spacer
spacer

SAS results for UniProt accession no. P14116

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P14116 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P14116 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 35 unique sequences (including 12 consensus sequences) giving 122 sequence matches in all. The 21 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P14116 -----------------------mprtrecdycgt--diepgtgtmfvhkdga---tthfcss--    50S ribosomal protein L24e OS=Haloarcula marismortui  ...
4hub:U ------------------------prtrecdycgt--diepgtgtmfvhkdga---tthfcss--    The re-refined crystal structure of the haloarcula  ...
1w2b:T ---------------------------recdycgt--diepgtgtmfvhkdga---tthfcss--    Trigger factor ribosome binding domain in complex with 50s
1ffk:R*---------------------------recdycgt--diepgtgtmfvhkdga---tthfcss--×65 Crystal structure of the large ribosomal subunit from  ...
4adx:U ---------------------------recdycgt--diepgtgtmfvhkdga---tthfcss--    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
1giy:R*---------------------------recdycgt--diepgtgtmfvhkdga---tthfcss--×6  Crystal structure of the ribosome at 5.5 a resolution. This  ...
3j21:V*-----------------------marwnvcsycgk--pfepgtgkmyvrndgr---vlffcsr--×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2zkr:u ---------------------------elcsfsgy--kiypghgrryartdgk---vfqflna--    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:W ------------------------mkvelcsfsgy--kiypghgrryartdgk---vfqflna--    Structure of the human 60s ribosomal proteins
3j39:W ------------------------mkiglcafsgy--kiypghgktmvkidgk---sftfldk--    Structure of the d. Melanogaster 60s ribosomal proteins
4a17:T*-----------------------vvrtgtcsfcey--riypgrgqrfiakdgr---gfffltk--×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3iz5:Z*----------------------mvlktelcrfsgq--kiypgkgirfiradsq---vflfans--×3  Localization of the large subunit ribosomal proteins into a  ...
3jyw:S -------------------------------fsga--kiypgrgtlfvrgdsk---ifrfqns--    Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:S*---------------------------eidsfsga--kiypgrgtlfvrgdsk---ifrfqns--×2  Structure of the translating 80s ribosome from yeast,  ...
2x7n:D ------------------------mkveidsfsga--kiypgrgtlfvrgdsk---ifrfqns--    Mechanism of eif6s anti-association activity
3o58:V*------------------------mkveidsfsga--kiypgrgtlfvrgdsk---ifrfqns--×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3izc:Z*------------------------mkveidsfsga--kiypgrgtlfvrgdsk---ifrfqns--×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:W ------------------------mkveidsfsga--kiypgrgtlfvrgdsk---ifrfqns--    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:W*------------------------mkveidsfsga--kiypgrgtlfvrgdsk---ifrfqns--×4  The structure of the eukaryotic ribosome at 3.0 a  ...
1do5:A qnlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygd---ltnncns--    Human copper chaperone for superoxide dismutase domain ii
2fc7:A ------gssgssgqqmqaesgfvqhvgfkcdncg----iepiqgvrwhcqdcppemsldfcdscs    Solution structure of the zz domain of zzz3 protein

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P14116 kcen--nadlgrearnlewtdtargeagea-edea------------------------------    50S ribosomal protein L24e OS=Haloarcula marismortui  ...
4hub:U kcen--nadlgrearnlewtdtar-----------------------------------------    The re-refined crystal structure of the haloarcula  ...
1w2b:T kcen--nadlgrearnlewtdtarg----------------------------------------    Trigger factor ribosome binding domain in complex with 50s
1ffk:R*kcen--nadlgrearnlewtdtar-----------------------------------------×65 Crystal structure of the large ribosomal subunit from  ...
4adx:U kcen--nadlgrearnlewtdta------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
1giy:R*kcen--nadl-rearnlewtdtar-----------------------------------------×6  Crystal structure of the ribosome at 5.5 a resolution. This  ...
3j21:V*kcer--yyfmgrnprklkwtkayqearlqr-gge-------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2zkr:u kces--aflskrnprqinwtvlyr-----------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:W kces--aflskrnprqinwtvlyrrkhkkg-qseeiqkkrtrravkfqraitgasladimakrnq    Structure of the human 60s ribosomal proteins
3j39:W kcer--sylmkrnprkvtwtvlyrrkhrkgieeeaskkrtrrtqkfqraivgaslaeilakrnmk    Structure of the d. Melanogaster 60s ribosomal proteins
4a17:T*kakc--lslrkvkaqkitwtiarrrlwk-------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3iz5:Z*kckr--yfhnrlkpakltwtamyrkqhkkd-ihaeavkkrrr-----------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3jyw:S ksas--lfkqrknprriawt---------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:S*ksas--lfkqrknprriawtvlfr-----------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
2x7n:D ksas--lfkqrknprriawtvlfr-----------------------------------------    Mechanism of eif6s anti-association activity
3o58:V*ksas--lfkqrknprriawtvlfrkhh--------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3izc:Z*ksas--lfkqrknprriawtvlfrkhhkkg-iteevakkrsr-----------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:W ksas--lfkqrknprriawtvlfrkhhkkg-iteevakkrsrktvkaqrpitgasldlikerrsl    The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:W*ksas--lfkqrknprriawtvlfrkhhkkg-iteevakkrsrktvkaqrpitgasldlikerrsl×4  The structure of the eukaryotic ribosome at 3.0 a  ...
1do5:A -cgnhfnpd-gashggpqdsdrhrgdlgnv-radadgraifrmedeqlkvwdvigrsliideged    Human copper chaperone for superoxide dismutase domain ii
2fc7:A dclh--etdihkedhqlepiyrssgpssg------------------------------------    Solution structure of the zz domain of zzz3 protein

                1         1         1         
                4         5         6         
       123456789012345678901234567890123456789                              Protein name
       ---------+---------+---------+---------                              ------------
P14116 ---------------------------------------                              50S ribosomal protein L24e OS=Haloarcula marismortui  ...
4hub:U ---------------------------------------                              The re-refined crystal structure of the haloarcula  ...
1w2b:T ---------------------------------------                              Trigger factor ribosome binding domain in complex with 50s
1ffk:R*---------------------------------------                          ×65 Crystal structure of the large ribosomal subunit from  ...
4adx:U ---------------------------------------                              The cryo-em structure of the archaeal 50s ribosomal subunit  ...
1giy:R*---------------------------------------                          ×6  Crystal structure of the ribosome at 5.5 a resolution. This  ...
3j21:V*---------------------------------------                          ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2zkr:u ---------------------------------------                              Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:W kpevrkaqreqairaakeakkakqaskk-----------                              Structure of the human 60s ribosomal proteins
3j39:W pevrkaqrdqaikvakeqkravkaakkaaapap------                              Structure of the d. Melanogaster 60s ribosomal proteins
4a17:T*---------------------------------------                          ×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3iz5:Z*---------------------------------------                          ×3  Localization of the large subunit ribosomal proteins into a  ...
3jyw:S ---------------------------------------                              Structure of the 60s proteins for eukaryotic ribosome based  ...
1k5y:S*---------------------------------------                          ×2  Structure of the translating 80s ribosome from yeast,  ...
2x7n:D ---------------------------------------                              Mechanism of eif6s anti-association activity
3o58:V*---------------------------------------                          ×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3izc:Z*---------------------------------------                          ×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:W kp-------------------------------------                              The structure of the eukaryotic ribosome at 3.0 a  ...
3u5i:W*kpevrkanreeklkankekkkaekaarkaekaksagtqs                          ×4  The structure of the eukaryotic ribosome at 3.0 a  ...
1do5:A dlgrgghplskitgnsgerlacgiiarsaglf-------                              Human copper chaperone for superoxide dismutase domain ii
2fc7:A ---------------------------------------                              Solution structure of the zz domain of zzz3 protein

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P14116. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 67 - - P14116 50S ribosomal protein L24e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl24e PE=1 SV=2
2. 406 100.0% 56 56 604.4 1.1e-26 4hub:U The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
3. 392 100.0% 54 54 584.3 1.4e-25 1w2b:T Trigger factor ribosome binding domain in complex with 50s
4. 384 100.0% 53 53 572.8 6.2e-25 1ffk:R * Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
5. " " " " " "  = 1jj2:T *
Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
6. " " " " " "  = 1k73:V *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
7. " " " " " "  = 1k8a:V *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
8. " " " " " "  = 1k9m:V *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
9. " " " " " "  = 1kc8:V *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
10. " " " " " "  = 1kd1:V *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
11. " " " " " "  = 1kqs:T *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
12. " " " " " "  = 1m1k:V *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
13. " " " " " "  = 1m90:V *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
14. " " " " " "  = 1n8r:V *
Structure of large ribosomal subunit in complex with virginiamycin m
15. " " " " " "  = 1nji:V *
Structure of chloramphenicol bound to the 50s ribosomal subunit
16. " " " " " "  = 1q7y:V *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
17. " " " " " "  = 1q81:V *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
18. " " " " " "  = 1q82:V *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
19. " " " " " "  = 1q86:V *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
20. " " " " " "  = 1qvf:T *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
21. " " " " " "  = 1qvg:T *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
22. " " " " " "  = 1s72:U *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
23. " " " " " "  = 1vq4:U *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
24. " " " " " "  = 1vq5:U *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
25. " " " " " "  = 1vq6:U *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
26. " " " " " "  = 1vq7:U *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
27. " " " " " "  = 1vq8:U *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
28. " " " " " "  = 1vq9:U *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
29. " " " " " "  = 1vqk:U *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
30. " " " " " "  = 1vql:U *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
31. " " " " " "  = 1vqm:U *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
32. " " " " " "  = 1vqn:U *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1vqo:U *
The structure of ccpmn bound to the large ribosomal subunit marismortui
34. " " " " " "  = 1vqp:U *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
35. " " " " " "  = 1yhq:U *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
36. " " " " " "  = 1yi2:U *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
37. " " " " " "  = 1yij:U *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
38. " " " " " "  = 1yit:U *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
39. " " " " " "  = 1yj9:U *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
40. " " " " " "  = 1yjn:U *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
41. " " " " " "  = 1yjw:U *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
42. " " " " " "  = 2otj:U *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
43. " " " " " "  = 2otl:U *
Girodazole bound to the large subunit of haloarcula marismor
44. " " " " " "  = 2qa4:U *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
45. " " " " " "  = 2qex:U *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
46. " " " " " "  = 3cc2:U *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
47. " " " " " "  = 3cc4:U *
Co-crystal structure of anisomycin bound to the 50s ribosoma
48. " " " " " "  = 3cc7:U *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
49. " " " " " "  = 3cce:U *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
50. " " " " " "  = 3ccj:U *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
51. " " " " " "  = 3ccl:U *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
52. " " " " " "  = 3ccm:U *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
53. " " " " " "  = 3ccq:U *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
54. " " " " " "  = 3ccr:U *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
55. " " " " " "  = 3ccs:U *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
56. " " " " " "  = 3ccu:U *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
57. " " " " " "  = 3ccv:U *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
58. " " " " " "  = 3cd6:U *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
59. " " " " " "  = 3cma:U *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
60. " " " " " "  = 3cme:U *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
61. " " " " " "  = 3cpw:T *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
62. " " " " " "  = 3cxc:T *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
63. " " " " " "  = 3g4s:U *
Co-crystal structure of tiamulin bound to the large ribosoma
64. " " " " " "  = 3g6e:U *
Co-crystal structure of homoharringtonine bound to the large subunit
65. " " " " " "  = 3g71:U *
Co-crystal structure of bruceantin bound to the large riboso subunit
66. " " " " " "  = 3i55:U *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
67. " " " " " "  = 3i56:U *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
68. " " " " " "  = 3ow2:T *
Crystal structure of enhanced macrolide bound to 50s ribosom
69. 377 100.0% 52 52 562.7 2.3e-24 4adx:U The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
70. 364 98.1% 53 52 543.8 2.5e-23 1giy:R * Crystal structure of the ribosome at 5.5 a resolution. This file, 1giy, contains the 50s ribosome subunit. The 30s ribosome subunit, three tRNA, and mRNA molecules are in the file 1gix
71. " " " " " "  = 1ml5:r *
Structure of the e. Coli ribosomal termination complex with factor 2
72. " " " " " "  = 1yl3:R *
Crystal structure of 70s ribosome with thrs operator and trn subunit. The coordinates for the small subunit are in the p 1yl4.
73. " " " " " "  = 2b66:T *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400
74. " " " " " "  = 2b9n:T *
50s ribosomal subunit from a crystal structure of release fa trnas and mRNA bound to the ribosome. This file contains th subunit from a crystal structure of release factor rf1, trn mRNA bound to the ribosome and is described in remark 400.
75. " " " " " "  = 2b9p:T *
50s ribosomal subunit from a crystal structure of the riboso complex with trnas and mRNA with a stop codon in the a-site file contains the 50s subunit from a crystal structure of t ribosome in complex with trnas and mRNA with a stop codon i site and is described in remark 400.
76. 200 50.9% 53 66 304.3 5.6e-10 3j21:V * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
77. " " " " " "  = 3j44:V *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
78. 118 34.0% 47 53 186.4 0.0021 2zkr:u Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
79. 121 30.0% 60 124 186.0 0.0021 3j3b:W Structure of the human 60s ribosomal proteins
80. 119 33.9% 62 130 182.9 0.0032 3j39:W Structure of the d. Melanogaster 60s ribosomal proteins
81. 107 32.7% 55 61 169.6 0.018 4a17:T * T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 2.
82. " " " " " "  = 4a1a:T *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 3.
83. " " " " " "  = 4a1c:T *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 4.
84. " " " " " "  = 4a1e:T *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 1
85. 103 30.9% 55 75 162.7 0.043 3iz5:Z * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
86. " " " " " "  = 3izr:Z *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
87. " " " " " "  = 3j61:W *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
88. 93 33.3% 45 45 151.0 0.19 3jyw:S Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
89. 93 33.3% 45 53 150.1 0.22 1k5y:S * Structure of the translating 80s ribosome from yeast, obtained by docking atomic models for RNA and protein components into a 15a cryo-em map. This file 1k5y contains the 60s ribosomal subunit. The file 1k5x contains the 40s ribosomal subunit, the p-site bound tRNA and the mRNA codon.
90. " " " " " "  = 1s1i:S *
Structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 a cryo-em map. This file, 1s1i, contains 60s subunit. The 40s ribosomal subunit is in file 1s1h.
91. 93 33.3% 45 56 149.8 0.23 2x7n:D Mechanism of eif6s anti-association activity
92. 93 33.3% 45 59 149.5 0.23 3o58:V * Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
93. " " " " " "  = 3o5h:V *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
94. 93 33.3% 45 73 148.3 0.27 3izc:Z * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
95. " " " " " "  = 3izs:Z *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
96. 93 33.3% 45 98 146.7 0.33 3u5e:W The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
97. 93 33.3% 45 135 144.9 0.42 3u5i:W * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
98. " " " " " "  = 4b6a:W *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
99. " " " " " "  = 4byn:W *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
100. " " " " " "  = 4byu:W *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
101. 87 33.8% 65 154 135.5 1.4 1do5:A Human copper chaperone for superoxide dismutase domain ii
102. 81 33.3% 51 82 130.2 2.8 2fc7:A Solution structure of the zz domain of zzz3 protein

Number of sequences: 102

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 78 32.4% 74 392 117.2 15 3k2q:A Crystal structure of pyrophosphate-dependent phosphofructokinase from marinobacter aquaeolei, northeast structural genomics consortium target mqr88
2. 72 27.1% 59 100 116.1 17 3zf7:Y High-resolution cryo-electron microscopy structure of the tr brucei ribosome
3. 69 29.0% 62 65 114.1 22 1lv3:A Solution nmr structure of zinc finger protein yacg from escherichia coli. Northeast structural genomics consortium target et92.
4. 69 47.4% 19 79 113.0 25 1exk:A Solution structure of the cysteine-rich domain of the escherichia coli chaperone protein dnaj.
5. 68 32.5% 40 73 112.0 29 2ma7:A Solution nmr structure of zinc finger protein eos from homo northeast structural genomics consortium (nesg) target hr79
6. 72 28.3% 60 329 109.5 40 3fvz:A * Structure of peptidyl-alpha-hydroxyglycine alpha-amidating l
7. " " " " " "  = 3fw0:A *
Structure of peptidyl-alpha-hydroxyglycine alpha-amidating lyase (pal) bound to alpha-hydroxyhippuric acid (non- peptidic substrate)
8. 65 42.4% 33 61 108.6 44 1iq9:A * Crystal structure at 1.8 a of toxin a from naja nigricollis venom
9. " " " " " "  = 1nea:A *
Three-dimensional solution structure of a curaremimetic toxin from naja nigricollis venom: a proton nmr and molecular modeling study
10. 65 42.4% 33 62 108.5 45 3nds:A Crystal structure of engineered naja nigricollis toxin alpha
11. 70 33.3% 51 247 108.2 47 2bkk:A Crystal structure of aminoglycoside phosphotransferase aph (3')-iiia in complex with the inhibitor ar_3a
12. 70 33.3% 51 260 107.9 49 1j7i:A Crystal structure of 3',5"-aminoglycoside phosphotransferase type iiia apoenzyme
13. 70 33.3% 51 263 107.8 49 1j7l:A * Crystal structure of 3',5"-aminoglycoside phosphotransferase type iiia adp complex
14. " " " " " "  = 1j7u:A *
Crystal structure of 3',5"-aminoglycoside phosphotransferase type iiia amppnp complex
15. " " " " " "  = 1l8t:A *
Crystal structure of 3',5"-aminoglycoside phosphotransferase type iiia adp kanamycin a complex
16. " " " " " "  = 1l8u:A *
Crystal structure of 3',5"-aminoglycoside phosphotransferase type iiia adp neomycin b complex
17. " " " " " "  = 2b0q:A *
Crystal structure of 3',5"-aminoglycoside phosphotransferase type iiia adp neomycin b complex
18. 70 33.3% 51 262 107.8 49 2bkk:C Crystal structure of aminoglycoside phosphotransferase aph (3')-iiia in complex with the inhibitor ar_3a
19. 70 33.3% 51 263 107.8 49 3h8p:A Crystal structure of 3',5"-aminoglycoside phosphotransferase amppnp butirosin a complex
20. 70 33.3% 51 261 107.8 49 3q2j:A Crystal structure of 3',5"-aminoglycoside phosphotransferase protein kinase inhibitor cki-7 complex
21. 70 33.3% 51 263 107.8 49 3tm0:A Crystal structure of 3',5"-aminoglycoside phosphotransferase amppnp butirosin a complex

Number of sequences: 21

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer