spacer
spacer

SAS results for UniProt accession no. Q5SJ80

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand   to metal
Catalytic residues:   (from CSA)
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. Q5SJ80 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q5SJ80 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 83 unique sequences (including 28 consensus sequences) giving 182 sequence matches in all. The 113 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q5SJ80 -----------------------------------------------------------------    Cytochrome c oxidase subunit 2 OS=Thermus thermophilus  ...
1ehk:B*-----------------------------------------------------------------×30 Crystal structure of the aberrant ba3-cytochromE-C oxidase  ...
2qpe:B*-----------------------------------------------------------------×7  An unexpected outcome of surface-engineering an integral  ...
2fwl:B -----------------------------------------------------------------    The cytochrome c552/cua complex from thermus thermophilus
2cua:B -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
2lln:A -----------------------------------------------------------------    Solution structure of thermus thermophilus apo-cua
2cua:A -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
3sbp:A*------------QKIHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLT×3  Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
1qni:A -------------------------ahvapgeldeyygfwsgghqgevrvlgvpsmrelmripvf    Crystal structure of nitrous oxide reductase from  ...
2yev:B -----------------------------------------------------------------    Structure of caa3-type cytochrome oxidase
1ar1:B*-----------------------------------------------------------------×3  Structure at 2.7 angstrom resolution of the paracoccus  ...
3ehb:B -----------------------------------------------------------------    A d-pathway mutation decouples the paracoccus denitrificans  ...
3hb3:B -----------------------------------------------------------------    High resolution crystal structure of paracoccus  ...
2iwf:A*adgsvapgklddyygfwssgqtgemrilgipsmrelmrvpvfnrcsatgwgqtnesirihqrtmt×2  Resting form of pink nitrous oxide reductase from  ...
1fwx:A -------adgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvr    Crystal structure of nitrous oxide reductase from p. Denitri
1cyx:A -----------------------------------------------------------------    Quinol oxidase (periplasmic fragment of subunit ii with  ...
2gsm:B -----------------------------------------------------------------    Catalytic core (subunits i and ii) of cytochromE C oxidase  ...
3dtu:B -----------------------------------------------------------------    Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
3fye:B*-----------------------------------------------------------------×6  Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
1m56:B*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1occ:B*-----------------------------------------------------------------×4  Structure of bovine heart cytochromE C oxidase at the fully  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q5SJ80 -----------------------------------------------------------------    Cytochrome c oxidase subunit 2 OS=Thermus thermophilus  ...
1ehk:B*-----------------------------------------------------------------×30 Crystal structure of the aberrant ba3-cytochromE-C oxidase  ...
2qpe:B*-----------------------------------------------------------------×7  An unexpected outcome of surface-engineering an integral  ...
2fwl:B -----------------------------------------------------------------    The cytochrome c552/cua complex from thermus thermophilus
2cua:B -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
2lln:A -----------------------------------------------------------------    Solution structure of thermus thermophilus apo-cua
2cua:A -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
3sbp:A*NESRHIMGDSAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQ×3  Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
1qni:A nvdsatgwgitneskeilggdqqylngdchhphismtdgrydgkylfindkantrvarirldimk    Crystal structure of nitrous oxide reductase from  ...
2yev:B -----------------------------------------------------------------    Structure of caa3-type cytochrome oxidase
1ar1:B*-----------------------------------------------------------------×3  Structure at 2.7 angstrom resolution of the paracoccus  ...
3ehb:B -----------------------------------------------------------------    A d-pathway mutation decouples the paracoccus denitrificans  ...
3hb3:B -----------------------------------------------------------------    High resolution crystal structure of paracoccus  ...
2iwf:A*ektkkqlaangkkihdngdlhhvhmsftdgkydgrylfmndkantrvarvrcdvmktdaileipn×2  Resting form of pink nitrous oxide reductase from  ...
1fwx:A ihertmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvmkcd    Crystal structure of nitrous oxide reductase from p. Denitri
1cyx:A -----------------------------------------------------------------    Quinol oxidase (periplasmic fragment of subunit ii with  ...
2gsm:B -----------------------------------------------------------------    Catalytic core (subunits i and ii) of cytochromE C oxidase  ...
3dtu:B -----------------------------------------------------------------    Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
3fye:B*-----------------------------------------------------------------×6  Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
1m56:B*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1occ:B*-----------------------------------------------------------------×4  Structure of bovine heart cytochromE C oxidase at the fully  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q5SJ80 -----------------------------------------------------------------    Cytochrome c oxidase subunit 2 OS=Thermus thermophilus  ...
1ehk:B*-----------------------------------------------------------------×30 Crystal structure of the aberrant ba3-cytochromE-C oxidase  ...
2qpe:B*-----------------------------------------------------------------×7  An unexpected outcome of surface-engineering an integral  ...
2fwl:B -----------------------------------------------------------------    The cytochrome c552/cua complex from thermus thermophilus
2cua:B -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
2lln:A -----------------------------------------------------------------    Solution structure of thermus thermophilus apo-cua
2cua:A -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
3sbp:A*AIHGLRLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLD×3  Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
1qni:A tdkithipnvqaihglrlqkvpktnyvfcnaefvipqpndgtdfsldnsytmftaidaetmdvaw    Crystal structure of nitrous oxide reductase from  ...
2yev:B -----------------------------------------------------------------    Structure of caa3-type cytochrome oxidase
1ar1:B*-----------------------------------------------------------------×3  Structure at 2.7 angstrom resolution of the paracoccus  ...
3ehb:B -----------------------------------------------------------------    A d-pathway mutation decouples the paracoccus denitrificans  ...
3hb3:B -----------------------------------------------------------------    High resolution crystal structure of paracoccus  ...
2iwf:A*akgihgmrpqkwprsnyvfcngedeaplvndgstmtdvatyvniftavdadkwevawqvkvsgnl×2  Resting form of pink nitrous oxide reductase from  ...
1fwx:A aileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavdadkwevawq    Crystal structure of nitrous oxide reductase from p. Denitri
1cyx:A -----------------------------------------------------------------    Quinol oxidase (periplasmic fragment of subunit ii with  ...
2gsm:B -----------------------------------------------------------------    Catalytic core (subunits i and ii) of cytochromE C oxidase  ...
3dtu:B -----------------------------------------------------------------    Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
3fye:B*-----------------------------------------------------------------×6  Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
1m56:B*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1occ:B*-----------------------------------------------------------------×4  Structure of bovine heart cytochromE C oxidase at the fully  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q5SJ80 -----------------------------------------------------------------    Cytochrome c oxidase subunit 2 OS=Thermus thermophilus  ...
1ehk:B*-----------------------------------------------------------------×30 Crystal structure of the aberrant ba3-cytochromE-C oxidase  ...
2qpe:B*-----------------------------------------------------------------×7  An unexpected outcome of surface-engineering an integral  ...
2fwl:B -----------------------------------------------------------------    The cytochrome c552/cua complex from thermus thermophilus
2cua:B -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
2lln:A -----------------------------------------------------------------    Solution structure of thermus thermophilus apo-cua
2cua:A -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
3sbp:A*NTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDG×3  Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
1qni:A qvivdgnldntdadytgkyatstcynseravdlagtmrndrdwvvvfnveriaaavkagnfktig    Crystal structure of nitrous oxide reductase from  ...
2yev:B -----------------------------------------------------------------    Structure of caa3-type cytochrome oxidase
1ar1:B*-----------------------------------------------------------------×3  Structure at 2.7 angstrom resolution of the paracoccus  ...
3ehb:B -----------------------------------------------------------------    A d-pathway mutation decouples the paracoccus denitrificans  ...
3hb3:B -----------------------------------------------------------------    High resolution crystal structure of paracoccus  ...
2iwf:A*dncdadyegkwafstsynsemgmtleemtksemdhvvvfniaeiekaikagqyeeingvkvvdgr×2  Resting form of pink nitrous oxide reductase from  ...
1fwx:A vlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeiekaiaagdyqelng    Crystal structure of nitrous oxide reductase from p. Denitri
1cyx:A -----------------------------------------------------------------    Quinol oxidase (periplasmic fragment of subunit ii with  ...
2gsm:B -----------------------------------------------------------------    Catalytic core (subunits i and ii) of cytochromE C oxidase  ...
3dtu:B -----------------------------------------------------------------    Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
3fye:B*-----------------------------------------------------------------×6  Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
1m56:B*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1occ:B*-----------------------------------------------------------------×4  Structure of bovine heart cytochromE C oxidase at the fully  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q5SJ80 -----------------------------------------------------------------    Cytochrome c oxidase subunit 2 OS=Thermus thermophilus  ...
1ehk:B*-----------------------------------------------------------------×30 Crystal structure of the aberrant ba3-cytochromE-C oxidase  ...
2qpe:B*-----------------------------------------------------------------×7  An unexpected outcome of surface-engineering an integral  ...
2fwl:B -----------------------------------------------------------------    The cytochrome c552/cua complex from thermus thermophilus
2cua:B -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
2lln:A -----------------------------------------------------------------    Solution structure of thermus thermophilus apo-cua
2cua:A -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
3sbp:A*RKKDGKDSKFTRYVPVPKNPHGCNTSSDGKYFIAAGKLSPTCSMIAIDKLPDLFAGKLADPRDVI×3  Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
1qni:A dskvpvvdgrgeseftryipvpknphglntspdgkyfiangklsptvsviaidklddlfedkiel    Crystal structure of nitrous oxide reductase from  ...
2yev:B -----------------------------------------------------------------    Structure of caa3-type cytochrome oxidase
1ar1:B*-----------------------------------------------------------------×3  Structure at 2.7 angstrom resolution of the paracoccus  ...
3ehb:B -----------------------------------------------------------------    A d-pathway mutation decouples the paracoccus denitrificans  ...
3hb3:B -----------------------------------------------------------------    High resolution crystal structure of paracoccus  ...
2iwf:A*keakslftryipiannphgcnmapdrkhlcvagklsptvtvldvtkfdalfydnaeprsavvaep×2  Resting form of pink nitrous oxide reductase from  ...
1fwx:A vkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvtvldvtrfdavfyenadpr    Crystal structure of nitrous oxide reductase from p. Denitri
1cyx:A -----------------------------------------------------------------    Quinol oxidase (periplasmic fragment of subunit ii with  ...
2gsm:B -----------------------------------------------------------------    Catalytic core (subunits i and ii) of cytochromE C oxidase  ...
3dtu:B -----------------------------------------------------------------    Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
3fye:B*-----------------------------------------------------------------×6  Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
1m56:B*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1occ:B*-----------------------------------------------------------------×4  Structure of bovine heart cytochromE C oxidase at the fully  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q5SJ80 -----------------------------------------------------------------    Cytochrome c oxidase subunit 2 OS=Thermus thermophilus  ...
1ehk:B*-----------------------------------------------------------------×30 Crystal structure of the aberrant ba3-cytochromE-C oxidase  ...
2qpe:B*-----------------------------------------------------------------×7  An unexpected outcome of surface-engineering an integral  ...
2fwl:B -----------------------------------------------------------------    The cytochrome c552/cua complex from thermus thermophilus
2cua:B -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
2lln:A -----------------------------------------------------------------    Solution structure of thermus thermophilus apo-cua
2cua:A -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
3sbp:A*VGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAVRAYKGEKVNYIKQKLDVHYQPGHLH×3  Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
1qni:A rdtivaepelglgplhttfdgrgnayttlfidsqvckwniadaikhyngdrvnyirqkldvqyqp    Crystal structure of nitrous oxide reductase from  ...
2yev:B -----------------------------------------------------------------    Structure of caa3-type cytochrome oxidase
1ar1:B*---------------------------qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfv×3  Structure at 2.7 angstrom resolution of the paracoccus  ...
3ehb:B ---------------------------qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfv    A d-pathway mutation decouples the paracoccus denitrificans  ...
3hb3:B ---------------------------qdvlgdlpvigkpvnggmnfqpassplahdqqwldhfv    High resolution crystal structure of paracoccus  ...
2iwf:A*elglgplhtafdgrgnaytslfldsqvvkwnideairayagekinpikdkldvqyqpghlktvmg×2  Resting form of pink nitrous oxide reductase from  ...
1fwx:A savvaepelglgplhtafdgrgnaytslfldsqvvkwniedairayagekvdpikdkldvhyqpg    Crystal structure of nitrous oxide reductase from p. Denitri
1cyx:A -----------------------------------------------------------------    Quinol oxidase (periplasmic fragment of subunit ii with  ...
2gsm:B --------------------leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtl    Catalytic core (subunits i and ii) of cytochromE C oxidase  ...
3dtu:B -------------------sleiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtl    Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
3fye:B*--------------------leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtl×6  Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
1m56:B*--------------------leiigrpqpggtgfqpsaspvatqihwldgfilviiaaitifvtl×2  Structure of cytochromE C oxidase from rhodobactor  ...
1occ:B*-----------------------------------------------maypmqlgfqdatspime×4  Structure of bovine heart cytochromE C oxidase at the fully  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q5SJ80 -----------------------------mvdehkahkailayekgwlafslamlfvfialiayt    Cytochrome c oxidase subunit 2 OS=Thermus thermophilus  ...
1ehk:B*-------------------------------DEHKAHKAILAYEKGWLAFSLAMLFVFIALIAYT×30 Crystal structure of the aberrant ba3-cytochromE-C oxidase  ...
2qpe:B*-------------------------------DQHKAHKAILAYEKGWLAFSLAMLFVFIALIAYT×7  An unexpected outcome of surface-engineering an integral  ...
2fwl:B ---------------------------------------------------------------YT    The cytochrome c552/cua complex from thermus thermophilus
2cua:B --------------------------------------------------------------AYT    The cua domain of cytochrome ba3 from thermus thermophilus
2lln:A -----------------------------------------------------------------    Solution structure of thermus thermophilus apo-cua
2cua:A -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
3sbp:A*ASLCETNEADGKWLVALSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHDGPTFAEPHDCIMAR×3  Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
1qni:A ghnhasltesrdadgkwlvvlskfskdrflpvgplhpendqlidisgeemklvhdgptyaephdc    Crystal structure of nitrous oxide reductase from  ...
2yev:B ------------AHRVAITHPGGSFNQEVAFLFPWVYFFSFLIFLVVAGSLAYVTWKFRARPEDQ    Structure of caa3-type cytochrome oxidase
1ar1:B*lyiitavtifvcllllicivrfnrranpvparfthntpieviwtlvpvlilvaigafslpilfrs×3  Structure at 2.7 angstrom resolution of the paracoccus  ...
3ehb:B lyiitavtifvcllllicivrfnrranpvparfthntpieviwtlvpvlilvaigafslpilfrs    A d-pathway mutation decouples the paracoccus denitrificans  ...
3hb3:B lyiitavtifvcllllicivrfnrranpvparfthntpieviwtlvpvlilvaigafslpilfrs    High resolution crystal structure of paracoccus  ...
2iwf:A*etldaandwlvclckfskdrflnvgplkpendqlidisgdkmvlvhdgptfaephdaiavspsil×2  Resting form of pink nitrous oxide reductase from  ...
1fwx:A hlktvmgetldatndwlvclskfskdrflnvgplkpendqlidisgdkmvlvhdgptfaephdai    Crystal structure of nitrous oxide reductase from p. Denitri
1cyx:A -----------------------------------------------------------------    Quinol oxidase (periplasmic fragment of subunit ii with  ...
2gsm:B lilyavwrfhekrnkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvt    Catalytic core (subunits i and ii) of cytochromE C oxidase  ...
3dtu:B lilyavwrfhekrnkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvt    Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
3fye:B*lilyavwrfhekrnkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvt×6  Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
1m56:B*lilyavwrfhekrnkvparfthnspleiawtivpivilvaigafslpvlfnqqeipeadvtvkvt×2  Structure of cytochromE C oxidase from rhodobactor  ...
1occ:B*ellhfhdhtlmivflisslvlyiislmlttklthtstmdaqevetiwtilpaiililialpslri×4  Structure of bovine heart cytochromE C oxidase at the fully  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q5SJ80 lathtagvipagklervdp------tt--vrqegpwadp---aqavvqtg---pnqytvyv--la    Cytochrome c oxidase subunit 2 OS=Thermus thermophilus  ...
1ehk:B*LATHTAGVIPAGKLERVDP------TT--VRQEGPWADP---AQAVVQTG---PNQYTVYV--LA×30 Crystal structure of the aberrant ba3-cytochromE-C oxidase  ...
2qpe:B*LATHTAGVIPAGKLERVDP------TT--VRQEGPWADP---AQAVVQTG---PNQYTVYV--LA×7  An unexpected outcome of surface-engineering an integral  ...
2fwl:B LATHTAGVIPAGKLERVDP------TT--VRQEGPWADP---AQAVVQTG---PNQYTVYV--LA    The cytochrome c552/cua complex from thermus thermophilus
2cua:B LATHTAG---AGKLERVDP------TT--VRQEGPWADP---AQAVVQTG---PNQYTVYV--LA    The cua domain of cytochrome ba3 from thermus thermophilus
2lln:A ------mvipagklervdp------tt--vrqegpwadp---aqavvqtg---pnqytvyv--la    Solution structure of thermus thermophilus apo-cua
2cua:A ----------AGKLERVDP------TT--VRQEGPWADP---AQAVVQTG---PNQYTVYV--LA    The cua domain of cytochrome ba3 from thermus thermophilus
3sbp:A*RDQIKTKKIWDRNDPFFAP------TVEMAKKDGINLDT---DNKVIRDG----NKVRVYMTSMA×3  Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
1qni:A ilvrrdqiktkkiyerndpyfascraq--aekdgvtles---dnkvirdg----nkvrvym--ts    Crystal structure of nitrous oxide reductase from  ...
2yev:B EEPPQIHGNDRLEVVWTLI------PL--AIVFVLFGLT---AKALIQVNRPIPGAMKVEV--TG    Structure of caa3-type cytochrome oxidase
1ar1:B*qempndpdlvikaighqwy------ws--yeypndgvaf---dalmleke---aladagys--ed×3  Structure at 2.7 angstrom resolution of the paracoccus  ...
3ehb:B qempndpdlvikaighqwy------ws--yeypndgvaf---dalmleke---aladagys--ed    A d-pathway mutation decouples the paracoccus denitrificans  ...
3hb3:B qempndpdlvikaighqwy------ws--yeypndgvaf---dalmleke---aladagys--ed    High resolution crystal structure of paracoccus  ...
2iwf:A*pnirsvwdrndplwaetrk------qa--eadevdidew---teavirdg----nkvrvym--ts×2  Resting form of pink nitrous oxide reductase from  ...
1fwx:A avhpsilsdiksvwdrndpmwae--tr--aqaeadgvdidnwteevirdg----nkvrvym--ss    Crystal structure of nitrous oxide reductase from p. Denitri
1cyx:A --------------------------------------k---pitievvs---mdwkwffi--yp    Quinol oxidase (periplasmic fragment of subunit ii with  ...
2gsm:B gyqwywgyeypdeeisfes------ym--igspatggdn---rmspeveq---qlieagys--rd    Catalytic core (subunits i and ii) of cytochromE C oxidase  ...
3dtu:B gyqwywgyeypdeeisfes------ym--igspatggdn---rmspeveq---qlieagys--rd    Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
3fye:B*gyqwywgyeypdeeisfes------ym--igspatggdn---rmspeveq---qlieagys--rd×6  Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
1m56:B*gyqwywgyeypdeeisfes------ym--igspatggdn---rmspeveq---qlieagys--rd×2  Structure of cytochromE C oxidase from rhodobactor  ...
1occ:B*lymmdeinnpsltvktmgh------qw--ywsyeytdye---dlsfdsym---iptselkp--ge×4  Structure of bovine heart cytochromE C oxidase at the fully  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q5SJ80 fafgyq---p-------npievpqgaeivfkits----pdvihgfhvegtninvevlpgevstvr    Cytochrome c oxidase subunit 2 OS=Thermus thermophilus  ...
1ehk:B*FAFGYQ---P-------NPIEVPQGAEIVFKITS----PDVIHGFHVEGTNINVEVLPGEVSTVR×30 Crystal structure of the aberrant ba3-cytochromE-C oxidase  ...
2qpe:B*FAFGYQ---P-------NPIEVPQGAEIVFKITS----PDVIHGFHVEGTNINVEVLPGEVSTVR×7  An unexpected outcome of surface-engineering an integral  ...
2fwl:B FAFGYQ---P-------NPIEVPQGAEIVFKITS----PDVIHGFHVEGTNINVEVLPGEVSTVR    The cytochrome c552/cua complex from thermus thermophilus
2cua:B FAFGYQ---P-------NPIEVPQGAEIVFKITS----PDVIHGFHVEGTNINVEVLPGEVSTVR    The cua domain of cytochrome ba3 from thermus thermophilus
2lln:A fafgyq---p-------npievpqgaeivfkits----pdvihgfhvegtninvevlpgevstvr    Solution structure of thermus thermophilus apo-cua
2cua:A FAFGYQ---P-------NPIEVPQGAEIVFKITS----PDVIHGFHVEGTNINVEVLPGEVSTVR    The cua domain of cytochrome ba3 from thermus thermophilus
3sbp:A*PAFGVQ---E---------FTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSMEISPQQTSSIT×3  Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
1qni:A vapqyg---m-------tdfkvkegdevtvyitnldmvedvthgfcmvnhgvsmeispqqtasvt    Crystal structure of nitrous oxide reductase from  ...
2yev:B YQFWWDFHYPELGLRNSNELVLPAGVPVELEITS----KDVIHSFWVPGLAGKRDAIPGQTTRIS    Structure of caa3-type cytochrome oxidase
1ar1:B*eyllat---d-------npvvvpvgkkvlvqvta----tdvihawtipafavkqdavpgriaqlw×3  Structure at 2.7 angstrom resolution of the paracoccus  ...
3ehb:B eyllat---d-------npvvvpvgkkvlvqvta----tdvihawtipafavkqdavpgriaqlw    A d-pathway mutation decouples the paracoccus denitrificans  ...
3hb3:B eyllat---d-------npvvvpvgkkvlvqvta----tdvihawtipafavkqdavpgriaqlw    High resolution crystal structure of paracoccus  ...
2iwf:A*vapsfs---q-------psftvkegdevtvivtnldeiddlthgftmgnhgvamevgpqqtssvt×2  Resting form of pink nitrous oxide reductase from  ...
1fwx:A vapsfs---i-------esftvkegdevtvivtnldeiddlthgftmgnygvameigpqmtssvt    Crystal structure of nitrous oxide reductase from p. Denitri
1cyx:A eqgiat---v-------neiafpantpvyfkvts----nsvmhsffiprlgsqiyamagmqtrlh    Quinol oxidase (periplasmic fragment of subunit ii with  ...
2gsm:B efllat---d-------tamvvpvnktvvvqvtg----advihswtvpafgvkqdavpgrlaqlw    Catalytic core (subunits i and ii) of cytochromE C oxidase  ...
3dtu:B efllat---d-------tamvvpvnktvvvqvtg----advihswtvpafgvkqdavpgrlaqlw    Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
3fye:B*efllat---d-------tamvvpvnktvvvqvtg----advihswtvpafgvkqdavpgrlaqlw×6  Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
1m56:B*efllat---d-------tamvvpvnktvvvqvtg----advihswtvpafgvkqdavpgrlaqlw×2  Structure of cytochromE C oxidase from rhodobactor  ...
1occ:B*lrllev---d-------nrvvlpmemtirmlvss----edvlhswavpslglktdaipgrlnqtt×4  Structure of bovine heart cytochromE C oxidase at the fully  ...

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q5SJ80 ytfkrpgeyriicnqycglghqnmfgti-vvke--------------------------------    Cytochrome c oxidase subunit 2 OS=Thermus thermophilus  ...
1ehk:B*YTFKRPGEYRIICNQYCGLGHQNMFGTI-VVKE--------------------------------×30 Crystal structure of the aberrant ba3-cytochromE-C oxidase  ...
2qpe:B*YTFKRPGEYRIICNQYCGLGHQNMFGTI-VVKE--------------------------------×7  An unexpected outcome of surface-engineering an integral  ...
2fwl:B YTFKRPGEYRIICNQYCGLGHQNMFGTI-VVKE--------------------------------    The cytochrome c552/cua complex from thermus thermophilus
2cua:B YTFKRPGEYRIICNQYCGLGHQNMFGTI-VVKE--------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
2lln:A ytfkrpgeyriicnqycglghqnmfgti-vvke--------------------------------    Solution structure of thermus thermophilus apo-cua
2cua:A YTFKRPGEYRIICNQYCGLGHQNMFGTI-VVKE--------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
3sbp:A*FVADKPGLHWYYCSWFCHALHMEMVGRM-MVEPA-------------------------------×3  Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
1qni:A ftagkpgvywyycnwfchalhmemvgrm-lveaa-------------------------------    Crystal structure of nitrous oxide reductase from  ...
2yev:B FEPKEPGLYYGFCAELCGASHARMLFRV-VVLPKEEFDRFVEAAKASPAPVADERGQQVFQQNCA    Structure of caa3-type cytochrome oxidase
1ar1:B*fsvdqegvyfgqcselcginhaym--pi-vvkavsqekyeawlagakeefaa-------------×3  Structure at 2.7 angstrom resolution of the paracoccus  ...
3ehb:B fsvdqegvyfgqcselcginhaym--pi-vvkavsqekyeawlagakeefaad------------    A d-pathway mutation decouples the paracoccus denitrificans  ...
3hb3:B fsvdqegvyfgqcselcginhaym--pi-vvkavsqekyeawlagakeefaa-------------    High resolution crystal structure of paracoccus  ...
2iwf:A*fvaanpgvywyycqwfchalhmemrgrm-fvep--------------------------------×2  Resting form of pink nitrous oxide reductase from  ...
1fwx:A fvaanpgvywyycqwfchalhmemrgrm-lvepk-------------------------------    Crystal structure of nitrous oxide reductase from p. Denitri
1cyx:A lianepgtydgicaeicgpghsgmkfka-iatpdraafdqwvakakqspntmsdmaafeklaaps    Quinol oxidase (periplasmic fragment of subunit ii with  ...
2gsm:B fraeregiffgqcselcgishaympitvkvvseeayaawleqhhhh-------------------    Catalytic core (subunits i and ii) of cytochromE C oxidase  ...
3dtu:B fraeregiffgqcselcgishaympitvkvvseeayaawleqhhhhhh-----------------    Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
3fye:B*fraeregiffgqcselcgishaympitvkvvseeayaawleqhhhh-------------------×6  Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
1m56:B*fraeregiffgqcselcgishaympitvkvvseeayaawleqarggtyel---------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1occ:B*lmssrpglyygqcseicgsnhsfmpivl-elvplkyfekwsasml--------------------×4  Structure of bovine heart cytochromE C oxidase at the fully  ...

                6         6         6         6         7         7     
                6         7         8         9         0         1     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q5SJ80 -----------------------------------------------------------------    Cytochrome c oxidase subunit 2 OS=Thermus thermophilus  ...
1ehk:B*-----------------------------------------------------------------×30 Crystal structure of the aberrant ba3-cytochromE-C oxidase  ...
2qpe:B*-----------------------------------------------------------------×7  An unexpected outcome of surface-engineering an integral  ...
2fwl:B -----------------------------------------------------------------    The cytochrome c552/cua complex from thermus thermophilus
2cua:B -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
2lln:A -----------------------------------------------------------------    Solution structure of thermus thermophilus apo-cua
2cua:A -----------------------------------------------------------------    The cua domain of cytochrome ba3 from thermus thermophilus
3sbp:A*-----------------------------------------------------------------×3  Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
1qni:A -----------------------------------------------------------------    Crystal structure of nitrous oxide reductase from  ...
2yev:B ACHGVARSMPPAVIGPELGLWGNRTSLGAGIVENTPENLKAWIRDPAGMKPGVKMPGFPQLSEED    Structure of caa3-type cytochrome oxidase
1ar1:B*-----------------------------------------------------------------×3  Structure at 2.7 angstrom resolution of the paracoccus  ...
3ehb:B -----------------------------------------------------------------    A d-pathway mutation decouples the paracoccus denitrificans  ...
3hb3:B -----------------------------------------------------------------    High resolution crystal structure of paracoccus  ...
2iwf:A*-----------------------------------------------------------------×2  Resting form of pink nitrous oxide reductase from  ...
1fwx:A -----------------------------------------------------------------    Crystal structure of nitrous oxide reductase from p. Denitri
1cyx:A eynqveyfsnvkpdlfadvinkfm-----------------------------------------    Quinol oxidase (periplasmic fragment of subunit ii with  ...
2gsm:B -----------------------------------------------------------------    Catalytic core (subunits i and ii) of cytochromE C oxidase  ...
3dtu:B -----------------------------------------------------------------    Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
3fye:B*-----------------------------------------------------------------×6  Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
1m56:B*-----------------------------------------------------------------×2  Structure of cytochromE C oxidase from rhodobactor  ...
1occ:B*-----------------------------------------------------------------×4  Structure of bovine heart cytochromE C oxidase at the fully  ...

           7         7         
           2         3         
       678901234567890123456789                                             Protein name
       ----+---------+---------                                             ------------
Q5SJ80 ------------------------                                             Cytochrome c oxidase subunit 2 OS=Thermus thermophilus  ...
1ehk:B*------------------------                                         ×30 Crystal structure of the aberrant ba3-cytochromE-C oxidase  ...
2qpe:B*------------------------                                         ×7  An unexpected outcome of surface-engineering an integral  ...
2fwl:B ------------------------                                             The cytochrome c552/cua complex from thermus thermophilus
2cua:B ------------------------                                             The cua domain of cytochrome ba3 from thermus thermophilus
2lln:A ------------------------                                             Solution structure of thermus thermophilus apo-cua
2cua:A ------------------------                                             The cua domain of cytochrome ba3 from thermus thermophilus
3sbp:A*------------------------                                         ×3  Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
1qni:A ------------------------                                             Crystal structure of nitrous oxide reductase from  ...
2yev:B LDALVRYLEGLKVEGFDFGALPKF                                             Structure of caa3-type cytochrome oxidase
1ar1:B*------------------------                                         ×3  Structure at 2.7 angstrom resolution of the paracoccus  ...
3ehb:B ------------------------                                             A d-pathway mutation decouples the paracoccus denitrificans  ...
3hb3:B ------------------------                                             High resolution crystal structure of paracoccus  ...
2iwf:A*------------------------                                         ×2  Resting form of pink nitrous oxide reductase from  ...
1fwx:A ------------------------                                             Crystal structure of nitrous oxide reductase from p. Denitri
1cyx:A ------------------------                                             Quinol oxidase (periplasmic fragment of subunit ii with  ...
2gsm:B ------------------------                                             Catalytic core (subunits i and ii) of cytochromE C oxidase  ...
3dtu:B ------------------------                                             Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
3fye:B*------------------------                                         ×6  Catalytic core subunits (i and ii) of cytochromE C oxidase  ...
1m56:B*------------------------                                         ×2  Structure of cytochromE C oxidase from rhodobactor  ...
1occ:B*------------------------                                         ×4  Structure of bovine heart cytochromE C oxidase at the fully  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q5SJ80. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 168 - - Q5SJ80 Cytochrome c oxidase subunit 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=cbaB PE=1 SV=1
2. 1116 100.0% 166 166 1382.8 4.8e-70 1ehk:B * Crystal structure of the aberrant ba3-cytochromE-C oxidase f thermus thermophilus
3. " " " " " "  = 1xme:B *
Structure of recombinant cytochrome ba3 oxidase from thermus thermophilus
4. " " " " " "  = 2qpd:B *
An unexpected outcome of surface-engineering an integral mem protein: improved crystallization of cytochrome ba3 oxidase thermus thermophilus
5. " " " " " "  = 3qjq:B *
The structure of and photolytic induced changes of carbon mo binding to the cytochrome ba3-oxidase from thermus thermoph
6. " " " " " "  = 3qjr:B *
The structure of and photolytic induced changes of carbon mo binding to the cytochrome ba3-oxidase from thermus thermoph
7. " " " " " "  = 3qju:B *
The structure of and photolytic induced changes of carbon mo binding to the cytochrome ba3-oxidase from thermus thermoph
8. " " " " " "  = 3qjv:B *
The structure of and photolytic induced changes of carbon mo binding to the cytochrome ba3-oxidase from thermus thermoph
9. " " " " " "  = 3s33:B *
Structure of thermus thermophilus cytochrome ba3 oxidase 10s depressurization
10. " " " " " "  = 3s38:B *
Structure of thermus thermophilus cytochrome ba3 oxidase 30s depressurization
11. " " " " " "  = 3s39:B *
Structure of thermus thermophilus cytochrome ba3 oxidase 60s depressurization
12. " " " " " "  = 3s3a:B *
Structure of thermus thermophilus cytochrome ba3 oxidase 120 depressurization
13. " " " " " "  = 3s3b:B *
Structure of thermus thermophilus cytochrome ba3 oxidase 240 depressurization
14. " " " " " "  = 3s3c:B *
Structure of thermus thermophilus cytochrome ba3 oxidase 360 depressurization
15. " " " " " "  = 3s3d:B *
Structure of thermus thermophilus cytochrome ba3 oxidase 480 depressurization
16. " " " " " "  = 3s8f:B *
1.8 a structure of ba3 cytochromE C oxidase from thermus the in lipid environment
17. " " " " " "  = 3s8g:B *
1.8 a structure of ba3 cytochromE C oxidase mutant (a120f) f thermus thermophilus in lipid environment
18. " " " " " "  = 4esl:B *
Structure of recombinant cytochrome ba3 oxidase mutant y133w from thermus thermophilus
19. " " " " " "  = 4ev3:B *
Structure of recombinant cytochrome ba3 oxidase mutant y133w thermus thermophilus
20. " " " " " "  = 4f05:B *
Structure of recombinant cytochrome ba3 oxidase mutant y133f thermus thermophilus
21. " " " " " "  = 4fa7:B *
Structure of recombinant cytochrome ba3 oxidase mutant a204f thermus thermophilus
22. " " " " " "  = 4faa:B *
Structure of recombinant cytochrome ba3 oxidase mutant a120f from thermus thermophilus
23. " " " " " "  = 4g70:B *
Structure of recombinant cytochrome ba3 oxidase mutant v236t thermus thermophilus
24. " " " " " "  = 4g71:B *
Structure of recombinant cytochrome ba3 oxidase mutant v236n thermus thermophilus
25. " " " " " "  = 4g72:B *
Structure of recombinant cytochrome ba3 oxidase mutant v236m thermus thermophilus
26. " " " " " "  = 4g7q:B *
Structure of recombinant cytochrome ba3 oxidase mutant v236l thermus thermophilus
27. " " " " " "  = 4g7r:B *
Structure of recombinant cytochrome ba3 oxidase mutant v236a thermus thermophilus
28. " " " " " "  = 4g7s:B *
Structure of recombinant cytochrome ba3 oxidase mutant v236i thermus thermophilus
29. " " " " " "  = 4gp4:B *
Structure of recombinant cytochrome ba3 oxidase mutant y133f thermus thermophilus
30. " " " " " "  = 4gp5:B *
Structure of recombinant cytochrome ba3 oxidase mutant y133w thermus thermophilus
31. " " " " " "  = 4gp8:B *
Structure of recombinant cytochrome ba3 oxidase mutant y133w from thermus thermophilus
32. 1112 99.4% 166 166 1377.9 9e-70 2qpe:B * An unexpected outcome of surface-engineering an integral mem protein: improved crystallization of cytochrome ba3 oxidase thermus thermophilus
33. " " " " " "  = 3bvd:B *
Structure of surface-engineered cytochrome ba3 oxidase from thermus thermophilus under xenon pressure, 100psi 5min
34. " " " " " "  = 3eh3:B *
Structure of the reduced form of cytochrome ba3 oxidase from thermophilus
35. " " " " " "  = 3eh4:B *
Structure of the reduced form of cytochrome ba3 oxidase from thermophilus
36. " " " " " "  = 3eh5:B *
Structure of the reduced form of cytochrome ba3 oxidase from thermophilus
37. " " " " " "  = 3qjs:B *
The structure of and photolytic induced changes of carbon mo binding to the cytochrome ba3-oxidase from thermus thermoph
38. " " " " " "  = 3qjt:B *
The structure of and photolytic induced changes of carbon mo binding to the cytochrome ba3-oxidase from thermus thermoph
39. 911 100.0% 134 134 1131.8 4.6e-56 2fwl:B The cytochrome c552/cua complex from thermus thermophilus
40. 880 97.8% 135 132 1093.8 6e-54 2cua:B The cua domain of cytochrome ba3 from thermus thermophilus
41. 855 100.0% 125 126 1063.3 3e-52 2lln:A Solution structure of thermus thermophilus apo-cua
42. 835 100.0% 122 122 1038.9 6.8e-51 2cua:A The cua domain of cytochrome ba3 from thermus thermophilus
43. 189 30.6% 121 581 233.5 4.9e-06 3sbp:A * Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for
44. " " " " " "  = 3sbq:A *
Pseudomonas stutzeri nitrous oxide reductase, p65 crystal fo
45. " " " " " "  = 3sbr:A *
Pseudomonas stutzeri nitrous oxide reductase, p1 crystal for substrate
46. 191 28.3% 127 572 230.0 7.8e-06 1qni:A Crystal structure of nitrous oxide reductase from pseudomonas nautica, at 2.4a resolution
47. 186 30.4% 112 319 230.0 7.7e-06 2yev:B Structure of caa3-type cytochrome oxidase
48. 169 30.7% 75 252 214.3 5.8e-05 1ar1:B * Structure at 2.7 angstrom resolution of the paracoccus denitrificans two-subunit cytochromE C oxidase complexed with an antibody fv fragment
49. " " " " " "  = 1qle:B *
Cryo-structure of the paracoccus denitrificans four-subunit cytochromE C oxidase in the completely oxidized state complexed with an antibody fv fragment
50. " " " " " "  = 1zyy:B *
Structural model for the adduct between cytochromE C and cytochromE C oxidase
51. 169 30.7% 75 253 214.3 5.8e-05 3ehb:B A d-pathway mutation decouples the paracoccus denitrificans cytochromE C oxidase by altering the side chain orientation of a distant, conserved glutamate
52. 169 30.7% 75 252 214.3 5.8e-05 3hb3:B High resolution crystal structure of paracoccus denitrificans cytochromE C oxidase
53. 167 28.2% 103 590 206.4 0.00016 2iwf:A * Resting form of pink nitrous oxide reductase from achromobacter cycloclastes
54. " " " " " "  = 2iwk:A *
Inhibitor-bound form of nitrous oxide reductase from achromobacter cycloclastes at 1.7 angstrom resolution
55. 157 25.8% 128 591 192.8 0.00092 1fwx:A Crystal structure of nitrous oxide reductase from p. Denitri
56. 149 30.9% 68 158 192.7 0.00093 1cyx:A Quinol oxidase (periplasmic fragment of subunit ii with engineered cu-a binding site)(cyoa)
57. 140 30.1% 73 256 178.5 0.0057 2gsm:B Catalytic core (subunits i and ii) of cytochromE C oxidase f rhodobacter sphaeroides
58. 140 30.1% 73 259 178.5 0.0058 3dtu:B Catalytic core subunits (i and ii) of cytochromE C oxidase from rhodobacter sphaeroides complexed with deoxycholic acid
59. 140 30.1% 73 256 178.5 0.0057 3fye:B * Catalytic core subunits (i and ii) of cytochromE C oxidase from rhodobacter sphaeroides in the reduced state
60. " " " " " "  = 3fyi:B *
Catalytic core subunits (i and ii) of cytochromE C oxidase from rhodobacter sphaeroides in the reduced state bound with cyanide
61. " " " " " "  = 3om3:B *
Catalytic core subunits (i and ii) of cytochromE C oxidase f rhodobacter sphaeroides with k362m mutation in the reduced
62. " " " " " "  = 3oma:B *
Catalytic core subunits (i and ii) of cytochromE C oxidase f rhodobacter sphaeroides with k362m mutation
63. " " " " " "  = 3omi:B *
Catalytic core subunits (i and ii) of cytochromE C oxidase f rhodobacter sphaeroides with d132a mutation
64. " " " " " "  = 3omn:B *
Catalytic core subunits (i and ii) of cytochromE C oxidase f rhodobacter sphaeroides with d132a mutation in the reduced
65. 140 30.1% 73 260 178.4 0.0058 1m56:B * Structure of cytochromE C oxidase from rhodobactor sphaeroides (wild type)
66. " " " " " "  = 1m57:B *
Structure of cytochromE C oxidase from rhodobacter sphaeroides (eq(i-286) mutant))
67. 134 27.9% 68 227 171.9 0.013 1occ:B * Structure of bovine heart cytochromE C oxidase at the fully oxidized state
68. " " " " " "  = 1oco:B *
Bovine heart cytochromE C oxidase in carbon monoxide-bound state
69. " " " " " "  = 1ocr:B *
Bovine heart cytochromE C oxidase in the fully reduced state
70. " " " " " "  = 1ocz:B *
Bovine heart cytochromE C oxidase in azide-bound state

Number of sequences: 70

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 134 27.9% 68 226 171.9 0.013 1v54:B * Bovine heart cytochromE C oxidase at the fully oxidized stat
2. " " " " " "  = 1v55:B *
Bovine heart cytochromE C oxidase at the fully reduced state
3. " " " " " "  = 2dyr:B *
Bovine heart cytochromE C oxidase at the fully oxidized stat
4. " " " " " "  = 2dys:B *
Bovine heart cytochromE C oxidase modified by dccd
5. " " " " " "  = 2eij:B *
Bovine heart cytochromE C oxidase in the fully reduced state
6. " " " " " "  = 2eik:B *
Cadmium ion binding structure of bovine heart cytochromE C o the fully reduced state
7. " " " " " "  = 2eil:B *
Cadmium ion binding structure of bovine heart cytochromE C o the fully oxidized state
8. " " " " " "  = 2eim:B *
Zinc ion binding structure of bovine heart cytochromE C oxid fully reduced state
9. " " " " " "  = 2ein:B *
Zinc ion binding structure of bovine heart cytochromE C oxidase in the fully oxidized state
10. 134 27.9% 68 227 171.9 0.013 2occ:B * Bovine heart cytochromE C oxidase at the fully oxidized stat
11. " " " " " "  = 2y69:B *
Bovine heart cytochromE C oxidase re-refined with molecular oxygen
12. " " " " " "  = 2ybb:M *
Fitted model for bovine mitochondrial supercomplex i1iii2iv single particle cryo-em (emd-1876)
13. 134 27.9% 68 226 171.9 0.013 2zxw:B * Bovine heart cytochromE C oxidase at the fully oxidized stat ray exposure dataset)
14. " " " " " "  = 3abk:B *
Bovine heart cytochromE C oxidase at the no-bound fully redu (50k)
15. " " " " " "  = 3abl:B *
Bovine heart cytochromE C oxidase at the fully oxidized state (15-s x-ray exposure dataset)
16. " " " " " "  = 3abm:B *
Bovine heart cytochromE C oxidase at the fully oxidized state (200-s x-ray exposure dataset)
17. " " " " " "  = 3ag1:B *
Bovine heart cytochromE C oxidase in the carbon monoxide-bou reduced state at 280 k
18. " " " " " "  = 3ag2:B *
Bovine heart cytochromE C oxidase in the carbon monoxide-bou reduced state at 100 k
19. " " " " " "  = 3ag3:B *
Bovine heart cytochromE C oxidase in the nitric oxide-bound reduced state at 100 k
20. " " " " " "  = 3ag4:B *
Bovine heart cytochromE C oxidase in the cyanide ion-bound f reduced state at 100 k
21. " " " " " "  = 3asn:B *
Bovine heart cytochromE C oxidase in the fully oxidized stat at 1.7470 angstrom wavelength
22. " " " " " "  = 3aso:B *
Bovine heart cytochromE C oxidase in the fully oxidized stat at 0.9 angstrom wavelength
23. 112 31.0% 84 91 150.8 0.2 1bxu:A * Oxidized plastocyanin from synechococcus sp.
24. " " " " " "  = 1bxv:A *
Reduced plastocyanin from synechococcus sp.
25. 108 26.5% 68 159 142.2 0.6 1cyw:A Quinol oxidase (periplasmic fragment of subunit ii) (cyoa)
26. 108 26.5% 68 257 139.1 0.9 1fft:B The structure of ubiquinol oxidase from escherichia coli
27. 99 25.6% 90 111 133.5 1.9 1ibz:A Red copper protein nitrosocyanin from nitrosomonas europaea
28. 99 25.6% 90 112 133.4 1.9 1iby:A Red copper protein nitrosocyanin from nitrosomonas europaea
29. 97 24.6% 69 110 131.1 2.5 1ic0:A Red copper protein nitrosocyanin from nitrosomonas europaea
30. 94 27.5% 80 87 128.9 3.3 4hci:A Uncharacterized cupredoxin-like domain protein cupredoxin_1 bacillus anthracis
31. 94 27.5% 80 88 128.8 3.4 4hcf:A Crystal structure of uncharacterized cupredoxin-like domain cupredoxin_1 with copper bound from bacillus anthracis
32. 94 27.5% 80 90 128.7 3.4 4hcg:B Uncharacterized cupredoxin-like domain protein cupredoxin_1 bound from bacillus anthracis
33. 94 27.5% 80 92 128.5 3.5 4hci:B Uncharacterized cupredoxin-like domain protein cupredoxin_1 bacillus anthracis
34. 94 27.5% 80 96 128.3 3.6 4hcf:B Crystal structure of uncharacterized cupredoxin-like domain cupredoxin_1 with copper bound from bacillus anthracis
35. 94 27.5% 80 95 128.3 3.6 4hcg:A Uncharacterized cupredoxin-like domain protein cupredoxin_1 bound from bacillus anthracis
36. 104 25.2% 131 415 127.4 4 2gp6:A X-ray crystal structure of mycobacterium tuberculosis beta- ketoacyl acyl carrier protein synthase ii (mtkasb)
37. 91 27.5% 91 97 124.5 5.9 1b3i:A * Nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (minimized average structure)
38. " " " " " "  = 2b3i:A *
Nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (19 structures)
39. " " " " " "  = 2jxm:A *
Ensemble of twenty structures of the prochlorothrix hollandica plastocyanin- cytochrome f complex
40. 92 25.9% 85 124 124.1 6.1 2jkw:A Pseudoazurin m16f
41. 98 20.2% 124 414 123.7 6.5 1iso:A Isocitrate dehydrogenase: structure of an engineered NADP+-- specificity-reversal mutant
42. 96 20.0% 120 414 121.3 8.9 1idd:A * Isocitrate dehydrogenase y160f mutant apo enzyme
43. " " " " " "  = 1ide:A *
Isocitrate dehydrogenase y160f mutant steady-state intermedi complex (laue determination)
44. 95 20.0% 120 414 120.0 10 1ai2:A * Isocitrate dehydrogenase complexed with isocitrate, NADP+, a (flash-cooled)
45. " " " " " "  = 1ai3:A *
Orbital steering in the catalytic power of enzymes: small st changes with large catalytic consequences
46. " " " " " "  = 1bl5:A *
Isocitrate dehydrogenase from e. Coli single turnover laue s of rate-limited product complex, 10 msec time resolution
47. 95 20.0% 120 415 120.0 10 1cw1:A * Crystal structure of isocitrate dehydrogenase mutant k230m b isocitrate and mn2+
48. " " " " " "  = 1cw4:A *
Crystal structure of k230m isocitrate dehydrogenase in compl alpha-ketoglutarate
49. 95 20.0% 120 415 120.0 10 1cw7:A Low temperature structure of wild-type idh complexed with mg isocitrate
50. 95 20.0% 120 414 120.0 10 1idc:A * Isocitrate dehydrogenase from e.Coli (mutant k230m), steady- intermediate complex determined by laue crystallography
51. " " " " " "  = 1idf:A *
Isocitrate dehydrogenase k230m mutant apo enzyme
52. 95 20.0% 120 414 120.0 10 1ika:A * Structure of isocitrate dehydrogenase with alpha-ketoglutara angstroms resolution: conformational changes induced by decarboxylation of isocitrate
53. " " " " " "  = 1ikb *
Oxidoreductase(NAD(a)-choh(d))
54. 95 20.0% 120 416 120.0 10 1p8f:A * A four location model to explain the stereospecificity of pr
55. " " " " " "  = 1pb1:A *
A four location model to explain the stereospecificity of pr
56. " " " " " "  = 1pb3:A *
Sites of binding and orientation in a four location model fo stereospecificity.
57. 95 20.0% 120 415 120.0 10 1sjs:A Access to phosphorylation in isocitrate dehydrogenase may oc domain shifting
58. 95 20.0% 120 414 120.0 10 3icd:A Structure of a bacterial enzyme regulated by phosphorylation isocitrate dehydrogenase
59. 95 20.0% 120 415 120.0 10 3lcb:C The crystal structure of isocitrate dehydrogenase kinase/pho in complex with its substrate, isocitrate dehydrogenase, fr escherichia coli.
60. 95 20.0% 120 416 120.0 10 4aj3:A 3d structure of e. Coli isocitrate dehydrogenase in complex isocitrate, calcium(ii) and NADP - the pseudo-michaelis com
61. 95 20.0% 120 415 120.0 10 4aja:A 3d structure of e. Coli isocitrate dehydrogenase in complex isocitrate, calcium(ii) and thionadp
62. 95 20.0% 120 413 120.0 10 4icd:A * Regulation of isocitrate dehydrogenase by phosphorylation in long-range conformational change in the free enzyme
63. " " " " " "  = 5icd:A *
Regulation of an enzyme by phosphorylation at the active sit
64. " " " " " "  = 9icd:A *
Catalytic mechanism of NADP+-dependent isocitrate dehydrogen implications from the structures of magnesium-isocitrate an complexes
65. 89 27.2% 81 138 119.7 11 1mys:B Muscle protein
66. 99 19.5% 149 266 119.2 12 1d9e:A Structure of e. Coli kdo8p synthase
67. 99 19.5% 149 275 119.0 12 1gg0:A Crystal structure analysis of kdop synthase at 3.0 a
68. 99 19.5% 149 272 119.0 12 1phq:A * Crystal structure of kdo8p synthase in its binary complex wi substrate analog e-fpep
69. " " " " " "  = 1phw:A *
Crystal structure of kdo8p synthase in its binary complex wi substrate analog 1-deoxy-a5p
70. " " " " " "  = 1pl9:A *
Crystal structure of kdo8p synthase in its binary complex wi substrate analog z-fpep
71. " " " " " "  = 1q3n:A *
Crystal structure of kdo8p synthase in its binary complex wi substrate pep
72. " " " " " "  = 1x6u:A *
Kdo8p synthase in it's binary complex with the product kdo8p
73. " " " " " "  = 1x8f:A *
Crystal structure of apo-kdo8p synthase
74. 99 19.5% 149 284 118.8 12 1g7u:A Crystal structures of kdo8p synthase in its binary complex w substrate phosphoenol pyruvate
75. 99 19.5% 149 284 118.8 12 1g7v:A Crystal structures of kdo8p synthase in its binary complexes mechanism-based inhibitor
76. 86 28.2% 71 115 117.2 15 1nqj:B Crystal structure of clostridium histolyticum colg collagenase collagen-binding domain 3b at 1.0 angstrom resolution in absence of calcium
77. 92 20.0% 120 414 116.3 17 1grp:A Regulatory and catalytic mechanisms in escherichia coli isoc dehydrogenase: multiple roles for n115
78. 92 20.0% 120 414 116.3 17 1hj6:A Isocitrate dehydrogenase s113e mutant complexed with isopropylmalate, NADP+ and magnesium (flash-cooled)
79. 92 20.0% 120 414 116.3 17 6icd:A Regulation of an enzyme by phosphorylation at the active sit
80. 92 20.0% 120 414 116.3 17 7icd:A * Regulation of an enzyme by phosphorylation at the active sit
81. " " " " " "  = 8icd:A *
Regulation of an enzyme by phosphorylation at the active sit
82. 86 27.2% 81 138 116.1 17 1i84:U * Cryo-em structure of the heavy meromyosin subfragment of chicken gizzard smooth muscle myosin with regulatory light chain in the dephosphorylated state. Only c alphas provided for regulatory light chain. Only backbone atoms provided for s2 fragment.
83. " " " " " "  = 2mys:B *
Myosin subfragment-1, alpha carbon coordinates only for the two light chains
84. 88 25.0% 108 251 114.6 21 1zd1:A Human sulfortransferase sult4a1
85. 84 24.7% 85 124 114.3 22 1bqk:A * Oxidized pseudoazurin
86. " " " " " "  = 1bqr:A *
Reduced pseudoazurin
87. " " " " " "  = 1zia:A *
Oxidized pseudoazurin
88. " " " " " "  = 1zib:A *
Reduced pseudoazurin
89. 90 20.0% 120 414 113.9 23 1gro:A Regulatory and catalytic mechanisms in escherichia coli isoc dehydrogenase: multiple roles for n115
90. 90 24.4% 131 415 113.9 23 2wgd:A * Crystal structure of kasa of mycobacterium tuberculosis
91. " " " " " "  = 2wge:A *
Crystal structure of kasa of mycobacterium tuberculosis with bound tlm
92. 90 24.4% 131 415 113.9 23 2wgf:A * Crystal structure of mycobacterium tuberculosis c171q kasa variant
93. " " " " " "  = 2wgg:A *
Crystal structure of mycobacterium tuberculosis c171q kasa variant with bound tlm
94. 90 24.4% 131 414 113.9 23 4c6u:A Crystal structure of m. Tuberculosis kasa in complex with tl
95. 90 24.4% 131 415 113.9 23 4c6v:A Crystal structure of m. Tuberculosis kasa in complex with tlm5 (soak for 5 min)
96. 90 24.4% 131 414 113.9 23 4c6w:A Crystal structure of m. Tuberculosis c171q kasa
97. 90 24.4% 131 415 113.9 23 4c6x:A Crystal structure of m. Tuberculosis c171q kasa in complex with thiolactomycin (tlm)
98. 90 24.4% 131 414 113.9 23 4c6z:A Crystal structure of m. Tuberculosis c171q kasa in complex with tlm3
99. 90 24.4% 131 415 113.9 23 4c70:A * Crystal structure of m. Tuberculosis c171q kasa in complex w
100. " " " " " "  = 4c71:A *
Crystal structure of m. Tuberculosis c171q kasa in complex w
101. 90 24.4% 131 413 113.9 23 4c72:A Crystal structure of m. Tuberculosis c171q kasa in complex with tlm5
102. 90 24.4% 131 414 113.9 23 4c73:A Crystal structure of m. Tuberculosis c171q kasa in complex with tlm6
103. 83 34.1% 41 130 112.7 26 1cc3:A Purple cua center
104. 80 22.6% 93 98 110.9 34 1m9w:A Study of electrostatic potential surface distribution using high resolution side-chain conformation determined by nmr
105. 80 22.0% 91 98 110.9 34 1pcs:A The 2.15 a crystal structure of a triple mutant plastocyanin cyanobacterium synechocystis sp. Pcc 6803
106. 86 25.2% 123 341 110.2 37 3meq:A Crystal structure of alcohol dehydrogenase from brucella mel
107. 79 22.8% 92 98 109.7 39 1i0w:A * Solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803
108. " " " " " "  = 1i0y:A *
Solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803-minimized average structure
109. " " " " " "  = 1j5c:A *
Solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803
110. " " " " " "  = 1j5d:A *
Solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803-minimized average structure
111. " " " " " "  = 1jxd:A *
Solution structure of reduced cu(i) plastocyanin from synechocystis pcc6803
112. " " " " " "  = 1jxf:A *
Solution structure of reduced cu(i) plastocyanin from synechocystis pcc6803
113. 90 25.4% 118 954 108.5 46 2okx:A Crystal structure of gh78 family rhamnosidase of bacillus sp 1.9 a

Number of sequences: 113

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer