spacer
spacer

SAS results for UniProt accession no. Q62760

Sequence annotated by structure
>

Key:
Sec. struc: By homology Predicted
  Helix Strand   Helix Strand

Predicted secondary structure (green) comes from the DSC program. The lighter the green the less certain the prediction. Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

 

FASTA alignment for UniProt accession no. Q62760 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. Q62760 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 26 unique sequences (including 5 consensus sequences) giving 50 sequence matches in all. The 6 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q62760 -----------------------------------------------------mvgrnsaiaagv    Mitochondrial import receptor subunit TOM20 homolog  ...
1om2:A -----------------------------------------------------------------    Solution nmr structure of the mitochondrial protein import  ...
1wt4:B -----------------------------------------------------------------    Crystal structure of rat tom20-aldh presequence complex
2cuv:C*-----------------------------------------------------------------×2  Crystal structure of disulfide bond tethered tom20-  ...
2v1t:B -----------------------------------------------------------------    Crystal structure of rat tom20-aldh presequence complex
3ax5:A -----------------------------------------------------------------    Crystal structure of rat tom20-aldh presequence complex: a  ...
3ax2:A -----------------------------------------------------------------    Crystal structure of rat tom20-aldh presequence complex: a  ...
2cuv:E*-----------------------------------------------------------------×2  Crystal structure of disulfide bond tethered tom20-  ...
1wt4:A*-----------------------------------------------------------------×3  Crystal structure of rat tom20-aldh presequence complex
3ax5:C -----------------------------------------------------------------    Crystal structure of rat tom20-aldh presequence complex: a  ...
2cuv:A*-----------------------------------------------------------------×2  Crystal structure of disulfide bond tethered tom20-  ...
3ax3:E -----------------------------------------------------------------    Crystal structure of rat tom20-aldh presequence complex: a  ...
3ax2:E -----------------------------------------------------------------    Crystal structure of rat tom20-aldh presequence complex: a  ...
3awr:B -----------------------------------------------------------------    Crystal structure of rat tom20-aldh presequence complex:  ...
3ax3:A -----------------------------------------------------------------    Crystal structure of rat tom20-aldh presequence complex: a  ...
2v1s:G -----------------------------------------------------------------    Crystal structure of rat tom20-aldh presequence complex
2cuv:G -----------------------------------------------------------------    Crystal structure of disulfide bond tethered tom20-  ...
1jj2:L*arsaysyireawkrpkegqiaelmwhrmqewrnepavvrierptrldrarslgykakqgiivvrv×20 Fully refined crystal structure of the haloarcula  ...
2kkm:A ------------mredkiaakkklhqdkrvhelarvkfmqdvvnsdtfkgqpifdhahtrefiqs    Solution nmr structure of yeast protein yor252w [residues  ...
2jnx:A ------------------------------maealfkqldangdgsvsyeevkafvsskrpikne    Nmr derived solution structure of an ef-hand calcium  ...
3iug:A -------------------------------------------gervfgcdlgehllnsgfevpq    Crystal structure of the rhogap domain of rics

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
Q62760 cgalfigyciyfdrkrrsd--pnfknrlrerrkkqklakera-glsklpdlkdaeavq---kffl    Mitochondrial import receptor subunit TOM20 homolog  ...
1om2:A ----------------------------------------ra-glsklpdlkdaeavq---kffl    Solution nmr structure of the mitochondrial protein import  ...
1wt4:B -------------------------------------------------dlkdaeavq---kffl    Crystal structure of rat tom20-aldh presequence complex
2cuv:C*------------------------------------------------sdlkdaeavq---kffl×2  Crystal structure of disulfide bond tethered tom20-  ...
2v1t:B -------------------------------------------------dlkdaeavq---kffl    Crystal structure of rat tom20-aldh presequence complex
3ax5:A ------------------------------------------------sdlkdaeavq---kffl    Crystal structure of rat tom20-aldh presequence complex: a  ...
3ax2:A -----------------------------------------------gsdlkdaeavq---kffl    Crystal structure of rat tom20-aldh presequence complex: a  ...
2cuv:E*----------------------------------------------lgsdlkdaeavq---kffl×2  Crystal structure of disulfide bond tethered tom20-  ...
1wt4:A*--------------------------------------------gplgsdlkdaeavq---kffl×3  Crystal structure of rat tom20-aldh presequence complex
3ax5:C --------------------------------------------gplgsdlkdaeavq---kffl    Crystal structure of rat tom20-aldh presequence complex: a  ...
2cuv:A*---------------------------------------------------kdaeavq---kffl×2  Crystal structure of disulfide bond tethered tom20-  ...
3ax3:E -------------------------------------------------dlkdaeavq---kffl    Crystal structure of rat tom20-aldh presequence complex: a  ...
3ax2:E ----------------------------------------------------daeavq---kffl    Crystal structure of rat tom20-aldh presequence complex: a  ...
3awr:B -----------------------------------------------------aeavq---kffl    Crystal structure of rat tom20-aldh presequence complex:  ...
3ax3:A ---------------------------------------------------kdaeavq---kffl    Crystal structure of rat tom20-aldh presequence complex: a  ...
2v1s:G -----------------------------------------------------aeavq---kffl    Crystal structure of rat tom20-aldh presequence complex
2cuv:G -----------------------------------------------------aeavq---kffl    Crystal structure of disulfide bond tethered tom20-  ...
1jj2:L*airkgssrrtrfnkgrrsk--rmmvnritrkkniqriaeera-n-rkfpnlrvlnsys---vged×20 Fully refined crystal structure of the haloarcula  ...
2kkm:A fierddteldelkkkrrsnrppsnrqvllqqrrdqelkefka-gfl-cpdlsdaknme---flrn    Solution nmr structure of yeast protein yor252w [residues  ...
2jnx:A qllqlifkaididgngeid--laeftkfaaavkeqdlsdekv-glkilyklmdadgdg---kltk    Nmr derived solution structure of an ef-hand calcium  ...
3iug:A vlqsctafierygivdgiy--rlsgvasniqrlrhefdsehvpdltkepyvqdihsvgslcklyf    Crystal structure of the rhogap domain of rics

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
Q62760 eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltklptisqriv    Mitochondrial import receptor subunit TOM20 homolog  ...
1om2:A eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltklptisqriv    Solution nmr structure of the mitochondrial protein import  ...
1wt4:B eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltkl--------    Crystal structure of rat tom20-aldh presequence complex
2cuv:C*eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltkl--------×2  Crystal structure of disulfide bond tethered tom20-  ...
2v1t:B eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltkl--------    Crystal structure of rat tom20-aldh presequence complex
3ax5:A eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltkl--------    Crystal structure of rat tom20-aldh presequence complex: a  ...
3ax2:A eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltkl--------    Crystal structure of rat tom20-aldh presequence complex: a  ...
2cuv:E*eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltkl--------×2  Crystal structure of disulfide bond tethered tom20-  ...
1wt4:A*eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltkl--------×3  Crystal structure of rat tom20-aldh presequence complex
3ax5:C eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltk---------    Crystal structure of rat tom20-aldh presequence complex: a  ...
2cuv:A*eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltkl--------×2  Crystal structure of disulfide bond tethered tom20-  ...
3ax3:E eeiqlgeellaqgdyekgvdhltnaiavsgqpqqllqv--lqqtlpppvfqmlltkl--------    Crystal structure of rat tom20-aldh presequence complex: a  ...
3ax2:E eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltkl--------    Crystal structure of rat tom20-aldh presequence complex: a  ...
3awr:B eeiqlgeellaqgdyekgvdhltnaiavcgqpqqllqv--lqqtlpppvfqmlltkl--------    Crystal structure of rat tom20-aldh presequence complex:  ...
3ax3:A eeiqlgeellaqgdyekgvdhltnaiavsgqpqqllqv--lqqtlpppvfqmlltkl--------    Crystal structure of rat tom20-aldh presequence complex: a  ...
2v1s:G eeiql------------------------------------------------------------    Crystal structure of rat tom20-aldh presequence complex
2cuv:G eeiq-------------------------------------------------------------    Crystal structure of disulfide bond tethered tom20-  ...
1jj2:L*grhkwhevilidpdhpaiksddqlswisrtrhrlrtfr--gltsagrrcrglrgqgkgsekvrps×20 Fully refined crystal structure of the haloarcula  ...
2kkm:A wngtfgllntlrlirindkgeqvvggne-------------------------------------    Solution nmr structure of yeast protein yor252w [residues  ...
2jnx:A eev---ttffkkfgyekvvdqimkadangdgyitleef--lafnl--------------------    Nmr derived solution structure of an ef-hand calcium  ...
3iug:A re--lpnplltyqlyek----fsdavsaatdeerlikihdviqqlppphyrtleflmrhlsllad    Crystal structure of the rhogap domain of rics

           2         2         2         2     
           0         1         2         3     
       6789012345678901234567890123456789012345                             Protein name
       ----+---------+---------+---------+-----                             ------------
Q62760 saqslaeddve-----------------------------                             Mitochondrial import receptor subunit TOM20 homolog  ...
1om2:A saqslgeddve-----------------------------                             Solution nmr structure of the mitochondrial protein import  ...
1wt4:B ----------------------------------------                             Crystal structure of rat tom20-aldh presequence complex
2cuv:C*----------------------------------------                         ×2  Crystal structure of disulfide bond tethered tom20-  ...
2v1t:B ----------------------------------------                             Crystal structure of rat tom20-aldh presequence complex
3ax5:A ----------------------------------------                             Crystal structure of rat tom20-aldh presequence complex: a  ...
3ax2:A ----------------------------------------                             Crystal structure of rat tom20-aldh presequence complex: a  ...
2cuv:E*----------------------------------------                         ×2  Crystal structure of disulfide bond tethered tom20-  ...
1wt4:A*----------------------------------------                         ×3  Crystal structure of rat tom20-aldh presequence complex
3ax5:C ----------------------------------------                             Crystal structure of rat tom20-aldh presequence complex: a  ...
2cuv:A*----------------------------------------                         ×2  Crystal structure of disulfide bond tethered tom20-  ...
3ax3:E ----------------------------------------                             Crystal structure of rat tom20-aldh presequence complex: a  ...
3ax2:E ----------------------------------------                             Crystal structure of rat tom20-aldh presequence complex: a  ...
3awr:B ----------------------------------------                             Crystal structure of rat tom20-aldh presequence complex:  ...
3ax3:A ----------------------------------------                             Crystal structure of rat tom20-aldh presequence complex: a  ...
2v1s:G ----------------------------------------                             Crystal structure of rat tom20-aldh presequence complex
2cuv:G ----------------------------------------                             Crystal structure of disulfide bond tethered tom20-  ...
1jj2:L*lrvngaka--------------------------------                         ×20 Fully refined crystal structure of the haloarcula  ...
2kkm:A ----------------------------------------                             Solution nmr structure of yeast protein yor252w [residues  ...
2jnx:A ----------------------------------------                             Nmr derived solution structure of an ef-hand calcium  ...
3iug:A ycsitnmhaknlaivwapnllrsqsvvvefilnhvdvlfs                             Crystal structure of the rhogap domain of rics

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. Q62760. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 145 - - Q62760 Mitochondrial import receptor subunit TOM20 homolog OS=Rattus norvegicus GN=Tomm20 PE=1 SV=2
2. 603 98.9% 95 95 761.8 1.9e-35 1om2:A Solution nmr structure of the mitochondrial protein import receptor tom20 from rat in a complex with a presequence peptide derived from rat aldehyde dehydrogenase (aldh)
3. 443 100.0% 68 68 564.7 1.8e-24 1wt4:B Crystal structure of rat tom20-aldh presequence complex
4. 443 100.0% 68 69 564.7 1.8e-24 2cuv:C * Crystal structure of disulfide bond tethered tom20- presequence complexes
5. " " " " " "  = 2v1s:C *
Crystal structure of rat tom20-aldh presequence complex
6. 443 100.0% 68 68 564.7 1.8e-24 2v1t:B Crystal structure of rat tom20-aldh presequence complex
7. 443 100.0% 68 69 564.7 1.8e-24 3ax5:A Crystal structure of rat tom20-aldh presequence complex: a c (form1) between tom20 and a disulfide-bridged presequence p containing d-cys and l-cys at the i and i+3 positions.
8. 443 100.0% 68 70 564.6 1.8e-24 3ax2:A Crystal structure of rat tom20-aldh presequence complex: a d tethered complex with a non-optimized, long linker
9. 443 100.0% 68 71 564.5 1.8e-24 2cuv:E * Crystal structure of disulfide bond tethered tom20- presequence complexes
10. " " " " " "  = 2v1s:E *
Crystal structure of rat tom20-aldh presequence complex
11. 443 100.0% 68 73 564.3 1.9e-24 1wt4:A * Crystal structure of rat tom20-aldh presequence complex
12. " " " " " "  = 2v1t:A *
Crystal structure of rat tom20-aldh presequence complex
13. " " " " " "  = 3awr:A *
Crystal structure of rat tom20-aldh presequence complex: the intermolecular disulfide bond was cleaved in the crystal of disulfide-tethered complex.
14. 438 100.0% 67 72 558.2 4.1e-24 3ax5:C Crystal structure of rat tom20-aldh presequence complex: a c (form1) between tom20 and a disulfide-bridged presequence p containing d-cys and l-cys at the i and i+3 positions.
15. 430 100.0% 66 66 548.7 1.4e-23 2cuv:A * Crystal structure of disulfide bond tethered tom20- presequence complexes
16. " " " " " "  = 2v1s:A *
Crystal structure of rat tom20-aldh presequence complex
17. 429 98.5% 68 68 547.3 1.6e-23 3ax3:E Crystal structure of rat tom20-aldh presequence complex: a c (form2) between tom20 and a disulfide-bridged presequence p containing d-cys and l-cys at the i and i+3 positions.
18. 424 100.0% 65 65 541.4 3.5e-23 3ax2:E Crystal structure of rat tom20-aldh presequence complex: a d tethered complex with a non-optimized, long linker
19. 416 100.0% 64 64 531.5 1.2e-22 3awr:B Crystal structure of rat tom20-aldh presequence complex: the intermolecular disulfide bond was cleaved in the crystal of disulfide-tethered complex.
20. 416 98.5% 66 66 531.3 1.3e-22 3ax3:A Crystal structure of rat tom20-aldh presequence complex: a c (form2) between tom20 and a disulfide-bridged presequence p containing d-cys and l-cys at the i and i+3 positions.
21. 84 100.0% 14 14 127.4 4.1 2v1s:G Crystal structure of rat tom20-aldh presequence complex
22. 79 100.0% 13 13 121.6 8.5 2cuv:G Crystal structure of disulfide bond tethered tom20- presequence complexes
23. 89 36.8% 38 194 118.3 13 1jj2:L * Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
24. " " " " " "  = 1k73:N *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
25. " " " " " "  = 1k8a:N *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
26. " " " " " "  = 1k9m:N *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
27. " " " " " "  = 1kc8:N *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
28. " " " " " "  = 1kd1:N *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
29. " " " " " "  = 1kqs:L *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
30. " " " " " "  = 1m1k:N *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
31. " " " " " "  = 1m90:N *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
32. " " " " " "  = 1n8r:N *
Structure of large ribosomal subunit in complex with virginiamycin m
33. " " " " " "  = 1nji:N *
Structure of chloramphenicol bound to the 50s ribosomal subunit
34. " " " " " "  = 1q7y:N *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
35. " " " " " "  = 1q81:N *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
36. " " " " " "  = 1q82:N *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
37. " " " " " "  = 1q86:N *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
38. " " " " " "  = 1qvf:L *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
39. " " " " " "  = 1qvg:L *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
40. " " " " " "  = 1w2b:L *
Trigger factor ribosome binding domain in complex with 50s
41. " " " " " "  = 3cxc:L *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
42. " " " " " "  = 3ow2:L *
Crystal structure of enhanced macrolide bound to 50s ribosom
43. 86 36.4% 44 141 116.4 16 2kkm:A Solution nmr structure of yeast protein yor252w [residues 38-178]: northeast structural genomics consortium target yt654
44. 85 35.7% 56 134 115.5 19 2jnx:A Nmr derived solution structure of an ef-hand calcium binding protein from entamoeba histolytica
45. 85 26.1% 88 184 113.6 24 3iug:A Crystal structure of the rhogap domain of rics

Number of sequences: 45

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 88 24.7% 85 367 113.4 24 1vpk:A Crystal structure of DNA polymerase iii, beta subunit (tm026 thermotoga maritima at 2.00 a resolution
2. 90 27.0% 115 722 111.9 29 1xdj:A Crystal structure of t. Maritima cobalamin-independent methionine synthase complexed with zn2+ and homocysteine
3. 90 27.0% 115 734 111.8 30 1t7l:A Crystal structure of cobalamin-independent methionine synthase from t. Maritima
4. 90 27.0% 115 734 111.8 30 1xpg:A Crystal structure of t. Maritima cobalamin-independent methionine synthase complexed with zn2+ and methyltetrahydrofolate
5. 82 28.0% 75 168 110.4 36 3m5k:A Crystal structure of putative nadh dehydrogenase/NAD(p)h nitroreductase (bdi_1728) from parabacteroides distasonis a at 1.86 a resolution
6. 100 27.1% 118 364 109.7 39 2hma:A The crystal structure of tRNA (5-methylaminomethyl-2-thiouri methyltransferase trmu from streptococcus pneumoniae

Number of sequences: 6

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer