spacer
spacer

SAS results for UniProt accession no. P14121

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P14121 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P14121 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 43 unique sequences (including 13 consensus sequences) giving 127 sequence matches in all. The 30 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P14121 -----------------------------------------------------------------    50S ribosomal protein L30P OS=Haloarcula marismortui  ...
1ffk:T*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:Y*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a17:V*----------------------------penvqkklardeklrkakaeqrkassaqmkqrkaewi×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:w -----mfmtglillgkgrevmpakavpapesaikraafkqqqtenfkkaiaankvaaaalkklay    High-resolution cryo-electron microscopy structure of the  ...
3o58:G*-----------------------------------------taeqvaaeraarkaankekraiil×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
2zkr:w -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:F ---------------------------------kkrrnfaelkikrlrkkfaqkmlrkarrkliy    Structure of the human 60s ribosomal proteins
1k5y:F*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3j39:F ----------------------------------fskkqiskrvaeskrrlkkaavialrkkenl    Structure of the d. Melanogaster 60s ribosomal proteins
3hu1:A lstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt    Structure of p97 n-d1 r95g mutant in complex with atpgs
3hu2:A lstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt    Structure of p97 n-d1 r86a mutant in complex with atpgs
3jyw:F ---------------------------------------------------aaaaaaaaaaaaaa    Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:F ------------------------------------------aeqvaaeraarkaankekraiil    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:F*-----------------------------------------taeqvaaeraarkaankekraiil×4  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:e*-------------------------iltpesqlkkskaqqktaeqvaaeraarkaankekraiil×2  Localization of the large subunit ribosomal proteins into a  ...
1s3s:A -----------pnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt    Crystal structure of aaa atpase p97/vcp nd1 in complex with  ...
1e32:A ---------nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt    Structure of the n-terminal domain and the d1 aaa domain of  ...
4kln:A lstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt    Structure of p97 n-d1 a232e mutant in complex with atpgs
3cf2:A ---------nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt    Structure of p97/vcp in complex with adp/amp-pnp
3cf1:A ---------nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddt    Structure of p97/vcp in complex with adp/adp.Alfx

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P14121 -------------------------------------mhalvqlrgevnmhtdiqdtlemlnihh    50S ribosomal protein L30P OS=Haloarcula marismortui  ...
1ffk:T*-------------------------------------mhalvqlrgevnmhtdiqdtlemlnihh×68 Crystal structure of the large ribosomal subunit from  ...
3j21:Y*-----------------------------------maklavirirgrvnvkrpvrdtlamlrlhr×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a17:V*skaqkyaaeyeaaekkivdekrkarktgafyvpaeakvafairirgvnqlhpdvkrvlrlfrlrq×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:w srglkysreyrstekklaglrrnarqhgnyyleakpkvavvtrirgiakvppkqrkilqllrlrq    High-resolution cryo-electron microscopy structure of the  ...
3o58:G*ernaayqkeyetaerniiqakrdakaagsyyveaqhklvfvvrikginkippkprkvlqllrltr×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
2zkr:w -------------------------------------lafvirirgingvspkvrkvlqllrlrq    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:F ekakhyhkeyrqmyrteirmarmarkagnfyvpaepklafvirirgingvspkvrkvlqllrlrq    Structure of the human 60s ribosomal proteins
1k5y:F*-------------------------------------lvfvvrikginkippkprkvlqllrltr×2  Structure of the translating 80s ribosome from yeast,  ...
3j39:F vraekyqneyikaeqreiklrrlakkrnqfyvpaeaklafvvrirginkvapkvrkvlqlfrlrq    Structure of the d. Melanogaster 60s ribosomal proteins
3hu1:A csdekirmnrvvrnnlrvglgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfle    Structure of p97 n-d1 r95g mutant in complex with atpgs
3hu2:A csdekirmnavvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfle    Structure of p97 n-d1 r86a mutant in complex with atpgs
3jyw:F aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaglvfvvrikginkippkprkvlqllrltr    Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:F ernaayqkeyetaerniiqakrdakaagsyyveaqhklvfvvrikginkippkprkvlqllrltr    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:F*ernaayqkeyetaerniiqakrdakaagsyyveaqhklvfvvrikginkippkprkvlqllrltr×4  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:e*ernaayqkeyetaerniiqakrdakaagsyyveaqhklvfvvrikginkippkprkvlqllrltr×2  Localization of the large subunit ribosomal proteins into a  ...
1s3s:A csdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfle    Crystal structure of aaa atpase p97/vcp nd1 in complex with  ...
1e32:A csdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfle    Structure of the n-terminal domain and the d1 aaa domain of  ...
4kln:A csdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfle    Structure of p97 n-d1 a232e mutant in complex with atpgs
3cf2:A csdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfle    Structure of p97/vcp in complex with adp/amp-pnp
3cf1:A csdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfle    Structure of p97/vcp in complex with adp/adp.Alfx

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P14121 vnhctlvpetdayrgmvakvndfvafgepsqetl---etvlatra--e-plegd--adv---dde    50S ribosomal protein L30P OS=Haloarcula marismortui  ...
1ffk:T*vnhctlvpetdayrgmvakvndfvafgepsqetl---etvlatra--e-plegd--adv---dde×68 Crystal structure of the large ribosomal subunit from  ...
3j21:Y*vnhcvivddtpsylgmlqkakdyitwgeinaetl---aklirkrg--r--lign--kpv---tde×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a17:V*lhngaffrvnkaslnmikrvlpfitfgyptrnti---skliykrgf-a-kvngqr-ipl---tdn×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:w ifntvfvrlnkpmenmlravepyiaygypslstv---ramvykrg--hlkingqrvkit---dnq    High-resolution cryo-electron microscopy structure of the  ...
3o58:G*insgtfvkvtkatlellkliepyvaygypsysti---rqlvykr--------gf--gki---nkq×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
2zkr:w ifngtfvklnkasinmlrivepyiawgypnlksv---neliykr--------gy--gki---nkk    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:F ifngtfvklnkasinmlrivepyiawgypnlksv---neliykrg--y-gkink--krialtdna    Structure of the human 60s ribosomal proteins
1k5y:F*insgtfvkvtkatlellkliepyvaygypsysti---rqlvykrgfgk-inkqr--vpl---sdn×2  Structure of the translating 80s ribosome from yeast,  ...
3j39:F inngvfiklnkatinmlriaepyitwgypnlksv---reliykrgfvk-hnrqr--vpi---tdn    Structure of the d. Melanogaster 60s ribosomal proteins
3hu1:A ayrpirkgdiflvrggmravefkvvetdpspycivapdtvihceg--e-pikre--------dee    Structure of p97 n-d1 r95g mutant in complex with atpgs
3hu2:A ayrpirkgdiflvrggmravefkvvetdpspycivapdtvihceg--e-pikre--------dee    Structure of p97 n-d1 r86a mutant in complex with atpgs
3jyw:F insgtfvkvtkatlellkliepyvaygypsysti---rqlvykrgfgk-inkqr--vpl---sdn    Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:F insgtfvkvtkatlellkliepyvaygypsysti---rqlvykrgfgk-inkqr--vpl---sdn    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:F*insgtfvkvtkatlellkliepyvaygypsysti---rqlvykrgfgk-inkqr--vpl---sdn×4  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:e*insgtfvkvtkatlellkliepyvaygypsysti---rqlvykrgfgk-inkqr--vpl---sdn×2  Localization of the large subunit ribosomal proteins into a  ...
1s3s:A ayrpirkgdiflvrggmravefkvvetdpspycivapdtvihceg--e-pikre--------dee    Crystal structure of aaa atpase p97/vcp nd1 in complex with  ...
1e32:A ayrpirkgdiflvrggmravefkvvetdpspycivapdtvihceg--e-pikre--------dee    Structure of the n-terminal domain and the d1 aaa domain of  ...
4kln:A ayrpirkgdiflvrggmravefkvvetdpspycivapdtvihceg--e-pikre--------dee    Structure of p97 n-d1 a232e mutant in complex with atpgs
3cf2:A ayrpirkgdiflvrggmravefkvvetdpspycivapdtvihceg--e-pikre--------dee    Structure of p97/vcp in complex with adp/amp-pnp
3cf1:A ayrpirkgdiflvrggmravefkvvetdpspycivapdtvihceg--e-pikre--------dee    Structure of p97/vcp in complex with adp/adp.Alfx

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P14121 wvae--ht-----d----yd--di---s-gl--a-fallse--ettlre-----------qg--l    50S ribosomal protein L30P OS=Haloarcula marismortui  ...
1ffk:T*wvae--ht-----d----yd--di---s-gl--a-fallse--ettlre-----------qg--l×68 Crystal structure of the large ribosomal subunit from  ...
3j21:Y*yvke--kl-----g----mt---i---e-ef--a-qkvvng--emslkdl----------pn--l×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a17:V*tive--kslgkf-g----it--cv---e-dl--i-heittv--gphfke-----------annfl×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:w mikdkyhn-----ddivcae--di---v-nq--i-yacgkh--frtvtn------------g--l    High-resolution cryo-electron microscopy structure of the  ...
3o58:G*rvpl--sd-----na---ygilsi---d-dl--i-heiitv--gphfkq-----------annfl×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
2zkr:w rial---t-----d----ns--li---arsl--gkfgiicm--edliheiytvgkrfkeann--f    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:F liar--sl-----g----ky--giicme-dl--i-heiytv--gkrfke-----------annfl    Structure of the human 60s ribosomal proteins
1k5y:F*aiie--anlg---k----ygilsi---d-dl--i-heiitv--gphfkq-----------annfl×2  Structure of the translating 80s ribosome from yeast,  ...
3j39:F fvie--rklrqahq----iq--cv---e-dl--v-heiftv--gpnfky-----------asnfl    Structure of the d. Melanogaster 60s ribosomal proteins
3hu1:A esln--ev-----g----yd--di---g-gcrkq-laqikemvelplrh-----------pa--l    Structure of p97 n-d1 r95g mutant in complex with atpgs
3hu2:A esln--ev-----g----yd--di---g-gcrkq-laqikemvelplrh-----------pa--l    Structure of p97 n-d1 r86a mutant in complex with atpgs
3jyw:F aiie--anlg---k----ygilsi---d-dl--i-heiitv--gphfkq-----------annfl    Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:F aiie--anlg---k----ygilsi---d-dl--i-heiitv--gphfkq-----------annfl    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:F*aiie--anlg---k----ygilsi---d-dl--i-heiitv--gphfkq-----------annfl×4  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:e*aiie--anlg---k----ygilsi---d-dl--i-heiitv--gphfkq-----------annfl×2  Localization of the large subunit ribosomal proteins into a  ...
1s3s:A esln--ev-----g----yd--dv---g-gcrkq-laqikemvelplrh-----------pa--l    Crystal structure of aaa atpase p97/vcp nd1 in complex with  ...
1e32:A esln--ev-----g----yd--dv---g-gcrkq-laqikemvelplrh-----------pa--l    Structure of the n-terminal domain and the d1 aaa domain of  ...
4kln:A esln--ev-----g----yd--di---g-gcrkq-laqikemvelplrh-----------pa--l    Structure of p97 n-d1 a232e mutant in complex with atpgs
3cf2:A esln--ev-----g----yd--di---g-gcrkq-laqikemvelplrh-----------pa--l    Structure of p97/vcp in complex with adp/amp-pnp
3cf1:A esln--ev-----g----yd--di---g-gcrkq-laqikemvelplrh-----------pa--l    Structure of p97/vcp in complex with adp/adp.Alfx

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P14121 sptlrlhpprgg-hdgvkh-pvk---eggqlgkhdtegiddlleamr------------------    50S ribosomal protein L30P OS=Haloarcula marismortui  ...
1ffk:T*sptlrlhpprgg-hdgvkh-pvk---eggqlgkhdtegiddlleamr------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:Y*kpvfrlhpprgg-frgskkrsfk---eggalg-yrgekinelierml------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a17:V*wp-fkldtprgg-frnkrh-ayh---qggdwgnrevy-indlvkaml------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:w wp-fklappagg-mrqkrr-hfv---eggdygnrdtlinrflarmi-------------------    High-resolution cryo-electron microscopy structure of the  ...
3o58:G*wp-fklsnpsgg-w-gvpr-kfkhfiqggsfgnre-efinklvksmn------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
2zkr:w lwpfklssprgg-mkkktt-hv----eggdagredq--inrlirrmn------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:F wp-fklssprgg-mkkktt-hfv---eggdagnredq-inrlirrmn------------------    Structure of the human 60s ribosomal proteins
1k5y:F*wp-fklsnpsgg-w-gvpr-kfkhfiqggsfgnre-efinklvksm-------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3j39:F wp-fklntptggwrkkanh-yvn----ggdfgnredq-inrllrkmv------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3hu1:A fkaigvkpprgi-llygpp-gtg---ktliaravanetgaffflingpeimsklagesesnlrka    Structure of p97 n-d1 r95g mutant in complex with atpgs
3hu2:A fkaigvkpprgi-llygpp-gtg---ktliaravanetgaffflingpeimsklagesesnlrka    Structure of p97 n-d1 r86a mutant in complex with atpgs
3jyw:F wp-fklsnpsgg-w-gvpr-kfkhfiqggsfgnre-efinklvksmn------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:F wp-fklsnpsgg-w-gvpr-kfkhfiqggsfgnre-efinklvksmn------------------    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:F*wp-fklsnpsgg-w-gvpr-kfkhfiqggsfgnre-efinklvksmn------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:e*wp-fklsnpsgg-w-gvpr-kfkhfiqggsfgnre-efinklvksmn------------------×2  Localization of the large subunit ribosomal proteins into a  ...
1s3s:A fkaigvkpprgi-llygpp-gtg---ktliaravanetgaffflingpeimsklagesesnlrka    Crystal structure of aaa atpase p97/vcp nd1 in complex with  ...
1e32:A fkaigvkpprgi-llygpp-gtg---ktliaravanetgaffflingpeimsklagesesnlrka    Structure of the n-terminal domain and the d1 aaa domain of  ...
4kln:A fkeigvkpprgi-llygpp-gtg---ktliaravanetgaffflingpeimsklagesesnlrka    Structure of p97 n-d1 a232e mutant in complex with atpgs
3cf2:A fkaigvkpprgi-llygpp-gtg---ktliaravanetgaffflingpeimsklagesesnlrka    Structure of p97/vcp in complex with adp/amp-pnp
3cf1:A fkaigvkpprgi-llygpp-gtg---ktliaravanetgaffflingpeimsklagesesnlrka    Structure of p97/vcp in complex with adp/adp.Alfx

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P14121 -----------------------------------------------------------------    50S ribosomal protein L30P OS=Haloarcula marismortui  ...
1ffk:T*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:Y*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a17:V*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:w -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3o58:G*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
2zkr:w -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:F -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
1k5y:F*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3j39:F -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3hu1:A feeaeknapaiifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsid    Structure of p97 n-d1 r95g mutant in complex with atpgs
3hu2:A feeaeknapaiifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsid    Structure of p97 n-d1 r86a mutant in complex with atpgs
3jyw:F -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:F -----------------------------------------------------------------    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:F*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:e*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
1s3s:A feeaeknapaiifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsid    Crystal structure of aaa atpase p97/vcp nd1 in complex with  ...
1e32:A feeaeknapaiifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsid    Structure of the n-terminal domain and the d1 aaa domain of  ...
4kln:A feeaeknapaiifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsid    Structure of p97 n-d1 a232e mutant in complex with atpgs
3cf2:A feeaeknapaiifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsid    Structure of p97/vcp in complex with adp/amp-pnp
3cf1:A feeaeknapaiifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsid    Structure of p97/vcp in complex with adp/adp.Alfx

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P14121 -----------------------------------------------------------------    50S ribosomal protein L30P OS=Haloarcula marismortui  ...
1ffk:T*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:Y*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a17:V*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:w -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3o58:G*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
2zkr:w -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:F -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
1k5y:F*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3j39:F -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3hu1:A palrrfgrfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaa    Structure of p97 n-d1 r95g mutant in complex with atpgs
3hu2:A palrrfgrfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaa    Structure of p97 n-d1 r86a mutant in complex with atpgs
3jyw:F -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:F -----------------------------------------------------------------    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:F*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:e*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
1s3s:A palrrfgrfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaa    Crystal structure of aaa atpase p97/vcp nd1 in complex with  ...
1e32:A palrrfgrfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaa    Structure of the n-terminal domain and the d1 aaa domain of  ...
4kln:A palrrfgrfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaa    Structure of p97 n-d1 a232e mutant in complex with atpgs
3cf2:A palrrfgrfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaa    Structure of p97/vcp in complex with adp/amp-pnp
3cf1:A palrrfgrfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaa    Structure of p97/vcp in complex with adp/adp.Alfx

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P14121 -----------------------------------------------------------------    50S ribosomal protein L30P OS=Haloarcula marismortui  ...
1ffk:T*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:Y*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a17:V*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:w -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3o58:G*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
2zkr:w -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:F -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
1k5y:F*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3j39:F -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3hu1:A lqairkkmdlidledetidaevmnslavtmddfrwalsqsnps----------------------    Structure of p97 n-d1 r95g mutant in complex with atpgs
3hu2:A lqairkkmdlidledetidaevmnslavtmddfrwalsqsnpsa---------------------    Structure of p97 n-d1 r86a mutant in complex with atpgs
3jyw:F -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:F -----------------------------------------------------------------    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:F*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:e*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
1s3s:A lqairkkmdlidledetidaevmnslavtmddfrwalsq--------------------------    Crystal structure of aaa atpase p97/vcp nd1 in complex with  ...
1e32:A lqairkkmdlidledetidaevmnslavtmddfrwalsq--------------------------    Structure of the n-terminal domain and the d1 aaa domain of  ...
4kln:A lqairkkmdlidledetidaevmnslavtmddfrwalsqsnps----------------------    Structure of p97 n-d1 a232e mutant in complex with atpgs
3cf2:A lqairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwediggled    Structure of p97/vcp in complex with adp/amp-pnp
3cf1:A lqairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwediggled    Structure of p97/vcp in complex with adp/adp.Alfx

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P14121 -----------------------------------------------------------------    50S ribosomal protein L30P OS=Haloarcula marismortui  ...
1ffk:T*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:Y*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a17:V*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:w -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3o58:G*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
2zkr:w -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:F -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
1k5y:F*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3j39:F -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3hu1:A -----------------------------------------------------------------    Structure of p97 n-d1 r95g mutant in complex with atpgs
3hu2:A -----------------------------------------------------------------    Structure of p97 n-d1 r86a mutant in complex with atpgs
3jyw:F -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:F -----------------------------------------------------------------    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:F*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:e*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
1s3s:A -----------------------------------------------------------------    Crystal structure of aaa atpase p97/vcp nd1 in complex with  ...
1e32:A -----------------------------------------------------------------    Structure of the n-terminal domain and the d1 aaa domain of  ...
4kln:A -----------------------------------------------------------------    Structure of p97 n-d1 a232e mutant in complex with atpgs
3cf2:A vkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpellt    Structure of p97/vcp in complex with adp/amp-pnp
3cf1:A vkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpellt    Structure of p97/vcp in complex with adp/adp.Alfx

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P14121 -----------------------------------------------------------------    50S ribosomal protein L30P OS=Haloarcula marismortui  ...
1ffk:T*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:Y*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a17:V*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:w -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3o58:G*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
2zkr:w -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:F -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
1k5y:F*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3j39:F -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3hu1:A -----------------------------------------------------------------    Structure of p97 n-d1 r95g mutant in complex with atpgs
3hu2:A -----------------------------------------------------------------    Structure of p97 n-d1 r86a mutant in complex with atpgs
3jyw:F -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:F -----------------------------------------------------------------    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:F*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:e*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
1s3s:A -----------------------------------------------------------------    Crystal structure of aaa atpase p97/vcp nd1 in complex with  ...
1e32:A -----------------------------------------------------------------    Structure of the n-terminal domain and the d1 aaa domain of  ...
4kln:A -----------------------------------------------------------------    Structure of p97 n-d1 a232e mutant in complex with atpgs
3cf2:A mwfgeseanvreifdkarqaapcvlffdeldsiadrvinqiltemdgmstkknvfiiganrpdii    Structure of p97/vcp in complex with adp/amp-pnp
3cf1:A mwfgeseanvreifdkarqaapcvlffdeldsiakargdgggaadrvinqiltemdgmstkknvf    Structure of p97/vcp in complex with adp/adp.Alfx

                6         6         6         6         7         7     
                6         7         8         9         0         1     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P14121 -----------------------------------------------------------------    50S ribosomal protein L30P OS=Haloarcula marismortui  ...
1ffk:T*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:Y*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a17:V*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:w -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
3o58:G*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
2zkr:w -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:F -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
1k5y:F*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3j39:F -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3hu1:A -----------------------------------------------------------------    Structure of p97 n-d1 r95g mutant in complex with atpgs
3hu2:A -----------------------------------------------------------------    Structure of p97 n-d1 r86a mutant in complex with atpgs
3jyw:F -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:F -----------------------------------------------------------------    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:F*-----------------------------------------------------------------×4  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:e*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
1s3s:A -----------------------------------------------------------------    Crystal structure of aaa atpase p97/vcp nd1 in complex with  ...
1e32:A -----------------------------------------------------------------    Structure of the n-terminal domain and the d1 aaa domain of  ...
4kln:A -----------------------------------------------------------------    Structure of p97 n-d1 a232e mutant in complex with atpgs
3cf2:A dpailrpgrldqliyiksrvailkanlrksakddlteicqracklairesievpehfeeamemfa    Structure of p97/vcp in complex with adp/amp-pnp
3cf1:A iigatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtngfs    Structure of p97/vcp in complex with adp/adp.Alfx

           7         7         7         7         7         7     
           2         3         4         5         6         7     
       678901234567890123456789012345678901234567890123456789012345         Protein name
       ----+---------+---------+---------+---------+---------+-----         ------------
P14121 ------------------------------------------------------------         50S ribosomal protein L30P OS=Haloarcula marismortui  ...
1ffk:T*------------------------------------------------------------     ×68 Crystal structure of the large ribosomal subunit from  ...
3j21:Y*------------------------------------------------------------     ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a17:V*------------------------------------------------------------     ×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3zf7:w ------------------------------------------------------------         High-resolution cryo-electron microscopy structure of the  ...
3o58:G*------------------------------------------------------------     ×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
2zkr:w ------------------------------------------------------------         Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:F ------------------------------------------------------------         Structure of the human 60s ribosomal proteins
1k5y:F*------------------------------------------------------------     ×2  Structure of the translating 80s ribosome from yeast,  ...
3j39:F ------------------------------------------------------------         Structure of the d. Melanogaster 60s ribosomal proteins
3hu1:A ------------------------------------------------------------         Structure of p97 n-d1 r95g mutant in complex with atpgs
3hu2:A ------------------------------------------------------------         Structure of p97 n-d1 r86a mutant in complex with atpgs
3jyw:F ------------------------------------------------------------         Structure of the 60s proteins for eukaryotic ribosome based  ...
3u5e:F ------------------------------------------------------------         The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:F*------------------------------------------------------------     ×4  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:e*------------------------------------------------------------     ×2  Localization of the large subunit ribosomal proteins into a  ...
1s3s:A ------------------------------------------------------------         Crystal structure of aaa atpase p97/vcp nd1 in complex with  ...
1e32:A ------------------------------------------------------------         Structure of the n-terminal domain and the d1 aaa domain of  ...
4kln:A ------------------------------------------------------------         Structure of p97 n-d1 a232e mutant in complex with atpgs
3cf2:A ------------------------------------------------------------         Structure of p97/vcp in complex with adp/amp-pnp
3cf1:A gadlteicqracklairesieseivpeirrdhfeeamrfarrsvsdndirkyemfaqtlq         Structure of p97/vcp in complex with adp/adp.Alfx

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P14121. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 154 - - P14121 50S ribosomal protein L30P OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl30p PE=1 SV=2
2. 1034 100.0% 154 154 1350.4 3.1e-68 1ffk:T * Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
3. " " " " " "  = 1jj2:V *
Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
4. " " " " " "  = 1k73:X *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
5. " " " " " "  = 1k8a:X *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
6. " " " " " "  = 1k9m:X *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
7. " " " " " "  = 1kc8:X *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
8. " " " " " "  = 1kd1:X *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
9. " " " " " "  = 1kqs:V *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
10. " " " " " "  = 1m1k:X *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
11. " " " " " "  = 1m90:X *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
12. " " " " " "  = 1n8r:X *
Structure of large ribosomal subunit in complex with virginiamycin m
13. " " " " " "  = 1nji:X *
Structure of chloramphenicol bound to the 50s ribosomal subunit
14. " " " " " "  = 1q7y:X *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
15. " " " " " "  = 1q81:X *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
16. " " " " " "  = 1q82:X *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
17. " " " " " "  = 1q86:X *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
18. " " " " " "  = 1qvf:V *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
19. " " " " " "  = 1qvg:V *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
20. " " " " " "  = 1s72:W *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
21. " " " " " "  = 1vq4:W *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
22. " " " " " "  = 1vq5:W *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
23. " " " " " "  = 1vq6:W *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
24. " " " " " "  = 1vq7:W *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
25. " " " " " "  = 1vq8:W *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
26. " " " " " "  = 1vq9:W *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
27. " " " " " "  = 1vqk:W *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
28. " " " " " "  = 1vql:W *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
29. " " " " " "  = 1vqm:W *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
30. " " " " " "  = 1vqn:W *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
31. " " " " " "  = 1vqo:W *
The structure of ccpmn bound to the large ribosomal subunit marismortui
32. " " " " " "  = 1vqp:W *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1w2b:V *
Trigger factor ribosome binding domain in complex with 50s
34. " " " " " "  = 1yhq:W *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
35. " " " " " "  = 1yi2:W *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
36. " " " " " "  = 1yij:W *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
37. " " " " " "  = 1yit:W *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
38. " " " " " "  = 1yj9:W *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
39. " " " " " "  = 1yjn:W *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
40. " " " " " "  = 1yjw:W *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
41. " " " " " "  = 2otj:W *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
42. " " " " " "  = 2otl:W *
Girodazole bound to the large subunit of haloarcula marismor
43. " " " " " "  = 2qa4:W *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
44. " " " " " "  = 2qex:W *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
45. " " " " " "  = 3cc2:W *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
46. " " " " " "  = 3cc4:W *
Co-crystal structure of anisomycin bound to the 50s ribosoma
47. " " " " " "  = 3cc7:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
48. " " " " " "  = 3cce:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
49. " " " " " "  = 3ccj:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
50. " " " " " "  = 3ccl:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
51. " " " " " "  = 3ccm:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
52. " " " " " "  = 3ccq:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
53. " " " " " "  = 3ccr:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
54. " " " " " "  = 3ccs:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
55. " " " " " "  = 3ccu:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
56. " " " " " "  = 3ccv:W *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
57. " " " " " "  = 3cd6:W *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
58. " " " " " "  = 3cma:W *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
59. " " " " " "  = 3cme:W *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
60. " " " " " "  = 3cpw:V *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
61. " " " " " "  = 3cxc:V *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
62. " " " " " "  = 3g4s:W *
Co-crystal structure of tiamulin bound to the large ribosoma
63. " " " " " "  = 3g6e:W *
Co-crystal structure of homoharringtonine bound to the large subunit
64. " " " " " "  = 3g71:W *
Co-crystal structure of bruceantin bound to the large riboso subunit
65. " " " " " "  = 3i55:W *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
66. " " " " " "  = 3i56:W *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
67. " " " " " "  = 3ow2:V *
Crystal structure of enhanced macrolide bound to 50s ribosom
68. " " " " " "  = 4adx:W *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
69. " " " " " "  = 4hub:W *
The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
70. 358 40.5% 153 155 472.4 2.4e-19 3j21:Y * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
71. " " " " " "  = 3j44:Y *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
72. 164 22.3% 157 234 217.7 3.8e-05 4a17:V * T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 2.
73. " " " " " "  = 4a1a:V *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 3.
74. " " " " " "  = 4a1c:V *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 4.
75. " " " " " "  = 4a1e:V *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 1
76. 138 23.5% 149 257 183.3 0.0031 3zf7:w High-resolution cryo-electron microscopy structure of the tr brucei ribosome
77. 106 23.4% 158 215 142.9 0.55 3o58:G * Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
78. " " " " " "  = 3o5h:G *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
79. 103 22.1% 163 158 139.9 0.82 2zkr:w Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
80. 102 20.3% 158 229 137.3 1.1 3j3b:F Structure of the human 60s ribosomal proteins
81. 105 23.0% 161 161 125.4 5.2 1k5y:F * Structure of the translating 80s ribosome from yeast, obtained by docking atomic models for RNA and protein components into a 15a cryo-em map. This file 1k5y contains the 60s ribosomal subunit. The file 1k5x contains the 40s ribosomal subunit, the p-site bound tRNA and the mRNA codon.
82. " " " " " "  = 1s1i:F *
Structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 a cryo-em map. This file, 1s1i, contains 60s subunit. The 40s ribosomal subunit is in file 1s1h.
83. 92 18.1% 160 229 124.3 6 3j39:F Structure of the d. Melanogaster 60s ribosomal proteins
84. 95 30.3% 89 451 123.5 6.6 3hu1:A Structure of p97 n-d1 r95g mutant in complex with atpgs
85. 95 30.3% 89 452 123.5 6.6 3hu2:A Structure of p97 n-d1 r86a mutant in complex with atpgs
86. 105 23.0% 161 213 123.5 6.6 3jyw:F Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
87. 105 23.0% 161 222 123.2 6.9 3u5e:F The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
88. 105 23.0% 161 223 123.2 6.9 3u5i:F * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
89. " " " " " "  = 4b6a:F *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
90. " " " " " "  = 4byn:F *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
91. " " " " " "  = 4byu:F *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
92. 105 23.0% 161 239 122.7 7.4 3izc:e * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
93. " " " " " "  = 3izs:e *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
94. 94 29.2% 89 436 122.5 7.6 1s3s:A Crystal structure of aaa atpase p97/vcp nd1 in complex with p47 c
95. 94 29.2% 89 438 122.4 7.6 1e32:A Structure of the n-terminal domain and the d1 aaa domain of membrane fusion atpase p97
96. 94 30.3% 89 451 122.2 7.8 4kln:A Structure of p97 n-d1 a232e mutant in complex with atpgs
97. 95 30.3% 89 659 120.9 9.3 3cf2:A Structure of p97/vcp in complex with adp/amp-pnp
98. 95 30.3% 89 719 120.3 10 3cf1:A Structure of p97/vcp in complex with adp/adp.Alfx

Number of sequences: 98

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 95 30.3% 89 723 120.3 10 3cf3:A Structure of p97/vcp in complex with adp
2. 89 32.7% 49 238 120.2 10 3fiu:A Structure of nmn synthetase from francisella tularensis
3. 94 29.2% 89 683 119.4 11 1r7r:A The crystal structure of murine p97/vcp at 3.6a
4. 94 29.2% 89 692 119.3 11 1ypw:A Structure of p97/vcp in complex in adp/amp-pnp
5. 94 29.2% 89 698 119.2 12 1oz4:A * Vcp/p97
6. " " " " " "  = 1yq0:A *
Structure of p97/vcp in complex with adp/adp.Alfx
7. 94 29.2% 89 705 119.2 12 1yqi:A Vcp/p97 complexed with adp
8. 83 28.6% 77 98 118.5 13 2yf1:B Complex of a b21 chicken mhc class i molecule and a 11mer ch peptide
9. 83 28.6% 77 97 118.5 13 2yf5:B * Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
10. " " " " " "  = 2yf6:B *
Complex of a b21 chicken mhc class i molecule and a 10mer chicken peptide
11. 83 28.6% 77 98 118.5 13 3jvg:C Crystal structure of chicken cd1-1
12. 83 28.6% 77 97 118.5 13 3o81:A Beta2-microglobulin from gallus gallus
13. 83 28.6% 77 97 118.5 13 4e0r:B * Structure of the chicken mhc class i molecule bf2 0401
14. " " " " " "  = 4g42:B *
Structure of the chicken mhc class i molecule bf2 0401 Compl pepitde p8d
15. " " " " " "  = 4g43:B *
Structure of the chicken mhc class i molecule bf2 0401 Compl p5e
16. 83 28.6% 77 99 118.4 13 3bev:B * 11mer structure of an mhc class i molecule from b21 chickens illustrate promiscuous peptide binding
17. " " " " " "  = 3bew:B *
10mer crystal structure of chicken mhc class i haplotype b21
18. 83 28.6% 77 99 118.4 13 3p73:B * Crystal structures of the chicken yf1 7.1 molecule
19. " " " " " "  = 3p77:B *
Crystal structures of the chicken yf1 7.1 molecule
20. 85 30.2% 106 168 117.4 15 1l9i:A Theoretical model of horse stromelysin
21. 90 32.3% 65 438 117.2 15 4kod:A Structure of p97 n-d1 r155h mutant in complex with adp
22. 90 32.3% 65 453 117.0 15 3hu3:A Structure of p97 n-d1 r155h mutant in complex with atpgs
23. 90 32.3% 65 456 117.0 15 4ko8:A Structure of p97 n-d1 r155h mutant in complex with atpgs
24. 84 33.8% 65 174 115.8 18 3mol:B Structure of dimeric holo hasap h32a mutant from pseudomonas aeruginosa to 1.20a resolution
25. 77 27.6% 76 96 110.8 34 2yez:B Complex of a b21 chicken mhc class i molecule and a 10mer ch peptide
26. 79 26.9% 67 142 110.7 34 1s11:B * Theoretical model of glutamate binding site of nmda receptor in closed form
27. " " " " " "  = 1s2s:B *
Theoretical model of glutamate binding site of nmda receptor in open form
28. 85 28.3% 106 466 110.3 36 2v5p:A Complex structure of human igf2r domains 11-13 bound to igf-ii
29. 85 28.3% 106 604 108.5 45 2v5o:A Structure of human igf2r domains 11-14
30. 81 43.2% 44 291 108.4 46 3g3l:A Crystal structure of putative membrane-associated protein of function (yp_211325.1) from bacteroides fragilis nctc 9343 resolution

Number of sequences: 30

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer