spacer
spacer

SAS results for UniProt accession no. P12734

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P12734 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P12734 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 11 unique sequences (including 3 consensus sequences) giving 80 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P12734 -----------------------------------------------------------------    50S ribosomal protein L21e OS=Haloarcula marismortui  ...
1ffk:N*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:R*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3j61:T -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
3iz5:U*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
2kj6:A -----------------------------------------------------------------    Nmr solution structure of a tubulin folding cofactor b  ...
2qwu:A -----------------------------------------------------------------    Crystal structure of f. Tularensis pathogenicity island  ...
4nn3:A -----------------------------------------------------------------    Crystal structure of a trap periplasmic solute binding  ...
4l9l:C iqrppkiqvysrhppylncyygfhppqieeqsdlsfskdwsfyllshascrvkhvtleqprivkw    Crystal structure of a human valpha7.2/vbeta13.2 mait tcr  ...
3s4o:A -----------------------------------------------------------------    Protein tyrosine phosphatase (putative) from leishmania majo
1idu:A -----------------------------------------------------------------    Crystal structure of the peroxide form of the vanadium-  ...
3bbo:D -----------------------------------------------------------------    Homology model for the spinach chloroplast 50s subunit  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P12734 -----------------------------------------------------------------    50S ribosomal protein L21e OS=Haloarcula marismortui  ...
1ffk:N*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:R*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3j61:T -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
3iz5:U*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
2kj6:A -----------------------------------------------------------------    Nmr solution structure of a tubulin folding cofactor b  ...
2qwu:A -----------------------------------------------------------------    Crystal structure of f. Tularensis pathogenicity island  ...
4nn3:A -----------------------------------------------------------------    Crystal structure of a trap periplasmic solute binding  ...
4l9l:C drrthslryfrlgisepgygipefisagyvdshpitmynsqlxepralwmeenlapdhwerytql    Crystal structure of a human valpha7.2/vbeta13.2 mait tcr  ...
3s4o:A -----------------------------------------------------------------    Protein tyrosine phosphatase (putative) from leishmania majo
1idu:A --------------------svtpiplpkidepeeyntnyilfwnhvglelnrvthtvggpltgp    Crystal structure of the peroxide form of the vanadium-  ...
3bbo:D ------------------------------------------------------rtrskrfleiq    Homology model for the spinach chloroplast 50s subunit  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P12734 -----------------------------------------------------------------    50S ribosomal protein L21e OS=Haloarcula marismortui  ...
1ffk:N*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:R*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3j61:T -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
3iz5:U*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
2kj6:A -----------------------------------------------------------------    Nmr solution structure of a tubulin folding cofactor b  ...
2qwu:A -----------------------------------------------------------------    Crystal structure of f. Tularensis pathogenicity island  ...
4nn3:A -----------------------------------------------------------------    Crystal structure of a trap periplasmic solute binding  ...
4l9l:C lrgwqqafkvelkqlqhhynhsgfhtyqrmigcelledgsitgflqyaydgqdflifnkdtlswm    Crystal structure of a human valpha7.2/vbeta13.2 mait tcr  ...
3s4o:A -----------------------------------------------------------mnatli    Protein tyrosine phosphatase (putative) from leishmania majo
1idu:A plsaralgmlhlaihdayfsicpptdfttflspdtenaayrlpspngandarqavagaalkmlss    Crystal structure of the peroxide form of the vanadium-  ...
3bbo:D klreikqeydlktalslmkqmsstkfvetaeahfrlnidpkyndqqlratvslpkgtgktvkiav    Homology model for the spinach chloroplast 50s subunit  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P12734 ---------------------------------------------mpssngplegtrg-klkn--    50S ribosomal protein L21e OS=Haloarcula marismortui  ...
1ffk:N*----------------------------------------------pssngplegtrg-klkn--×68 Crystal structure of the large ribosomal subunit from  ...
3j21:R*----------------------------------------------qkahsfrrktrk-klsk--×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3j61:T ---------------------------------------------mpaghglrsrtrd-lfar--    Localization of the large subunit ribosomal proteins into a  ...
3iz5:U*---------------------------------------------mpaghglrsrtrd-lfar--×2  Localization of the large subunit ribosomal proteins into a  ...
2kj6:A --------------mghhhhhhshgddsvhlhithanlksfsadarfspqmsveavke-klwk--    Nmr solution structure of a tubulin folding cofactor b  ...
2qwu:A -----------------------------------------------------------------    Crystal structure of f. Tularensis pathogenicity island  ...
4nn3:A ---------------------------------------------------kyearig-hlespl    Crystal structure of a trap periplasmic solute binding  ...
4l9l:C amdnvadiirrvweanrhelqyqknwleeeciawlkrfleygkdalqrteppkvrvnh-kttl--    Crystal structure of a human valpha7.2/vbeta13.2 mait tcr  ...
3s4o:A dccdpqkpsrvlfhflildapspsnlptyikelqhrgvrhlvrvcgptydatlvksrgidvhs--    Protein tyrosine phosphatase (putative) from leishmania majo
1idu:A lymkpveqpnpnpganisdnayaqlglvldrsvleapggvdresasfmfgedvadvff-alln--    Crystal structure of the peroxide form of the vanadium-  ...
3bbo:D laqgdkideakaagadivggeelieqikggfmdfdkliatsdmmakvaslgrilgprg--lmp--    Homology model for the spinach chloroplast 50s subunit  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P12734 kpr---drgtsp-pq--ravee----fdd-gekvh----lkidps----vpng------rfhp--    50S ribosomal protein L21e OS=Haloarcula marismortui  ...
1ffk:N*kpr---drgtsp-pq--ravee----fdd-gekvh----lkidps----vpng------rfhp--×68 Crystal structure of the large ribosomal subunit from  ...
3j21:R*hpr---rrglpp-lt--rflqe----fev-gqrvh----ivieps----yhkg------mpdp--×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3j61:T pfr---kkgyip-lt--tylrt----ykv-gehvd----vkvnga----vhkg------mphk--    Localization of the large subunit ribosomal proteins into a  ...
3iz5:U*pfr---kkgyip-lt--tylrt----ykv-gehvd----vkvnga----vhkg------mphk--×2  Localization of the large subunit ribosomal proteins into a  ...
2kj6:A kc------gtsv-ns--malel----yddsgskva----vlsdds----rplg------ffsp--    Nmr solution structure of a tubulin folding cofactor b  ...
2qwu:A ----------ms-em--itrqq----vts-getih----vrtdpt----acig------s-hpnc    Crystal structure of f. Tularensis pathogenicity island  ...
4nn3:A qpr---hqglek-va--klvke----rtn-ge-ve----fkifps----sqlg------nqrq--    Crystal structure of a trap periplasmic solute binding  ...
4l9l:C ycr---aygfyp-pe--isinw----mkn-geeif----qdtd--------yg------gilp--    Crystal structure of a human valpha7.2/vbeta13.2 mait tcr  ...
3s4o:A wpf---ddg-ap-pt--ravldswlklld-telar----qqedps----vppp------tigv--    Protein tyrosine phosphatase (putative) from leishmania majo
1idu:A dprgasqegynptpg--ry--k----fdd--epthpvvlipvdpn----npngpkmpfrqyha--    Crystal structure of the peroxide form of the vanadium-  ...
3bbo:D tpk---a-gtvt-pnvaqavee----fkk-g-kve----frvdktgivhipfg------klnf--    Homology model for the spinach chloroplast 50s subunit  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P12734 rfdg--qtg-tvegkqgdaykvdivd--ggk--ektiivtaahlrrqe-----------------    50S ribosomal protein L21e OS=Haloarcula marismortui  ...
1ffk:N*rfdg--qtg-tvegkqgdaykvdivd--ggk--ektiivtaahlrrqe-----------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:R*rfhg--rtg-tvvgkrgeayiveikd--gsk--vktlfihpvhlrpqk-----------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3j61:T fyhg--rtg-rvwnvtkraigveinkqvgnriikkrihvrvehvqpsrcneeflqrklnndklka    Localization of the large subunit ribosomal proteins into a  ...
3iz5:U*fyhg--rtg-rvwnvtkraigveinkqvgnriikkrihvrvehvqpsrcneeflqrklnndklka×2  Localization of the large subunit ribosomal proteins into a  ...
2kj6:A -fdg--frl-hiidldp------------------------------------------------    Nmr solution structure of a tubulin folding cofactor b  ...
2qwu:A rmfi--dsl-tiagekldk-nivaid--gge--dvtkadsataaasvirmsitpgsinptisitl    Crystal structure of f. Tularensis pathogenicity island  ...
4nn3:A mnegv-qfg-tiegtvsaaaflggfn--pvv--simdipfllpvdrakaqelrqgkfgkallksf    Crystal structure of a trap periplasmic solute binding  ...
4l9l:C sgdgtyqtwvsvelqngdiyschveh--ggv--hmvlqgfq------------------------    Crystal structure of a human valpha7.2/vbeta13.2 mait tcr  ...
3s4o:A hcva--glg-rapilvalalveygnv--sal--daialirekrkgainqtqmhwitkykr-----    Protein tyrosine phosphatase (putative) from leishmania majo
1idu:A pfyg--ktt-krfatqsehfladppg--lrs--nadetaeyddavrvaiamggaqalnstkrspw    Crystal structure of the peroxide form of the vanadium-  ...
3bbo:D eeed--lli-nlfatiksvetnkptg--akg--vywksahisssmgpsirlnire----------    Homology model for the spinach chloroplast 50s subunit  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P12734 -----------------------------------------------------------------    50S ribosomal protein L21e OS=Haloarcula marismortui  ...
1ffk:N*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:R*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3j61:T eakvrgevistkrqpagpkpgfmvegttietvtpipydvvndl----------------------    Localization of the large subunit ribosomal proteins into a  ...
3iz5:U*eakargevistkrqpagpkpgfmvegttietvtpipydvvndlkggy------------------×2  Localization of the large subunit ribosomal proteins into a  ...
2kj6:A -----------------------------------------------------------------    Nmr solution structure of a tubulin folding cofactor b  ...
2qwu:A gvliksnvrtkieekvssilqasatdmkiklgnsnkkqeyktdeawgimidlsnlelypisakaf    Crystal structure of f. Tularensis pathogenicity island  ...
4nn3:A dsrgfkaiatwpngrknftsnkpistiadykgqsfrvmdskilieqfaaigasaialpfgelyta    Crystal structure of a trap periplasmic solute binding  ...
4l9l:C -----------------------------------------------------------------    Crystal structure of a human valpha7.2/vbeta13.2 mait tcr  ...
3s4o:A -----------------------------------------------------------------    Protein tyrosine phosphatase (putative) from leishmania majo
1idu:A qtaqglywaydgsnligtpprfynqivrriavtykkeedlansevnnadfarlfalvdvactdag    Crystal structure of the peroxide form of the vanadium-  ...
3bbo:D -----------------------------------------------------------------    Homology model for the spinach chloroplast 50s subunit  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P12734 -----------------------------------------------------------------    50S ribosomal protein L21e OS=Haloarcula marismortui  ...
1ffk:N*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:R*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3j61:T -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
3iz5:U*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
2kj6:A -----------------------------------------------------------------    Nmr solution structure of a tubulin folding cofactor b  ...
2qwu:A sisieptelmgvskdgmryhiisidglttsqgslpvccaastdkgvakigyia------------    Crystal structure of f. Tularensis pathogenicity island  ...
4nn3:A lqngvvdgeenpldtiqrmkfyevqkylvtsehgamedyvlfnpsyweslpenyqkiivdtfiev    Crystal structure of a trap periplasmic solute binding  ...
4l9l:C -----------------------------------------------------------------    Crystal structure of a human valpha7.2/vbeta13.2 mait tcr  ...
3s4o:A -----------------------------------------------------------------    Protein tyrosine phosphatase (putative) from leishmania majo
1idu:A ifswkekwefefwrplsgvrddgrpdhgdpfwltlgapatntndipfkppfpaypsghatfggav    Crystal structure of the peroxide form of the vanadium-  ...
3bbo:D -----------------------------------------------------------------    Homology model for the spinach chloroplast 50s subunit  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P12734 -----------------------------------------------------------------    50S ribosomal protein L21e OS=Haloarcula marismortui  ...
1ffk:N*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:R*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3j61:T -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
3iz5:U*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
2kj6:A -----------------------------------------------------------------    Nmr solution structure of a tubulin folding cofactor b  ...
2qwu:A -----------------------------------------------------------------    Crystal structure of f. Tularensis pathogenicity island  ...
4nn3:A mpgveahkeqaqkdalevikkagvqvtplqaadraamrelmypktkaaylaragaqgqeliklye    Crystal structure of a trap periplasmic solute binding  ...
4l9l:C -----------------------------------------------------------------    Crystal structure of a human valpha7.2/vbeta13.2 mait tcr  ...
3s4o:A -----------------------------------------------------------------    Protein tyrosine phosphatase (putative) from leishmania majo
1idu:A fqmvrryyngrvgtwkddepdniaidmmiseelngvnrdlrqpydptapiedqpgivrtrivrhf    Crystal structure of the peroxide form of the vanadium-  ...
3bbo:D -----------------------------------------------------------------    Homology model for the spinach chloroplast 50s subunit  ...

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P12734 -----------------------------------------------------------------    50S ribosomal protein L21e OS=Haloarcula marismortui  ...
1ffk:N*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:R*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3j61:T -----------------------------------------------------------------    Localization of the large subunit ribosomal proteins into a  ...
3iz5:U*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
2kj6:A -----------------------------------------------------------------    Nmr solution structure of a tubulin folding cofactor b  ...
2qwu:A -----------------------------------------------------------------    Crystal structure of f. Tularensis pathogenicity island  ...
4nn3:A eeyariv----------------------------------------------------------    Crystal structure of a trap periplasmic solute binding  ...
4l9l:C -----------------------------------------------------------------    Crystal structure of a human valpha7.2/vbeta13.2 mait tcr  ...
3s4o:A -----------------------------------------------------------------    Protein tyrosine phosphatase (putative) from leishmania majo
1idu:A dsawelmfenaisriflgvhwrfdaaaardiliptttkdvyavdnngatvfqnvediryttrgtr    Crystal structure of the peroxide form of the vanadium-  ...
3bbo:D -----------------------------------------------------------------    Homology model for the spinach chloroplast 50s subunit  ...

                6         6         6       
                6         7         8       
       1234567890123456789012345678901234567                                Protein name
       ---------+---------+---------+-------                                ------------
P12734 -------------------------------------                                50S ribosomal protein L21e OS=Haloarcula marismortui  ...
1ffk:N*-------------------------------------                            ×68 Crystal structure of the large ribosomal subunit from  ...
3j21:R*-------------------------------------                            ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
3j61:T -------------------------------------                                Localization of the large subunit ribosomal proteins into a  ...
3iz5:U*-------------------------------------                            ×2  Localization of the large subunit ribosomal proteins into a  ...
2kj6:A -------------------------------------                                Nmr solution structure of a tubulin folding cofactor b  ...
2qwu:A -------------------------------------                                Crystal structure of f. Tularensis pathogenicity island  ...
4nn3:A -------------------------------------                                Crystal structure of a trap periplasmic solute binding  ...
4l9l:C -------------------------------------                                Crystal structure of a human valpha7.2/vbeta13.2 mait tcr  ...
3s4o:A -------------------------------------                                Protein tyrosine phosphatase (putative) from leishmania majo
1idu:A edeeglfpiggvplgieiadeifnnglkptppeiqpm                                Crystal structure of the peroxide form of the vanadium-  ...
3bbo:D -------------------------------------                                Homology model for the spinach chloroplast 50s subunit  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P12734. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 96 - - P12734 50S ribosomal protein L21e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl21e PE=1 SV=2
2. 648 100.0% 95 95 847.6 3e-40 1ffk:N * Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
3. " " " " " "  = 1jj2:P *
Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
4. " " " " " "  = 1k73:R *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
5. " " " " " "  = 1k8a:R *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
6. " " " " " "  = 1k9m:R *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
7. " " " " " "  = 1kc8:R *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
8. " " " " " "  = 1kd1:R *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
9. " " " " " "  = 1kqs:P *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
10. " " " " " "  = 1m1k:R *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
11. " " " " " "  = 1m90:R *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
12. " " " " " "  = 1n8r:R *
Structure of large ribosomal subunit in complex with virginiamycin m
13. " " " " " "  = 1nji:R *
Structure of chloramphenicol bound to the 50s ribosomal subunit
14. " " " " " "  = 1q7y:R *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
15. " " " " " "  = 1q81:R *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
16. " " " " " "  = 1q82:R *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
17. " " " " " "  = 1q86:R *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
18. " " " " " "  = 1qvf:P *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
19. " " " " " "  = 1qvg:P *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
20. " " " " " "  = 1s72:Q *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
21. " " " " " "  = 1vq4:Q *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
22. " " " " " "  = 1vq5:Q *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
23. " " " " " "  = 1vq6:Q *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
24. " " " " " "  = 1vq7:Q *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
25. " " " " " "  = 1vq8:Q *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
26. " " " " " "  = 1vq9:Q *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
27. " " " " " "  = 1vqk:Q *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
28. " " " " " "  = 1vql:Q *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
29. " " " " " "  = 1vqm:Q *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
30. " " " " " "  = 1vqn:Q *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
31. " " " " " "  = 1vqo:Q *
The structure of ccpmn bound to the large ribosomal subunit marismortui
32. " " " " " "  = 1vqp:Q *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1w2b:P *
Trigger factor ribosome binding domain in complex with 50s
34. " " " " " "  = 1yhq:Q *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
35. " " " " " "  = 1yi2:Q *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
36. " " " " " "  = 1yij:Q *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
37. " " " " " "  = 1yit:Q *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
38. " " " " " "  = 1yj9:Q *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
39. " " " " " "  = 1yjn:Q *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
40. " " " " " "  = 1yjw:Q *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
41. " " " " " "  = 2otj:Q *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
42. " " " " " "  = 2otl:Q *
Girodazole bound to the large subunit of haloarcula marismor
43. " " " " " "  = 2qa4:Q *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
44. " " " " " "  = 2qex:Q *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
45. " " " " " "  = 3cc2:Q *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
46. " " " " " "  = 3cc4:Q *
Co-crystal structure of anisomycin bound to the 50s ribosoma
47. " " " " " "  = 3cc7:Q *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
48. " " " " " "  = 3cce:Q *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
49. " " " " " "  = 3ccj:Q *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
50. " " " " " "  = 3ccl:Q *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
51. " " " " " "  = 3ccm:Q *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
52. " " " " " "  = 3ccq:Q *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
53. " " " " " "  = 3ccr:Q *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
54. " " " " " "  = 3ccs:Q *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
55. " " " " " "  = 3ccu:Q *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
56. " " " " " "  = 3ccv:Q *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
57. " " " " " "  = 3cd6:Q *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
58. " " " " " "  = 3cma:Q *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
59. " " " " " "  = 3cme:Q *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
60. " " " " " "  = 3cpw:P *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
61. " " " " " "  = 3cxc:P *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
62. " " " " " "  = 3g4s:Q *
Co-crystal structure of tiamulin bound to the large ribosoma
63. " " " " " "  = 3g6e:Q *
Co-crystal structure of homoharringtonine bound to the large subunit
64. " " " " " "  = 3g71:Q *
Co-crystal structure of bruceantin bound to the large riboso subunit
65. " " " " " "  = 3i55:Q *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
66. " " " " " "  = 3i56:Q *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
67. " " " " " "  = 3ow2:P *
Crystal structure of enhanced macrolide bound to 50s ribosom
68. " " " " " "  = 4adx:Q *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
69. " " " " " "  = 4hub:Q *
The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
70. 277 50.0% 86 95 369.7 1.3e-13 3j21:R * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
71. " " " " " "  = 3j44:R *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
72. 105 27.8% 97 160 144.8 0.43 3j61:T Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
73. 105 27.8% 97 164 144.6 0.43 3iz5:U * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
74. " " " " " "  = 3izr:U *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
75. 89 43.4% 53 97 127.4 3.9 2kj6:A Nmr solution structure of a tubulin folding cofactor b obtained from arabidopsis thaliana: northeast structural genomics consortium target ar3436a
76. 84 29.1% 55 207 116.1 17 2qwu:A Crystal structure of f. Tularensis pathogenicity island protein c
77. 85 36.1% 61 311 114.7 20 4nn3:A Crystal structure of a trap periplasmic solute binding prote desulfovibrio salexigens (desal_2161), target efi-510109, w orotic acid
78. 85 31.2% 64 328 114.4 21 4l9l:C Crystal structure of a human valpha7.2/vbeta13.2 mait tcr in with bovine mr1
79. 81 35.8% 53 163 113.8 23 3s4o:A Protein tyrosine phosphatase (putative) from leishmania majo
80. 84 32.0% 75 576 109.5 40 1idu:A Crystal structure of the peroxide form of the vanadium- containing chloroperoxidase from curvularia inaequalis
81. 79 36.2% 58 227 109.0 42 3bbo:D Homology model for the spinach chloroplast 50s subunit fitte cryo-em map of the 70s chlororibosome

Number of sequences: 81

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer