the  ...
2go5:6*-------------------treytvnlhkrlhg-ctfkkkapnaikeirkfaq-kamgtnd--v-×2  Structure of signal recognition particle receptor (sr) in  ...
4a17:W*-------------vkqeeksidttvnlhkqchk-isfkkkapra---ireivaiakktmgtddv-×4  T.Thermophila 60s ribosomal subunit in complex with  ...
1xex:A nigdailfvlgglsakamrasrisdlifagskn-eppakyaevaiyfnned---rgfpidedevv    Structural biochemistry of atp-driven dimerization and DNA  ...
4i99:A nigdailfvlgglsakamrasrisdlifagskn-eppakyaevaiyfnned---rgfpidedevv    Crystal structure of the smchead bound to thE C-winged  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P18138 ---rldpsineaawargrantpskir--vraarf--ee--egeaiveaetae-------------    50S ribosomal protein L31e OS=Haloarcula marismortui  ...
4hub:X ---rldpsineaawargrantpskir--vraarf--ee--egeaiveaetae-------------    The re-refined crystal structure of the haloarcula  ...
1ffk:U ---rldpsineaawargrantpskir--vraarf--ee--egeaiveae----------------    Crystal structure of the large ribosomal subunit from  ...
1w2b:W ---rldpsineaawargrantpskir--vraarf--ee--egeaiveaet---------------    Trigger factor ribosome binding domain in complex with 50s
1jj2:W*---rldpsineaawargrantpskir--vraarf--ee--egeaiveae----------------×65 Fully refined crystal structure of the haloarcula  ...
3j21:a ---iidpkvnekiwergiekppsklr--vkvkve--eekregeetvriayvt-------------    Promiscuous behavior of proteins in archaeal ribosomes  ...
3j44:a ---iidpkvnekiwergiekppsklr--vkvkve--tv--riayvt-------------------    Structure of the methanococcus jannaschii  ...
2zkr:x ---ridtrlnkavwakgirnvpyrir--vrlsrk--rn--ededspnk-----------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:d ---ridtrlnkavwakgirnvpyrir--vrlsrk--rn--ededspnklytlvtyvpvttfknlq    Structure of the human 60s ribosomal proteins
1k5y:W*---rlapelnqaiwkrgvkgveyrlr--lrisrk--rn--eee----------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:W ---rlapelnqaiwkrgvkgveyrlr--lrisrk--rn--eeedakn------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
2ww9:M*---rlapelnqaiwkrgvkgveyrlr--lrisrk--rn--eeedaknplfsy-------------×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
3o58:a*---rlapelnqaiwkrgvkgveyrlr--lrisrk--rn--eeedaknp-----------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3j39:d ---ridtrlnkhiwskgirstpfrir--vrlarr--rn--ddedspnklytyvtyvpvstfknlq    Structure of the d. Melanogaster 60s ribosomal proteins
3u5e:d*---rlapelnqaiwkrgvkgveyrlr--lrisrk--rn--eeedaknplfsyvepvlvasakglq×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:g*---rlapelnqaiwkrgvkgveyrlr--lrisrk--rn--eeedaknplfsyvepvlvasakglq×2  Localization of the large subunit ribosomal proteins into a  ...
3zf7:h ---ridaslntfiwhkgvkgvpgrvr--vrverk--se--tmeggkrkhfytvishipvpsfknl    High-resolution cryo-electron microscopy structure of the  ...
2go5:6*---ridvklnkhiwssgirsvprrvr--vriark--rn--deedakeel----------------×2  Structure of signal recognition particle receptor (sr) in  ...
4a17:W*---ridtelnkfiwsngirniprrvr--vrlckrknee--egaqsqfytlvqhlqvdsyhgllte×4  T.Thermophila 60s ribosomal subunit in complex with  ...
1xex:A irrrvypdgrssywlngrratrseildiltaami--sp--dgynivlqgditkfikmsplerrll    Structural biochemistry of atp-driven dimerization and DNA  ...
4i99:A irrrvypdgrssywlngrratrseildiltaami--sp--dgynivlqgditkfikmsplerrll    Crystal structure of the smchead bound to thE C-winged  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P18138 -----------------------------------------------------------------    50S ribosomal protein L31e OS=Haloarcula marismortui  ...
4hub:X -----------------------------------------------------------------    The re-refined crystal structure of the haloarcula  ...
1ffk:U -----------------------------------------------------------------    Crystal structure of the large ribosomal subunit from  ...
1w2b:W -----------------------------------------------------------------    Trigger factor ribosome binding domain in complex with 50s
1jj2:W*-----------------------------------------------------------------×65 Fully refined crystal structure of the haloarcula  ...
3j21:a -----------------------------------------------------------------    Promiscuous behavior of proteins in archaeal ribosomes  ...
3j44:a -----------------------------------------------------------------    Structure of the methanococcus jannaschii  ...
2zkr:x -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:d tvnvde-----------------------------------------------------------    Structure of the human 60s ribosomal proteins
1k5y:W*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:W -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
2ww9:M*-----------------------------------------------------------------×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
3o58:a*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3j39:d tenvessdd--------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3u5e:d*tvvveed----------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:g*tvvve------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3zf7:h ttkvieq----------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
2go5:6*-----------------------------------------------------------------×2  Structure of signal recognition particle receptor (sr) in  ...
4a17:W*ktkae------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
1xex:A iddis------------------------------------------------------------    Structural biochemistry of atp-driven dimerization and DNA  ...
4i99:A iddisgikekknvfmrtfeaisrnfseifaklspggsarlilenpedpfsggleieakpagkdvk    Crystal structure of the smchead bound to thE C-winged  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P18138 -----------------------------------------------------------------    50S ribosomal protein L31e OS=Haloarcula marismortui  ...
4hub:X -----------------------------------------------------------------    The re-refined crystal structure of the haloarcula  ...
1ffk:U -----------------------------------------------------------------    Crystal structure of the large ribosomal subunit from  ...
1w2b:W -----------------------------------------------------------------    Trigger factor ribosome binding domain in complex with 50s
1jj2:W*-----------------------------------------------------------------×65 Fully refined crystal structure of the haloarcula  ...
3j21:a -----------------------------------------------------------------    Promiscuous behavior of proteins in archaeal ribosomes  ...
3j44:a -----------------------------------------------------------------    Structure of the methanococcus jannaschii  ...
2zkr:x -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:d -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
1k5y:W*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:W -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
2ww9:M*-----------------------------------------------------------------×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
3o58:a*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3j39:d -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3u5e:d*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:g*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3zf7:h -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
2go5:6*-----------------------------------------------------------------×2  Structure of signal recognition particle receptor (sr) in  ...
4a17:W*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
1xex:A -----------------------------------------------------------------    Structural biochemistry of atp-driven dimerization and DNA  ...
4i99:A rieamsggekaltalafvfaiqkfkpapfylfdeidahlddanvkrvadlikesskesqfivitl    Crystal structure of the smchead bound to thE C-winged  ...

           3         3         3       
           3         4         5       
       67890123456789012345678901234567                                     Protein name
       ----+---------+---------+-------                                     ------------
P18138 --------------------------------                                     50S ribosomal protein L31e OS=Haloarcula marismortui  ...
4hub:X --------------------------------                                     The re-refined crystal structure of the haloarcula  ...
1ffk:U --------------------------------                                     Crystal structure of the large ribosomal subunit from  ...
1w2b:W --------------------------------                                     Trigger factor ribosome binding domain in complex with 50s
1jj2:W*--------------------------------                                 ×65 Fully refined crystal structure of the haloarcula  ...
3j21:a --------------------------------                                     Promiscuous behavior of proteins in archaeal ribosomes  ...
3j44:a --------------------------------                                     Structure of the methanococcus jannaschii  ...
2zkr:x --------------------------------                                     Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:d --------------------------------                                     Structure of the human 60s ribosomal proteins
1k5y:W*--------------------------------                                 ×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:W --------------------------------                                     Structure of the 60s proteins for eukaryotic ribosome based  ...
2ww9:M*--------------------------------                                 ×3  Cryo-em structure of the active yeast ssh1 complex bound to  ...
3o58:a*--------------------------------                                 ×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3j39:d --------------------------------                                     Structure of the d. Melanogaster 60s ribosomal proteins
3u5e:d*--------------------------------                                 ×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:g*--------------------------------                                 ×2  Localization of the large subunit ribosomal proteins into a  ...
3zf7:h --------------------------------                                     High-resolution cryo-electron microscopy structure of the  ...
2go5:6*--------------------------------                                 ×2  Structure of signal recognition particle receptor (sr) in  ...
4a17:W*--------------------------------                                 ×4  T.Thermophila 60s ribosomal subunit in complex with  ...
1xex:A --------------------------------                                     Structural biochemistry of atp-driven dimerization and DNA  ...
4i99:A rdvmmanadkiigvsmrdgvskvvslslekam                                     Crystal structure of the smchead bound to thE C-winged  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P18138. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 92 - - P18138 50S ribosomal protein L31e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl31e PE=1 SV=2
2. 575 100.0% 90 90 811.8 3e-38 4hub:X The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
3. 549 100.0% 85 85 776.1 3e-36 1ffk:U Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
4. 532 100.0% 83 83 752.6 6e-35 1w2b:W Trigger factor ribosome binding domain in complex with 50s
5. 527 100.0% 82 82 745.7 1.5e-34 1jj2:W * Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
6. " " " " " "  = 1k73:Y *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
7. " " " " " "  = 1k8a:Y *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
8. " " " " " "  = 1k9m:Y *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
9. " " " " " "  = 1kc8:Y *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
10. " " " " " "  = 1kd1:Y *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
11. " " " " " "  = 1kqs:W *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
12. " " " " " "  = 1m1k:Y *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
13. " " " " " "  = 1m90:Y *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
14. " " " " " "  = 1n8r:Y *
Structure of large ribosomal subunit in complex with virginiamycin m
15. " " " " " "  = 1nji:Y *
Structure of chloramphenicol bound to the 50s ribosomal subunit
16. " " " " " "  = 1q7y:Y *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
17. " " " " " "  = 1q81:Y *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
18. " " " " " "  = 1q82:Y *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
19. " " " " " "  = 1q86:Y *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
20. " " " " " "  = 1qvf:W *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
21. " " " " " "  = 1qvg:W *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
22. " " " " " "  = 1s72:X *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
23. " " " " " "  = 1vq4:X *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
24. " " " " " "  = 1vq5:X *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
25. " " " " " "  = 1vq6:X *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
26. " " " " " "  = 1vq7:X *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
27. " " " " " "  = 1vq8:X *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
28. " " " " " "  = 1vq9:X *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
29. " " " " " "  = 1vqk:X *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
30. " " " " " "  = 1vql:X *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
31. " " " " " "  = 1vqm:X *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
32. " " " " " "  = 1vqn:X *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1vqo:X *
The structure of ccpmn bound to the large ribosomal subunit marismortui
34. " " " " " "  = 1vqp:X *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
35. " " " " " "  = 1yhq:X *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
36. " " " " " "  = 1yi2:X *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
37. " " " " " "  = 1yij:X *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
38. " " " " " "  = 1yit:X *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
39. " " " " " "  = 1yj9:X *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
40. " " " " " "  = 1yjn:X *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
41. " " " " " "  = 1yjw:X *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
42. " " " " " "  = 2otj:X *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
43. " " " " " "  = 2otl:X *
Girodazole bound to the large subunit of haloarcula marismor
44. " " " " " "  = 2qa4:X *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
45. " " " " " "  = 2qex:X *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
46. " " " " " "  = 3cc2:X *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
47. " " " " " "  = 3cc4:X *
Co-crystal structure of anisomycin bound to the 50s ribosoma
48. " " " " " "  = 3cc7:X *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
49. " " " " " "  = 3cce:X *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
50. " " " " " "  = 3ccj:X *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
51. " " " " " "  = 3ccl:X *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
52. " " " " " "  = 3ccm:X *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
53. " " " " " "  = 3ccq:X *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
54. " " " " " "  = 3ccr:X *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
55. " " " " " "  = 3ccs:X *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
56. " " " " " "  = 3ccu:X *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
57. " " " " " "  = 3ccv:X *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
58. " " " " " "  = 3cd6:X *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
59. " " " " " "  = 3cma:X *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
60. " " " " " "  = 3cme:X *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
61. " " " " " "  = 3cpw:W *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
62. " " " " " "  = 3cxc:W *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
63. " " " " " "  = 3g4s:X *
Co-crystal structure of tiamulin bound to the large ribosoma
64. " " " " " "  = 3g6e:X *
Co-crystal structure of homoharringtonine bound to the large subunit
65. " " " " " "  = 3g71:X *
Co-crystal structure of bruceantin bound to the large riboso subunit
66. " " " " " "  = 3i55:X *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
67. " " " " " "  = 3i56:X *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
68. " " " " " "  = 3ow2:W *
Crystal structure of enhanced macrolide bound to 50s ribosom
69. " " " " " "  = 4adx:X *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
70. 186 39.8% 83 90 271.3 3.9e-08 3j21:a Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
71. 172 39.1% 69 82 252.5 4.3e-07 3j44:a Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
72. 139 40.7% 59 80 206.8 0.00015 2zkr:x Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
73. 139 40.7% 59 113 204.5 0.0002 3j3b:d Structure of the human 60s ribosomal proteins
74. 121 35.6% 59 78 182.0 0.0037 1k5y:W * Structure of the translating 80s ribosome from yeast, obtained by docking atomic models for RNA and protein components into a 15a cryo-em map. This file 1k5y contains the 60s ribosomal subunit. The file 1k5x contains the 40s ribosomal subunit, the p-site bound tRNA and the mRNA codon.
75. " " " " " "  = 1s1i:W *
Structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 a cryo-em map. This file, 1s1i, contains 60s subunit. The 40s ribosomal subunit is in file 1s1h.
76. 121 35.6% 59 79 181.9 0.0037 3jyw:W Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
77. 121 35.6% 59 84 181.5 0.0039 2ww9:M * Cryo-em structure of the active yeast ssh1 complex bound to yeast 80s ribosome
78. " " " " " "  = 2wwa:M *
Cryo-em structure of idle yeast ssh1 complex bound to the yeast 80s ribosome
79. " " " " " "  = 2wwb:M *
Cryo-em structure of the mammalian sec61 complex bound to th actively translating wheat germ 80s ribosome
80. 121 35.6% 59 86 181.3 0.004 3o58:a * Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
81. " " " " " "  = 3o5h:a *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
82. 122 35.6% 59 111 181.0 0.0042 3j39:d Structure of the d. Melanogaster 60s ribosomal proteins
83. 121 35.6% 59 109 179.8 0.0049 3u5e:d * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
84. " " " " " "  = 3u5i:d *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
85. " " " " " "  = 4b6a:d *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
86. " " " " " "  = 4byn:d *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
87. " " " " " "  = 4byu:d *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
88. 121 35.6% 59 110 179.7 0.0049 3izc:g * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
89. " " " " " "  = 3izs:g *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
90. 118 35.0% 60 188 172.0 0.013 3zf7:h High-resolution cryo-electron microscopy structure of the tr brucei ribosome
91. 108 32.2% 59 81 163.6 0.039 2go5:6 * Structure of signal recognition particle receptor (sr) in complex with signal recognition particle (srp) and ribosome nascent chain complex
92. " " " " " "  = 2j37:6 *
Model of mammalian srp bound to 80s rncs
93. 108 37.7% 61 110 161.6 0.05 4a17:W * T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 2.
94. " " " " " "  = 4a1a:W *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 3.
95. " " " " " "  = 4a1c:W *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 4.
96. " " " " " "  = 4a1e:W *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 1
97. 94 29.8% 84 166 139.5 0.86 1xex:A Structural biochemistry of atp-driven dimerization and DNA stimulated activation of smc atpases.
98. 94 29.8% 84 323 135.1 1.5 4i99:A Crystal structure of the smchead bound to thE C-winged helix scpa

Number of sequences: 98

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 85 32.9% 76 323 122.6 7.4 1rm6:B * Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica
2. " " " " " "  = 1sb3:B *
Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica
3. 82 23.9% 88 363 117.7 14 4aws:A * Crystal structure of the oxidized shewanella yellow enzyme 1 (sye1) m25l mutant
4. " " " " " "  = 4awt:A *
Crystal structure of the reduced shewanella yellow enzyme 1 (sye1) m25l mutant
5. 82 23.9% 88 364 117.7 14 4awu:A Crystal structure of the oxidized shewanella yellow enzyme 1 m25l mutant in complex with para-chlorophenol
6. 80 22.7% 88 365 114.9 20 2gou:A * Structure of wild type, oxidized sye1, an oye homologue from s. Oneidensis
7. " " " " " "  = 2gq8:A *
Structure of sye1, an oye homologue from s. Ondeidensis, in with p-hydroxyacetophenone
8. 80 22.7% 88 362 114.9 20 2gq9:A Structure of sye1, an oye homologue from s. Oneidensis, in c with p-hydroxybenzaldehyde
9. 80 22.7% 88 364 114.9 20 2gqa:A Structure of nadh-reduced sye1, an oye homologue from s. One
10. 77 40.5% 42 231 113.7 23 3lhi:A Crystal structure of putative 6- phosphogluconolactonase(yp_207848.1) from neisseria gonorrhoeae fa 1090 at 1.33 a resolution
11. 80 29.4% 51 477 113.1 25 1rzu:A * Crystal structure of the glycogen synthase from a. Tumefacie complex with adp
12. " " " " " "  = 1rzv:A *
Crystal structure of the glycogen synthase from agrobacterium tumefaciens (non-complexed form)
13. 73 40.7% 59 152 110.9 34 1kjn:A Structure of mt0777
14. 75 35.5% 62 357 108.1 48 3cq4:A Histidinol-phosphate aminotransferase from corynebacterium glutamicum
15. 75 35.5% 62 364 108.0 49 3cq5:A Histidinol-phosphate aminotransferase from corynebacterium glutamicum in complex with pmp
16. 75 35.5% 62 363 108.0 49 3cq6:A Histidinol-phosphate aminotransferase from corynebacterium glutamicum holo-form (plp covalently bound )
17. 71 36.4% 44 158 107.9 49 1zu2:A Solution nmr structure of the plant tom20 mitochondrial import receptor from arabidopsis thaliana
18. 71 21.9% 73 160 107.8 50 4ecp:A X-ray crystal structure of inorganic pyrophosphate ppa from mycobacterium leprae

Number of sequences: 18

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer