spacer
spacer

SAS results for UniProt accession no. P32411

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P32411 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P32411 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 31 unique sequences (including 12 consensus sequences) giving 189 sequence matches in all. The 82 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P32411 -----------------------------------------------------------------    50S ribosomal protein L44e OS=Haloarcula marismortui  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a18:C*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2zkr:4 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:o -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:o -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
1k5y:1*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:Z -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3j0l:F*-----------------------------------------------------------------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3izc:r*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3iz5:r*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3zf7:t -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
2ct0:A -----------------------------------------------------------------    Solution structure of the ring domain of the non-smc  ...
2mbs:A -----------------------------------------------------------------    Nmr solution structure of oxidized kpdsba
4mcu:A -----------------------------------------------------------------    Crystal structure of disulfide oxidoreductase from  ...
2cot:A -----------------------------------------------------------------    Solution structure of the first and second zf-c2h2 domain  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3nw0:A gvmtdvhrrflqllmthgvleewdvkrlqthcykvhnatvdkledfinninsvleslyieikrgv    Crystal structure of mageg1 and nse1 complex

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P32411 -----------------------------------------------------------------    50S ribosomal protein L44e OS=Haloarcula marismortui  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a18:C*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2zkr:4 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:o -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:o -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
1k5y:1*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:Z -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3j0l:F*-----------------------------------------------------------------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3izc:r*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3iz5:r*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3zf7:t -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
2ct0:A -----------------------------------------------------------------    Solution structure of the ring domain of the non-smc  ...
2mbs:A -----------------------------------------------------------------    Nmr solution structure of oxidized kpdsba
4mcu:A -----------------------------------------------------------------    Crystal structure of disulfide oxidoreductase from  ...
2cot:A -----------------------------------------------------------------    Solution structure of the first and second zf-c2h2 domain  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3nw0:A teddgrpiyalvnlattsiskmatdfaeneldlfrkaleliidsetgfasstnilnlvdqlkgkk    Crystal structure of mageg1 and nse1 complex

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P32411 -----------------------------------------------------------------    50S ribosomal protein L44e OS=Haloarcula marismortui  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a18:C*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2zkr:4 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:o -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:o -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
1k5y:1*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:Z -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3j0l:F*-----------------------------------------------------------------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3izc:r*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3iz5:r*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3zf7:t -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
2ct0:A ---------------------------------gssgssgretypdavkicnichslliqgqsce    Solution structure of the ring domain of the non-smc  ...
2mbs:A --------------------------------------------------------snaqitdgk    Nmr solution structure of oxidized kpdsba
4mcu:A ---------------------------------------------------------naqitdgk    Crystal structure of disulfide oxidoreductase from  ...
2cot:A -----------------------------------------------------------------    Solution structure of the first and second zf-c2h2 domain  ...
3u5e:g*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:i*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3nw0:A mrkkeaeqvlqkfvqnkwliekegeftlhgrailemeqyiretypdavkicnichslliqgqsce    Crystal structure of mageg1 and nse1 complex

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P32411 ------------mqmprrfntycp--h--cnehqe--hevekvrsgrqt-gmkwidrqre-rn-s    50S ribosomal protein L44e OS=Haloarcula marismortui  ...
1ffk:Z*------------mqmprrfntycp--h--cnehqe--hevekvrsgrqt-gmkwidrqre-rn-s×68 Crystal structure of the large ribosomal subunit from  ...
3j21:j*------------mkypkqirtycp--f--ckkhti--hkvervkkrprs-elsagqrrfr-rilk×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a18:C*------------vqvpktrktyck--k--cnshtn--hkvsqykkskes-thaqgrrrydmkq-s×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2zkr:4 ------------vnvpktrrtfck--k--cgkhqp--hkvtqykkgkds-lyaqgkrryd-rkqs    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:o ------------vnvpktrrtfck--k--cgkhqp--hkvtqykkgkds-lyaqgkrryd-rkqs    Structure of the human 60s ribosomal proteins
3j39:o -----------mvnvpkqrrtfck--k--ckvhkl--hkvtqykkskerkgaqgrrrydr-kq-q    Structure of the d. Melanogaster 60s ribosomal proteins
1k5y:1*------------vnvpktrktyck--gktcrkhtq--hkvtqykagkas-lfaqgkrryd-rkqs×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:Z ------------vnvpktrktyck--gktcrkhtq--hkvtqykagkas-lfaqgkrryd-rkqs    Structure of the 60s proteins for eukaryotic ribosome based  ...
3j0l:F*------------vnvpktrktyck--gktcrkhtq--hkvtqykagkas-lfaqgkrryd-rkqs×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3izc:r*-----------mvnvpktrktyck--gktcrkhtq--hkvtqykagkas-lfaqgkrryd-rkqs×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*------------vnvpktrktyck--gktcrkhtq--hkvtqykagkas-lfaqgkrryd-rkqs×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3iz5:r*-----------mvnvpktkktyck--nkecrkhtl--hkvtqykkgkds-lsaqgkrryd-rkqs×3  Localization of the large subunit ribosomal proteins into a  ...
3zf7:t ------------vnypkkkkmhcpder--cnahks--fkvvqykagkar-lyargkrryd-rkqs    High-resolution cryo-electron microscopy structure of the  ...
2ct0:A tcgirmhlpcvakyfqsnaeprcp--h--cndywp--heipk--sgpss-g--------------    Solution structure of the ring domain of the non-smc  ...
2mbs:A qyitldkpiagepqvleffsfycp--h--cyqfeevlhvsdnvrqklpe-gtkmtkyhve-fl-g    Nmr solution structure of oxidized kpdsba
4mcu:A qyitldkpiagepqvleffsfycp--h--cyqfeevlhvsdnvrqklpe-gtkmtkyhve-fl-g    Crystal structure of disulfide oxidoreductase from  ...
2cot:A ------------------------------------------gssgssg-rsewqqrerr-ry-k    Solution structure of the first and second zf-c2h2 domain  ...
3u5e:g*--------------------------------------------------aqrvtfrrrn-py-n×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:i*------------------------------------------------m-aqrvtfrrrn-py-n×2  Localization of the large subunit ribosomal proteins into a  ...
3nw0:A tcgirmhlpcvakyfqsnaeprcp--h--cndywp--heipkvfdpe------------------    Crystal structure of mageg1 and nse1 complex

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P32411 gigndgk--fskvpgg---dkp--tkktdlkyrcgecgkahlr-egwragrlefqe---------    50S ribosomal protein L44e OS=Haloarcula marismortui  ...
1ffk:Z*gigndgk--fskvpgg---dkp--tkktdlkyrcgecgkahlr-egwragrlefqe---------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:j*gyggfpr---pkpegr---ekp--vkkldlrfrctecgkahtrgrgfrvkkfelveg--------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a18:C*gfggqtkpifrkka------kt--tkkvalkfdcttcktkrvi-pikrcktivfmditqikkakv×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2zkr:4 gyggqtkpifrk---k---akt--tkkivlrlecvepncrskr-mlaikrckhfel---------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:o gyggqtkpifrk---k---akt--tkkivlrlecvepncrskr-mlaikrckhfelggdkkrkgq    Structure of the human 60s ribosomal proteins
3j39:o gfggqtkpifrkka------kt--tkkivlrmecteckyrkqt-plkrckhfelggdkkrkgqmi    Structure of the d. Melanogaster 60s ribosomal proteins
1k5y:1*gfggqtkpvfhkka------kt--tkkvvlrlecvkcktraql-tlkrckhfe------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:Z gfggqtkpvfhkka------kt--tkkvvlrlecvkcktraql-tlkrckhfel-----------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3j0l:F*gfggqtkpvfhkka------kt--tkkvvlrlecvkcktraql-tlkrckhfelgge--------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3izc:r*gfggqtkpvfhkka------kt--tkkvvlrlecvkcktraql-tlkrckhfelggekkqkgqal×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*gfggqtkpvfhkka------kt--tkkvvlrlecvkcktraql-tlkrckhfelggekkqkgqal×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3iz5:r*gyggqtkpvfhkka------kt--tkkivlklqcqsckhysqh-pikrckhfeiggdkkgkgtsl×3  Localization of the large subunit ribosomal proteins into a  ...
3zf7:t gyggqtkpifhkka------kt--tkkivlklqcsncksiiqn-vlkrtkhfelndkkktgnkdp    High-resolution cryo-electron microscopy structure of the  ...
2ct0:A -----------------------------------------------------------------    Solution structure of the ring domain of the non-smc  ...
2mbs:A plgkdlt--qawavai---alg--vedkitapmfeavqktqtv-qsvadirkvfvdagvkgedyd    Nmr solution structure of oxidized kpdsba
4mcu:A plgkdlt--qawavai---alg--vedkitapmfeavqktqtv-qsvadirkvfvdagvkgedyd    Crystal structure of disulfide oxidoreductase from  ...
2cot:A cdecgks--fshssdl---skhrrthtgekpykcdecgkafiq-rshlighhrvhtgsgpssg--    Solution structure of the first and second zf-c2h2 domain  ...
3u5e:g*trsnkik--vvktpggilraqh--vkklatrpkcgdcgsalqg-istlrprqyatvskthktvsr×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:i*trsnkik--vvktpggilraqh--vkklatrpkcgdcgsalqg-istlrprqyatvskthktvsr×2  Localization of the large subunit ribosomal proteins into a  ...
3nw0:A -----------------------------------------------------------------    Crystal structure of mageg1 and nse1 complex

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P32411 -----------------------------------------------------------------    50S ribosomal protein L44e OS=Haloarcula marismortui  ...
1ffk:Z*-----------------------------------------------------------------×68 Crystal structure of the large ribosomal subunit from  ...
3j21:j*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a18:C*nk---------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2zkr:4 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:o viqf-------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:o qf---------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
1k5y:1*-----------------------------------------------------------------×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:Z -----------------------------------------------------------------    Structure of the 60s proteins for eukaryotic ribosome based  ...
3j0l:F*-----------------------------------------------------------------×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3izc:r*qf---------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*qf---------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3iz5:r*f----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
3zf7:t tw---------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
2ct0:A -----------------------------------------------------------------    Solution structure of the ring domain of the non-smc  ...
2mbs:A aawnsfvvkslvaqqekaaadlqlqgvpamyvngkyqlnpqgmdtsnmdvfvaqyadtvkqlvek    Nmr solution structure of oxidized kpdsba
4mcu:A aawnsfvvkslvaqqekaaadlqlqgvpamyvngkyqlnpqgmdtsnmdvfvaqyadtvkqlvek    Crystal structure of disulfide oxidoreductase from  ...
2cot:A -----------------------------------------------------------------    Solution structure of the first and second zf-c2h2 domain  ...
3u5e:g*ayggsrcancvkeriiraflieeqkivkkvvkeqteaak--------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:i*ayggsrcancvkeriiraflieeqkivkkvvkeqteaakksekk---------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3nw0:A -----------------------------------------------------------------    Crystal structure of mageg1 and nse1 complex

        
        
       1                                                                    Protein name
       -                                                                    ------------
P32411 -                                                                    50S ribosomal protein L44e OS=Haloarcula marismortui  ...
1ffk:Z*-                                                                ×68 Crystal structure of the large ribosomal subunit from  ...
3j21:j*-                                                                ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4a18:C*-                                                                ×4  T.Thermophila 60s ribosomal subunit in complex with  ...
2zkr:4 -                                                                    Structure of a mammalian ribosomal 60s subunit within an  ...
3j3b:o -                                                                    Structure of the human 60s ribosomal proteins
3j39:o -                                                                    Structure of the d. Melanogaster 60s ribosomal proteins
1k5y:1*-                                                                ×2  Structure of the translating 80s ribosome from yeast,  ...
3jyw:Z -                                                                    Structure of the 60s proteins for eukaryotic ribosome based  ...
3j0l:F*-                                                                ×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
3izc:r*-                                                                ×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:o*-                                                                ×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3iz5:r*-                                                                ×3  Localization of the large subunit ribosomal proteins into a  ...
3zf7:t -                                                                    High-resolution cryo-electron microscopy structure of the  ...
2ct0:A -                                                                    Solution structure of the ring domain of the non-smc  ...
2mbs:A k                                                                    Nmr solution structure of oxidized kpdsba
4mcu:A -                                                                    Crystal structure of disulfide oxidoreductase from  ...
2cot:A -                                                                    Solution structure of the first and second zf-c2h2 domain  ...
3u5e:g*-                                                                ×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3izc:i*-                                                                ×2  Localization of the large subunit ribosomal proteins into a  ...
3nw0:A -                                                                    Crystal structure of mageg1 and nse1 complex

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P32411. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 92 - - P32411 50S ribosomal protein L44e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl44e PE=1 SV=1
2. 676 100.0% 92 92 879.0 5.5e-42 1ffk:Z * Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
3. " " " " " "  = 1jj2:2 *
Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
4. " " " " " "  = 1k73:4 *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
5. " " " " " "  = 1k8a:4 *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
6. " " " " " "  = 1k9m:4 *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
7. " " " " " "  = 1kc8:4 *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
8. " " " " " "  = 1kd1:4 *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
9. " " " " " "  = 1kqs:2 *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
10. " " " " " "  = 1m1k:4 *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
11. " " " " " "  = 1m90:4 *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
12. " " " " " "  = 1n8r:4 *
Structure of large ribosomal subunit in complex with virginiamycin m
13. " " " " " "  = 1nji:4 *
Structure of chloramphenicol bound to the 50s ribosomal subunit
14. " " " " " "  = 1q7y:4 *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
15. " " " " " "  = 1q81:4 *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
16. " " " " " "  = 1q82:4 *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
17. " " " " " "  = 1q86:4 *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
18. " " " " " "  = 1qvf:2 *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
19. " " " " " "  = 1qvg:2 *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
20. " " " " " "  = 1s72:3 *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
21. " " " " " "  = 1vq4:3 *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
22. " " " " " "  = 1vq5:3 *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
23. " " " " " "  = 1vq6:3 *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
24. " " " " " "  = 1vq7:3 *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
25. " " " " " "  = 1vq8:3 *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
26. " " " " " "  = 1vq9:3 *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
27. " " " " " "  = 1vqk:3 *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
28. " " " " " "  = 1vql:3 *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
29. " " " " " "  = 1vqm:3 *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
30. " " " " " "  = 1vqn:3 *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
31. " " " " " "  = 1vqo:3 *
The structure of ccpmn bound to the large ribosomal subunit marismortui
32. " " " " " "  = 1vqp:3 *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1w2b:2 *
Trigger factor ribosome binding domain in complex with 50s
34. " " " " " "  = 1yhq:3 *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
35. " " " " " "  = 1yi2:3 *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
36. " " " " " "  = 1yij:3 *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
37. " " " " " "  = 1yit:3 *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
38. " " " " " "  = 1yj9:3 *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
39. " " " " " "  = 1yjn:3 *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
40. " " " " " "  = 1yjw:3 *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
41. " " " " " "  = 2otj:3 *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
42. " " " " " "  = 2otl:3 *
Girodazole bound to the large subunit of haloarcula marismor
43. " " " " " "  = 2qa4:3 *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
44. " " " " " "  = 2qex:3 *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
45. " " " " " "  = 3cc2:3 *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
46. " " " " " "  = 3cc4:3 *
Co-crystal structure of anisomycin bound to the 50s ribosoma
47. " " " " " "  = 3cc7:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
48. " " " " " "  = 3cce:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
49. " " " " " "  = 3ccj:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
50. " " " " " "  = 3ccl:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
51. " " " " " "  = 3ccm:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
52. " " " " " "  = 3ccq:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
53. " " " " " "  = 3ccr:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
54. " " " " " "  = 3ccs:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
55. " " " " " "  = 3ccu:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
56. " " " " " "  = 3ccv:3 *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
57. " " " " " "  = 3cd6:3 *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
58. " " " " " "  = 3cma:3 *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
59. " " " " " "  = 3cme:3 *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
60. " " " " " "  = 3cpw:2 *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
61. " " " " " "  = 3cxc:2 *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
62. " " " " " "  = 3g4s:3 *
Co-crystal structure of tiamulin bound to the large ribosoma
63. " " " " " "  = 3g6e:3 *
Co-crystal structure of homoharringtonine bound to the large subunit
64. " " " " " "  = 3g71:3 *
Co-crystal structure of bruceantin bound to the large riboso subunit
65. " " " " " "  = 3i55:3 *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
66. " " " " " "  = 3i56:3 *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
67. " " " " " "  = 3ow2:2 *
Crystal structure of enhanced macrolide bound to 50s ribosom
68. " " " " " "  = 4adx:3 *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
69. " " " " " "  = 4hub:3 *
The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
70. 238 39.4% 94 94 317.8 1e-10 3j21:j * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
71. " " " " " "  = 3j44:j *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
72. 146 32.5% 77 103 199.4 0.00039 4a18:C * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
73. " " " " " "  = 4a19:C *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
74. " " " " " "  = 4a1b:C *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
75. " " " " " "  = 4a1d:C *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
76. 128 31.6% 76 92 176.9 0.007 2zkr:4 Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
77. 128 31.6% 76 105 176.3 0.0077 3j3b:o Structure of the human 60s ribosomal proteins
78. 124 28.6% 77 104 171.2 0.015 3j39:o Structure of the d. Melanogaster 60s ribosomal proteins
79. 121 30.4% 79 91 168.0 0.022 1k5y:1 * Structure of the translating 80s ribosome from yeast, obtained by docking atomic models for RNA and protein components into a 15a cryo-em map. This file 1k5y contains the 60s ribosomal subunit. The file 1k5x contains the 40s ribosomal subunit, the p-site bound tRNA and the mRNA codon.
80. " " " " " "  = 1s1i:Z *
Structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 a cryo-em map. This file, 1s1i, contains 60s subunit. The 40s ribosomal subunit is in file 1s1h.
81. 121 30.4% 79 92 168.0 0.022 3jyw:Z Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
82. 121 30.4% 79 95 167.8 0.023 3j0l:F * Core of mammalian 80s pre-ribosome in complex with trnas fit 9.8a cryo-em map: classic pre state 1
83. " " " " " "  = 3j0o:F *
Core of mammalian 80s pre-ribosome in complex with trnas fit 9a cryo-em map: classic pre state 2
84. " " " " " "  = 3o58:f *
Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
85. " " " " " "  = 3o5h:f *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
86. 121 30.4% 79 106 167.3 0.024 3izc:r * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
87. " " " " " "  = 3izs:r *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
88. 121 30.4% 79 105 167.3 0.024 3u5e:o * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
89. " " " " " "  = 3u5i:o *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
90. " " " " " "  = 4b6a:o *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
91. " " " " " "  = 4byn:o *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
92. " " " " " "  = 4byu:o *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
93. 118 31.6% 79 105 163.5 0.04 3iz5:r * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
94. " " " " " "  = 3izr:r *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
95. " " " " " "  = 3j61:o *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
96. 117 30.4% 79 105 162.2 0.047 3zf7:t High-resolution cryo-electron microscopy structure of the tr brucei ribosome
97. 86 50.0% 22 74 124.3 6 2ct0:A Solution structure of the ring domain of the non-smc element 1 protein
98. 89 32.0% 50 190 123.3 6.9 2mbs:A Nmr solution structure of oxidized kpdsba
99. 89 32.0% 50 188 123.3 6.8 4mcu:A Crystal structure of disulfide oxidoreductase from klebsiell pneumoniae in reduced state
100. 83 29.0% 62 77 120.2 10 2cot:A Solution structure of the first and second zf-c2h2 domain of zinc finger protein 435
101. 84 34.9% 43 112 119.6 11 3u5e:g * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
102. " " " " " "  = 3u5i:g *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
103. " " " " " "  = 4b6a:g *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
104. " " " " " "  = 4byn:g *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
105. " " " " " "  = 4byu:g *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
106. 84 34.9% 43 118 119.3 11 3izc:i * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
107. " " " " " "  = 3izs:i *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
108. 85 60.0% 15 236 117.0 15 3nw0:A Crystal structure of mageg1 and nse1 complex

Number of sequences: 108

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 77 46.2% 26 42 115.6 18 2ytb:A Solution structure of c2h2 type zinc finger domain 5 in zinc finger protein 32
2. 78 54.2% 24 58 115.3 19 2o13:A Solution structure of thE C-terminal lim domain of mlp/crp3
3. 76 60.0% 20 46 113.9 23 2yrj:A Solution structure of the c2h2-type zinc finger domain (781- 813) from zinc finger protein 473
4. 75 35.0% 40 46 112.6 27 2ytk:A Solution structure of the c2h2 type zinc finger (region 396- 428) of human zinc finger protein 347
5. 79 28.0% 50 185 110.6 35 3l9s:A Crystal structure of salmonella enterica serovar typhimurium
6. 73 50.0% 24 44 110.3 36 2eox:A Solution structure of the c2h2 type zinc finger (region 315- 345) of human zinc finger protein 473
7. 80 26.9% 52 274 109.9 38 1ti2:B * Crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici
8. " " " " " "  = 1ti4:B *
Crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici complexed with pyrogallol
9. " " " " " "  = 1ti6:B *
Crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene
10. " " " " " "  = 1vld:N *
Crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici
11. " " " " " "  = 1vle:N *
Crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici complexed with pyrogallol
12. " " " " " "  = 1vlf:N *
Crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene
13. 80 27.1% 70 337 108.8 44 1ffk:B Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
14. 80 27.1% 70 337 108.8 44 1jj2:B * Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
15. " " " " " "  = 1k73:D *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
16. " " " " " "  = 1k8a:D *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
17. " " " " " "  = 1k9m:D *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
18. " " " " " "  = 1kc8:D *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
19. " " " " " "  = 1kd1:D *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
20. " " " " " "  = 1kqs:B *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
21. " " " " " "  = 1m1k:D *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
22. " " " " " "  = 1m90:D *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
23. " " " " " "  = 1n8r:D *
Structure of large ribosomal subunit in complex with virginiamycin m
24. " " " " " "  = 1nji:D *
Structure of chloramphenicol bound to the 50s ribosomal subunit
25. " " " " " "  = 1q7y:D *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
26. " " " " " "  = 1q81:D *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
27. " " " " " "  = 1q82:D *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
28. " " " " " "  = 1q86:D *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
29. " " " " " "  = 1qvf:B *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
30. " " " " " "  = 1qvg:B *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
31. " " " " " "  = 1s72:B *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
32. " " " " " "  = 1vq4:B *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1vq5:B *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
34. " " " " " "  = 1vq6:B *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
35. " " " " " "  = 1vq7:B *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
36. " " " " " "  = 1vq8:B *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
37. " " " " " "  = 1vq9:B *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
38. " " " " " "  = 1vqk:B *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
39. " " " " " "  = 1vql:B *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
40. " " " " " "  = 1vqm:B *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
41. " " " " " "  = 1vqn:B *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
42. " " " " " "  = 1vqo:B *
The structure of ccpmn bound to the large ribosomal subunit marismortui
43. " " " " " "  = 1vqp:B *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
44. " " " " " "  = 1w2b:B *
Trigger factor ribosome binding domain in complex with 50s
45. " " " " " "  = 1yhq:B *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
46. " " " " " "  = 1yi2:B *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
47. " " " " " "  = 1yij:B *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
48. " " " " " "  = 1yit:B *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
49. " " " " " "  = 1yj9:B *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
50. " " " " " "  = 1yjn:B *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
51. " " " " " "  = 1yjw:B *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
52. " " " " " "  = 2otj:B *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
53. " " " " " "  = 2otl:B *
Girodazole bound to the large subunit of haloarcula marismor
54. " " " " " "  = 2qa4:B *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
55. " " " " " "  = 2qex:B *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
56. " " " " " "  = 3cc2:B *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
57. " " " " " "  = 3cc4:B *
Co-crystal structure of anisomycin bound to the 50s ribosoma
58. " " " " " "  = 3cc7:B *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
59. " " " " " "  = 3cce:B *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
60. " " " " " "  = 3ccj:B *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
61. " " " " " "  = 3ccl:B *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
62. " " " " " "  = 3ccm:B *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
63. " " " " " "  = 3ccq:B *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
64. " " " " " "  = 3ccr:B *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
65. " " " " " "  = 3ccs:B *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
66. " " " " " "  = 3ccu:B *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
67. " " " " " "  = 3ccv:B *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
68. " " " " " "  = 3cd6:B *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
69. " " " " " "  = 3cma:B *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
70. " " " " " "  = 3cme:B *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
71. " " " " " "  = 3cpw:B *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
72. " " " " " "  = 3cxc:B *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
73. " " " " " "  = 3g4s:B *
Co-crystal structure of tiamulin bound to the large ribosoma
74. " " " " " "  = 3g6e:B *
Co-crystal structure of homoharringtonine bound to the large subunit
75. " " " " " "  = 3g71:B *
Co-crystal structure of bruceantin bound to the large riboso subunit
76. " " " " " "  = 3i55:B *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
77. " " " " " "  = 3i56:B *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
78. " " " " " "  = 3ow2:B *
Crystal structure of enhanced macrolide bound to 50s ribosom
79. " " " " " "  = 4adx:B *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
80. " " " " " "  = 4hub:B *
The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
81. 78 36.6% 41 208 108.7 44 2dda:A Crystal structure of pseudechetoxin from pseudechis australi
82. 74 30.4% 56 90 107.9 49 3j3b:p Structure of the human 60s ribosomal proteins

Number of sequences: 82

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer