spacer
spacer

SAS results for UniProt accession no. P10175

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P10175 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P10175 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 24 unique sequences (including 1 consensus sequences) giving 49 sequence matches in all. The 4 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P10175 -----------------------------------------------------------------    Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos  ...
1occ:M*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
3sjp:A -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus varian
2vge:A -----------------------------------------------------------------    Crystal structure of thE C-terminal region of human iaspp
3skb:I -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus varian
1zjj:A -----------------------------------------------------------------    Crystal structure of hypothetical protein ph1952 from  ...
3sej:I -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3sln:H -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3sld:H -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3l81:A -----------------------------------------------------------------    Crystal structure of adaptor protein complex 4 (ap-4) mu4  ...
4n2r:A -----------------------------------------------------------------    Crystal structure of the alpha-l-arabinofuranosidase  ...
4n1i:A -----------------------------------------------------------------    Crystal structure of the alpha-l-arabinofuranosidase  ...
2c3a:B -----------------------------------------------------------------    Structure of unliganded hsv gd reveals a mechanism for  ...
1hk6:A -----------------------------------------------------------------    Ral binding domain from sec5
2bl0:A -----------------------------------------------------------------    Physarum polycephalum myosin ii regulatory domain
3cyj:A -----------------------------------------------------------------    Crystal structure of a mandelate racemase/muconate  ...
3cbg:A -----------------------------------------------------------------    Functional and structural characterization of a  ...
3rcn:A -----------------------------------------------------------------    Crystal structure of beta-n-acetylhexosaminidase from  ...
1uad:C -----------------------------------------------------------------    Crystal structure of the rala-gppnhp-sec5 ral-binding  ...
2r0p:A --mnapietdvlilgggpvgmalaldlahrqvghlvveqtdgtithprvgtigprsmelfrrwgv    K252c-soaked rebc
3ept:A apietdvlilgggpvgmalaldlahrqvghlvveqtdgtithprvgtigprsmelfrrwgvakqi    Structure of the rebeccamycin biosynthetic enzyme rebc with  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P10175 -----------------------------------------------------------------    Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos  ...
1occ:M*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
3sjp:A -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus varian
2vge:A -----------------------------------------------------------------    Crystal structure of thE C-terminal region of human iaspp
3skb:I -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus varian
1zjj:A -----------------------------------------------------------------    Crystal structure of hypothetical protein ph1952 from  ...
3sej:I -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3sln:H -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3sld:H -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3l81:A -------------------------------------------------------------nevf    Crystal structure of adaptor protein complex 4 (ap-4) mu4  ...
4n2r:A -----------------------------------------------------------------    Crystal structure of the alpha-l-arabinofuranosidase  ...
4n1i:A -----------------------------------------------------------------    Crystal structure of the alpha-l-arabinofuranosidase  ...
2c3a:B ---------------------------------------lpvldqltdppgvrrcyhiqaglpdp    Structure of unliganded hsv gd reveals a mechanism for  ...
1hk6:A -----------------------------------------------------------------    Ral binding domain from sec5
2bl0:A -----------------------------------------------------------------    Physarum polycephalum myosin ii regulatory domain
3cyj:A -----------------------------------------------------------------    Crystal structure of a mandelate racemase/muconate  ...
3cbg:A -----------------------------------------------------------------    Functional and structural characterization of a  ...
3rcn:A -----------------------------------------------------------------    Crystal structure of beta-n-acetylhexosaminidase from  ...
1uad:C -----------------------------------------------------------------    Crystal structure of the rala-gppnhp-sec5 ral-binding  ...
2r0p:A akqirtagwpgdhpldaawvtrvgghevyriplgtadtratpehtpepdaicpqhwlapllaeav    K252c-soaked rebc
3ept:A rtagwpgdhpldaawvtrvgghevyriplgtadtratpehtpepdaicpqhwlapllaeavgerl    Structure of the rebeccamycin biosynthetic enzyme rebc with  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P10175 -----------------------------------------------------------------    Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos  ...
1occ:M*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
3sjp:A -----------------esrtkpftvpiltveemtnsrfpipleklftgpssafvvqpqngrctt    Structural characterization of a gii.4 2004 norovirus varian
2vge:A -----------------------------------------------------------------    Crystal structure of thE C-terminal region of human iaspp
3skb:I -----------------------rtkpftvpiltveemtnsrfpipleklftgpssafvvqpqng    Structural characterization of a gii.4 2004 norovirus varian
1zjj:A -----------------------------------------------------------------    Crystal structure of hypothetical protein ph1952 from  ...
3sej:I ------------------------------esrtkpftvpiltveemtnsrfpipleklftgpss    Structural characterization of a gii.4 2004 norovirus  ...
3sln:H -----------------------esrtkpftvpiltveemtnsrfpipleklftgpssafvvqpq    Structural characterization of a gii.4 2004 norovirus  ...
3sld:H ----------------------esrtkpftvpiltveemtnsrfpipleklftgpssafvvqpqn    Structural characterization of a gii.4 2004 norovirus  ...
3l81:A ldvverlsvliasngsllkvdvqgeirlksflpsgsemriglteefsvgkselrgygpgirvdev    Crystal structure of adaptor protein complex 4 (ap-4) mu4  ...
4n2r:A -----------------------------------------------------------------    Crystal structure of the alpha-l-arabinofuranosidase  ...
4n1i:A -----------------------------------------------------------------    Crystal structure of the alpha-l-arabinofuranosidase  ...
2c3a:B fqppslpitvyyavleracrsvllnapseapqivrgasedvrkqpynltiawfrmggncaipitv    Structure of unliganded hsv gd reveals a mechanism for  ...
1hk6:A -----------------------------------------------------------------    Ral binding domain from sec5
2bl0:A -----------------------------------------------------------------    Physarum polycephalum myosin ii regulatory domain
3cyj:A --------------------------------------------prverlevsaytvptdypesd    Crystal structure of a mandelate racemase/muconate  ...
3cbg:A ----------------------------------------------------------------k    Functional and structural characterization of a  ...
3rcn:A -----------------------------------------------------------------    Crystal structure of beta-n-acetylhexosaminidase from  ...
1uad:C -----------------------------------------------------------------    Crystal structure of the rala-gppnhp-sec5 ral-binding  ...
2r0p:A gerlrtrsrldsfeqrddhvratitdlrtgatravharylvacdgassptrkalgidapprhrtq    K252c-soaked rebc
3ept:A rtrsrldsfeqrddhvratitdlrtgatravharylvacdgassptrkalgidapprhrtqvfrn    Structure of the rebeccamycin biosynthetic enzyme rebc with  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P10175 -----------------------------------------------------------------    Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos  ...
1occ:M*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
3sjp:A dgallgttqlspvdictfrgdvthiagtqnytmnlasqnwnnydpteeipaplgtpdfvgkiqgv    Structural characterization of a gii.4 2004 norovirus varian
2vge:A -----------------------------------------------------------------    Crystal structure of thE C-terminal region of human iaspp
3skb:I rcttdgallgttqlspvdictfrgdvthiagtqnytmnlasqnwnnydpteeipaplgtpdfvgk    Structural characterization of a gii.4 2004 norovirus varian
1zjj:A -----------------------------------------------------------------    Crystal structure of hypothetical protein ph1952 from  ...
3sej:I afvvqpqngrcttdgallgttqlspvdictfrgdvthiagtqnytmnlsqnwnnydpteeipapl    Structural characterization of a gii.4 2004 norovirus  ...
3sln:H ngrcttdgallgttqlspvdictfrgdvthiagtqnytmnlasqnwnnydpteeipaplgtpdfv    Structural characterization of a gii.4 2004 norovirus  ...
3sld:H grcttdgallgttqlspvdictfrgdvthiagtqnytmnlasqnwnnydpteeipaplgtpdfvg    Structural characterization of a gii.4 2004 norovirus  ...
3l81:A sfhssvnldefeshrilrlqppqgeltvmryqlsddlpsplpfrlfpsvqwdrgsgrlqvylklr    Crystal structure of adaptor protein complex 4 (ap-4) mu4  ...
4n2r:A -----------------scalpttyrwtssaplaqpkdgwvslkdfthvpyngqhlvyasyhdst    Crystal structure of the alpha-l-arabinofuranosidase  ...
4n1i:A -----------------scalpttyrwtssaplaqpkdgwvslkdfthvpyngqhlvyasyhdst    Crystal structure of the alpha-l-arabinofuranosidase  ...
2c3a:B meytecsynkslgacpirtqprwnyydsfsavsednlgflmhapafetagtylrlvkindwteit    Structure of unliganded hsv gd reveals a mechanism for  ...
1hk6:A -----------------------------------------------------------------    Ral binding domain from sec5
2bl0:A -----------------------------------------------------------------    Physarum polycephalum myosin ii regulatory domain
3cyj:A gtlqwdsttmilveahgggrkglgytygdvsvgrfvesklagvaegsdalsppavwarmqaairn    Crystal structure of a mandelate racemase/muconate  ...
3cbg:A gitgfdpslysylqsisaddsfylaqlrretahlpgapmqispeqaqflgllisltgakqvleig    Functional and structural characterization of a  ...
3rcn:A ----------msafhqlipapwsfsagtgeleldagtsvgadpelrgprrwltralggatgwdla    Crystal structure of beta-n-acetylhexosaminidase from  ...
1uad:C -----------------------------------------------------------------    Crystal structure of the rala-gppnhp-sec5 ral-binding  ...
2r0p:A vfrnilfrapelrsllgeraalffflmllrfplraldgrglyrltvgvdtmdsfelvrravafdt    K252c-soaked rebc
3ept:A ilfrapelrsllgeraalffflmlssslrfplraldgrglyrltvgvddtmdsfelvrravafdt    Structure of the rebeccamycin biosynthetic enzyme rebc with  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P10175 ----------------------------------------------mlrlap-tvrllqapl---    Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos  ...
1occ:M*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
3sjp:A ltqttrrdgstrghkatvstgsvhftpklgsvqfstdtsndfetgqntrftp--vgvvq-pq---    Structural characterization of a gii.4 2004 norovirus varian
2vge:A ----------------------------------------sprkarrarlnp-lvllldaal---    Crystal structure of thE C-terminal region of human iaspp
3skb:I iqgvltqttrrdgstrghkatvstgsvhftpklgsvqfstdtsndfetgqnt-rftpvgvvp---    Structural characterization of a gii.4 2004 norovirus varian
1zjj:A --------------------------------mvaiifdmdgvlyrgnraip-gvreliefl---    Crystal structure of hypothetical protein ph1952 from  ...
3sej:I gtpdfvgkiqgvltqttrrdgstrghkatvstgsvhftpklgsvqfstfetg-qntrftpvg---    Structural characterization of a gii.4 2004 norovirus  ...
3sln:H gkiqgvltqttrrdgstrghkatvstgsvhftpklgsvqfstdtfetgqntr-ftpvgvvep---    Structural characterization of a gii.4 2004 norovirus  ...
3sld:H kiqgvltqttrrdgstrghkatvstgsvhftpklgsvqfstdtdfetgqntr-ftpvgvvep---    Structural characterization of a gii.4 2004 norovirus  ...
3l81:A cdllsksqalnvrlhlplprgvvslsqelsspeqkaelaegalrwdlprvqg-gsqlsglfq---    Crystal structure of adaptor protein complex 4 (ap-4) mu4  ...
4n2r:A kygsmafspfkhwadmatatqtgmtqaavaptvfyftpkklwflvsqwgsapftyrtstdpt---    Crystal structure of the alpha-l-arabinofuranosidase  ...
4n1i:A kygsmafspfkhwadmatatqtgmtqaavaptvfyftpkklwflvsqwgsapftyrtstdpt---    Crystal structure of the alpha-l-arabinofuranosidase  ...
2c3a:B qfilehrakgsckyalplrippsaclspqayqqgvtvdsigmlprfipenqr-tvavyslki---    Structure of unliganded hsv gd reveals a mechanism for  ...
1hk6:A ----------------------------------------------hmrqpp-lvtgi-spn---    Ral binding domain from sec5
2bl0:A -----------------------------------------------rrige-ivkvvqaaa---    Physarum polycephalum myosin ii regulatory domain
3cyj:A agrpgvgamavsavdialwdlkarllglpladalprfhaevpvygsggftsy-plrrlqeql---    Crystal structure of a mandelate racemase/muconate  ...
3cbg:A vfrgysalamalqlppdgqiiacdqdpnataiakkywqkagvaekislrlgp-alatleqlt---    Functional and structural characterization of a  ...
3rcn:A papareagirllldpsldaeayrlevsdavvisaggaagafygaqtllqllg-paalrqapvvav    Crystal structure of beta-n-acetylhexosaminidase from  ...
1uad:C -----------------------------------------------srqpp-lvtgi-spn---    Crystal structure of the rala-gppnhp-sec5 ral-binding  ...
2r0p:A eievlsdsewhlthrvadsfsagrvfltgdaahtlspsggfgmntgigsaad-lgwklaatl---    K252c-soaked rebc
3ept:A eievlsdsewhlthrvadsfsagrvfltgdaahtlspsggfgmntgigsaad-lgwklaatl---    Structure of the rebeccamycin biosynthetic enzyme rebc with  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P10175 r--gwa---vp--k-----ah-itak--paktp---tspk--eq--ai--------gls-v-tf-    Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos  ...
1occ:M*----------------------ITAK--PAKTP---TSPK--EQ--AI--------GLS-V-TF-×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
3sjp:A q---wv---lp--dysgrdshnvhla--pavap---tfpg--eq--ll--------ffr-s-tm-    Structural characterization of a gii.4 2004 norovirus varian
2vge:A t--g-e---le--v-----vq-qavk--emndp---sqpn--ee--gitalhnaicgan-y-si-    Crystal structure of thE C-terminal region of human iaspp
3skb:I q--qwv---lp--dysgrdshnvhla--pavap---tfpg--eq--ll--------ffr-s-tmp    Structural characterization of a gii.4 2004 norovirus varian
1zjj:A k--erg---ip--f-----af-ltnn--stktp---emyr--ekllkm--------gid-v-ss-    Crystal structure of hypothetical protein ph1952 from  ...
3sej:I v--qwv---lp--dysgrdshnvhla--pavap---tfpg--eq--ll--------ffr-s-tmp    Structural characterization of a gii.4 2004 norovirus  ...
3sln:H q--qwv---lp--dysgrdshnvhla--pavap---tfpg--eq--ll--------ffr-s-tmp    Structural characterization of a gii.4 2004 norovirus  ...
3sld:H q--qwv---lp--dysgrdshnvhla--pavap---tfpg--eq--ll--------ffr-s-tmp    Structural characterization of a gii.4 2004 norovirus  ...
3l81:A m--dvp---gp--p-----gl-glgp--aslsf---elpr--ht--cs--------glq-v-rf-    Crystal structure of adaptor protein complex 4 (ap-4) mu4  ...
4n2r:A kvngws---ap--q-----pl-ftgk--vadsg---tgpi--dq--tv--------iad-d-rk-    Crystal structure of the alpha-l-arabinofuranosidase  ...
4n1i:A kvngws---ap--q-----pl-ftgk--vadsg---tgpi--dq--tv--------iad-d-rk-    Crystal structure of the alpha-l-arabinofuranosidase  ...
2c3a:B a--gwh---gp--k-----ap-ytstllppelp---edpe--ds--al--------ledpv-gt-    Structure of unliganded hsv gd reveals a mechanism for  ...
1hk6:A e--g-----ip--w-----tk-vtir--genlg---tgpt--dl---i--------glt-i-cg-    Ral binding domain from sec5
2bl0:A r--gw----ve--r-----kh-frqa--reksv---sa-----r--ii--------qdn-iray-    Physarum polycephalum myosin ii regulatory domain
3cyj:A g--gwaaagiprvk-----mk-vgre--pekdp---ervraare--ai--------ges-v-el-    Crystal structure of a mandelate racemase/muconate  ...
3cbg:A q--gkp---lp--e-----fd-lifi--dadkr---nypr--yy--ei--------gln-l-lr-    Functional and structural characterization of a  ...
3rcn:A e--gws---vp--r-----vs-vedk--prfgy---rgtm--ld--va--------rhf-m-pk-    Crystal structure of beta-n-acetylhexosaminidase from  ...
1uad:C e--g-----ip--w-----tk-vtir--genlg---tgpt--dl---i--------glt-i-cg-    Crystal structure of the rala-gppnhp-sec5 ral-binding  ...
2r0p:A r--gwa---gp--g-----ll-atye--eerrpvaitsle--ea--nv--------nlr-r-t--    K252c-soaked rebc
3ept:A r--gwa---gp--g-----ll-atye--eerrpvaitsle--ea--nv--------nlr-r-t--    Structure of the rebeccamycin biosynthetic enzyme rebc with  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P10175 --lsf--llpagwv--ly---hldnykkssaa---------------------------------    Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos  ...
1occ:M*--LSF--LLPAGWV--LY---HLDNYKKS------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
3sjp:A --mnldcllpqewv---q---hf--yqesapaqsdvallrfvnpdtgrvlfecklhksgyvtvah    Structural characterization of a gii.4 2004 norovirus varian
2vge:A --vdf--litagan--vn---spdshgwtplhcaascndtvicmalvqhgaaifattlsdgataf    Crystal structure of thE C-terminal region of human iaspp
3skb:I n-ldc--llpqewv---q---hf--yqesapaqsdvallrfvnpdtgrvlfecklhksgyvtvah    Structural characterization of a gii.4 2004 norovirus varian
1zjj:A ---si--iitsglatrlymskhldpgkifviggeglvkemqalgwgivtldearqgswkevkhvv    Crystal structure of hypothetical protein ph1952 from  ...
3sej:I gnldc--llpqewv---q---hf--yqesapaqsdvallrfvnpdtgrvlfecklhksgyvtvah    Structural characterization of a gii.4 2004 norovirus  ...
3sln:H mnldc--llpqewv---q---hf--yqesapaqsdvallrfvnpdtgrvlfecklhksgyvtvah    Structural characterization of a gii.4 2004 norovirus  ...
3sld:H mnldc--llpqewv---q---hf--yqesapaqsdvallrfvnpdtgrvlfecklhksgyvtvah    Structural characterization of a gii.4 2004 norovirus  ...
3l81:A --lrl--afphkwvrhls---hsdayviri-----------------------------------    Crystal structure of adaptor protein complex 4 (ap-4) mu4  ...
4n2r:A --vyl--ffvadng--kv---yrtsmaigdfpanfgtasevilsdtqaklfeavqvytvagqnqy    Crystal structure of the alpha-l-arabinofuranosidase  ...
4n1i:A --vyl--ffvadng--kv---yrtsmaigdfpanfgtasevilsdtqaklfeavqvytvagqnqy    Crystal structure of the alpha-l-arabinofuranosidase  ...
2c3a:B --vap--qippnwh--ip---siqdcatpyh----------------------------------    Structure of unliganded hsv gd reveals a mechanism for  ...
1hk6:A --hnc--lltaewm--sa---skivcrvgqakndkgdiivttksggkgtstvsfkllkpek----    Ral binding domain from sec5
2bl0:A --lef--knwawwk--lf---akarpllv------------------------------------    Physarum polycephalum myosin ii regulatory domain
3cyj:A --mvd--angaytr--kq---alywagafareagisyleepvssedreglrllrdrgpggvaiaa    Crystal structure of a mandelate racemase/muconate  ...
3cbg:A --rgg--lmvidnv--lw---hgkvtevdpqeaqtqvlqqfnrdlaqdervrisviplgdgmtla    Functional and structural characterization of a  ...
3rcn:A --dnv--lrfievm--am---hklnvlhlhltddqgwrmqinrypkltetgawrresslgswrag    Crystal structure of beta-n-acetylhexosaminidase from  ...
1uad:C --hnc--lltaewm--sa---skivcrvgqakndkgdiivttksggrgtstvsfkllkp------    Crystal structure of the rala-gppnhp-sec5 ral-binding  ...
2r0p:A --mdr--elppglh--dd---gprgeriraavaeklersgarrefdapgihfghtyrssivcgew    K252c-soaked rebc
3ept:A --mdr--elppglh--dd---gprgeriraavaeklersgarrefdapgihfghtyrssivcgeg    Structure of the rebeccamycin biosynthetic enzyme rebc with  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P10175 -----------------------------------------------------------------    Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos  ...
1occ:M*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
3sjp:A tgqhdlvippngyfrfdswvnqfytlapmg-----------------------------------    Structural characterization of a gii.4 2004 norovirus varian
2vge:A ekcdpyregyadcatyladveqsmglmnsgavyalwdysaefgdelsfregesvtvlrrdgpeet    Crystal structure of thE C-terminal region of human iaspp
3skb:I tgqhdlvippngyfrfdswvnqfytlapmg-----------------------------------    Structural characterization of a gii.4 2004 norovirus varian
1zjj:A vgldpdltyeklkyatlairngatfigtnpdatlpgeegiypgagsiiaalkvatnvepiiigkp    Crystal structure of hypothetical protein ph1952 from  ...
3sej:I tgqhdlvippngyfrfdswvnqfytlapm------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3sln:H tgqhdlvippngyfrfdswvnqfytlapmg-----------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3sld:H tgqhdlvippngyfrfdswvnqfytlapmg-----------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3l81:A -----------------------------------------------------------------    Crystal structure of adaptor protein complex 4 (ap-4) mu4  ...
4n2r:A lmiveaqgtngryfrsftansldgewkvqagsesapfagkansgaswtndvshgdlirsnpdqtm    Crystal structure of the alpha-l-arabinofuranosidase  ...
4n1i:A lmiveaqgtngryfrsftansldgewkvqagsesapfagkansgaswtndvshgdlirsnpdqtm    Crystal structure of the alpha-l-arabinofuranosidase  ...
2c3a:B -----------------------------------------------------------------    Structure of unliganded hsv gd reveals a mechanism for  ...
1hk6:A -----------------------------------------------------------------    Ral binding domain from sec5
2bl0:A -----------------------------------------------------------------    Physarum polycephalum myosin ii regulatory domain
3cyj:A geyewtlpqlhdlagcvdilqadvtrcggitgllrvdgicrghqipfsahcapavsahaccaves    Crystal structure of a mandelate racemase/muconate  ...
3cbg:A lkk--------------------------------------------------------------    Functional and structural characterization of a  ...
3rcn:A vfdgrphggfytqddlreivafaadrhitvipeidvpghsqaaiaaypelgagpspvevwtrwgi    Crystal structure of beta-n-acetylhexosaminidase from  ...
1uad:C -----------------------------------------------------------------    Crystal structure of the rala-gppnhp-sec5 ral-binding  ...
2r0p:A rpsarpgaraphawltpttstldlfgrgfvllsfgttdgveavtrafadrhvpletvtchapeih    K252c-soaked rebc
3ept:A gwrpsarpgaraphawltpttstldlfgrgfvllsfgttdgveavtrafadrhvpletvtchape    Structure of the rebeccamycin biosynthetic enzyme rebc with  ...

                5         5         5         5         5         5     
                3         4         5         6         7         8     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P10175 -----------------------------------------------------------------    Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos  ...
1occ:M*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
3sjp:A -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus varian
2vge:A dwwwaalhgqegyvprnyfglfprvkp--------------------------------------    Crystal structure of thE C-terminal region of human iaspp
3skb:I -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus varian
1zjj:A nepmyevvremfpgeelwmvgdrldtdiafakkfgmkaimvltgvssledikkseykpdlvlpsv    Crystal structure of hypothetical protein ph1952 from  ...
3sej:I -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3sln:H -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3sld:H -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3l81:A -----------------------------------------------------------------    Crystal structure of adaptor protein complex 4 (ap-4) mu4  ...
4n2r:A tidpcrlqllyqgrdknkvpssydlapyrpglltlyglgle------------------------    Crystal structure of the alpha-l-arabinofuranosidase  ...
4n1i:A tidpcrlqllyqgrdknkvpssydlapyrpglltlyglgleqklise------------------    Crystal structure of the alpha-l-arabinofuranosidase  ...
2c3a:B -----------------------------------------------------------------    Structure of unliganded hsv gd reveals a mechanism for  ...
1hk6:A -----------------------------------------------------------------    Ral binding domain from sec5
2bl0:A -----------------------------------------------------------------    Physarum polycephalum myosin ii regulatory domain
3cyj:A llhleyfhdharverllfdgtldpeggslrpdpdrpglglelkrseagkyaa-------------    Crystal structure of a mandelate racemase/muconate  ...
3cbg:A -----------------------------------------------------------------    Functional and structural characterization of a  ...
3rcn:A netvlevsetslefyrnvldevveifpspwislggdevpltqwqasaqaqakaaelglddvsglh    Crystal structure of beta-n-acetylhexosaminidase from  ...
1uad:C -----------------------------------------------------------------    Crystal structure of the rala-gppnhp-sec5 ral-binding  ...
2r0p:A alyerahvlvrpdghvawrgdhlpaelgglvdkvrgaa---------------------------    K252c-soaked rebc
3ept:A ihalyerahvlvrpdghvawrgdhlpaelgglvdkvrgaa-------------------------    Structure of the rebeccamycin biosynthetic enzyme rebc with  ...

           5         6         6         6         6         6         6
           9         0         1         2         3         4         5
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P10175 -----------------------------------------------------------------    Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos  ...
1occ:M*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
3sjp:A -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus varian
2vge:A -----------------------------------------------------------------    Crystal structure of thE C-terminal region of human iaspp
3skb:I -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus varian
1zjj:A yelidylk---------------------------------------------------------    Crystal structure of hypothetical protein ph1952 from  ...
3sej:I -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3sln:H -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3sld:H -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3l81:A -----------------------------------------------------------------    Crystal structure of adaptor protein complex 4 (ap-4) mu4  ...
4n2r:A -----------------------------------------------------------------    Crystal structure of the alpha-l-arabinofuranosidase  ...
4n1i:A -----------------------------------------------------------------    Crystal structure of the alpha-l-arabinofuranosidase  ...
2c3a:B -----------------------------------------------------------------    Structure of unliganded hsv gd reveals a mechanism for  ...
1hk6:A -----------------------------------------------------------------    Ral binding domain from sec5
2bl0:A -----------------------------------------------------------------    Physarum polycephalum myosin ii regulatory domain
3cyj:A -----------------------------------------------------------------    Crystal structure of a mandelate racemase/muconate  ...
3cbg:A -----------------------------------------------------------------    Functional and structural characterization of a  ...
3rcn:A swfvgqlalhlkhhgratsvwdelpdgalvaswrgyeggidalrkgydvvmcpehklyldhrqad    Crystal structure of beta-n-acetylhexosaminidase from  ...
1uad:C -----------------------------------------------------------------    Crystal structure of the rala-gppnhp-sec5 ral-binding  ...
2r0p:A -----------------------------------------------------------------    K252c-soaked rebc
3ept:A -----------------------------------------------------------------    Structure of the rebeccamycin biosynthetic enzyme rebc with  ...

                6         6         6         6         7         7     
                6         7         8         9         0         1     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P10175 -----------------------------------------------------------------    Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos  ...
1occ:M*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
3sjp:A -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus varian
2vge:A -----------------------------------------------------------------    Crystal structure of thE C-terminal region of human iaspp
3skb:I -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus varian
1zjj:A -----------------------------------------------------------------    Crystal structure of hypothetical protein ph1952 from  ...
3sej:I -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3sln:H -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3sld:H -----------------------------------------------------------------    Structural characterization of a gii.4 2004 norovirus  ...
3l81:A -----------------------------------------------------------------    Crystal structure of adaptor protein complex 4 (ap-4) mu4  ...
4n2r:A -----------------------------------------------------------------    Crystal structure of the alpha-l-arabinofuranosidase  ...
4n1i:A -----------------------------------------------------------------    Crystal structure of the alpha-l-arabinofuranosidase  ...
2c3a:B -----------------------------------------------------------------    Structure of unliganded hsv gd reveals a mechanism for  ...
1hk6:A -----------------------------------------------------------------    Ral binding domain from sec5
2bl0:A -----------------------------------------------------------------    Physarum polycephalum myosin ii regulatory domain
3cyj:A -----------------------------------------------------------------    Crystal structure of a mandelate racemase/muconate  ...
3cbg:A -----------------------------------------------------------------    Functional and structural characterization of a  ...
3rcn:A gddepvpvgfvttlqavyefeplpgtdfpgrllgaqaniwsehldsprrvqfaafprlsaisevf    Crystal structure of beta-n-acetylhexosaminidase from  ...
1uad:C -----------------------------------------------------------------    Crystal structure of the rala-gppnhp-sec5 ral-binding  ...
2r0p:A -----------------------------------------------------------------    K252c-soaked rebc
3ept:A -----------------------------------------------------------------    Structure of the rebeccamycin biosynthetic enzyme rebc with  ...

           7         7         7         7         7         7   
           2         3         4         5         6         7   
       6789012345678901234567890123456789012345678901234567890123           Protein name
       ----+---------+---------+---------+---------+---------+---           ------------
P10175 ----------------------------------------------------------           Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos  ...
1occ:M*----------------------------------------------------------       ×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
3sjp:A ----------------------------------------------------------           Structural characterization of a gii.4 2004 norovirus varian
2vge:A ----------------------------------------------------------           Crystal structure of thE C-terminal region of human iaspp
3skb:I ----------------------------------------------------------           Structural characterization of a gii.4 2004 norovirus varian
1zjj:A ----------------------------------------------------------           Crystal structure of hypothetical protein ph1952 from  ...
3sej:I ----------------------------------------------------------           Structural characterization of a gii.4 2004 norovirus  ...
3sln:H ----------------------------------------------------------           Structural characterization of a gii.4 2004 norovirus  ...
3sld:H ----------------------------------------------------------           Structural characterization of a gii.4 2004 norovirus  ...
3l81:A ----------------------------------------------------------           Crystal structure of adaptor protein complex 4 (ap-4) mu4  ...
4n2r:A ----------------------------------------------------------           Crystal structure of the alpha-l-arabinofuranosidase  ...
4n1i:A ----------------------------------------------------------           Crystal structure of the alpha-l-arabinofuranosidase  ...
2c3a:B ----------------------------------------------------------           Structure of unliganded hsv gd reveals a mechanism for  ...
1hk6:A ----------------------------------------------------------           Ral binding domain from sec5
2bl0:A ----------------------------------------------------------           Physarum polycephalum myosin ii regulatory domain
3cyj:A ----------------------------------------------------------           Crystal structure of a mandelate racemase/muconate  ...
3cbg:A ----------------------------------------------------------           Functional and structural characterization of a  ...
3rcn:A wsnpagrdydefltrltgahlarleamgveyrplsgpapwqqrpgvegwkrdydaeql           Crystal structure of beta-n-acetylhexosaminidase from  ...
1uad:C ----------------------------------------------------------           Crystal structure of the rala-gppnhp-sec5 ral-binding  ...
2r0p:A ----------------------------------------------------------           K252c-soaked rebc
3ept:A ----------------------------------------------------------           Structure of the rebeccamycin biosynthetic enzyme rebc with  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P10175. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 70 - - P10175 Cytochrome c oxidase subunit 8B, mitochondrial OS=Bos taurus GN=COX8B PE=1 SV=3
2. 281 100.0% 43 43 438.6 1.8e-17 1occ:M * Structure of bovine heart cytochromE C oxidase at the fully oxidized state
3. " " " " " "  = 1oco:M *
Bovine heart cytochromE C oxidase in carbon monoxide-bound state
4. " " " " " "  = 1ocr:M *
Bovine heart cytochromE C oxidase in the fully reduced state
5. " " " " " "  = 1ocz:M *
Bovine heart cytochromE C oxidase in azide-bound state
6. " " " " " "  = 1v54:M *
Bovine heart cytochromE C oxidase at the fully oxidized stat
7. " " " " " "  = 1v55:M *
Bovine heart cytochromE C oxidase at the fully reduced state
8. " " " " " "  = 2dyr:M *
Bovine heart cytochromE C oxidase at the fully oxidized stat
9. " " " " " "  = 2dys:M *
Bovine heart cytochromE C oxidase modified by dccd
10. " " " " " "  = 2eij:M *
Bovine heart cytochromE C oxidase in the fully reduced state
11. " " " " " "  = 2eik:M *
Cadmium ion binding structure of bovine heart cytochromE C o the fully reduced state
12. " " " " " "  = 2eil:M *
Cadmium ion binding structure of bovine heart cytochromE C o the fully oxidized state
13. " " " " " "  = 2eim:M *
Zinc ion binding structure of bovine heart cytochromE C oxid fully reduced state
14. " " " " " "  = 2ein:M *
Zinc ion binding structure of bovine heart cytochromE C oxidase in the fully oxidized state
15. " " " " " "  = 2occ:M *
Bovine heart cytochromE C oxidase at the fully oxidized stat
16. " " " " " "  = 2y69:M *
Bovine heart cytochromE C oxidase re-refined with molecular oxygen
17. " " " " " "  = 2ybb:X *
Fitted model for bovine mitochondrial supercomplex i1iii2iv single particle cryo-em (emd-1876)
18. " " " " " "  = 2zxw:M *
Bovine heart cytochromE C oxidase at the fully oxidized stat ray exposure dataset)
19. " " " " " "  = 3abk:M *
Bovine heart cytochromE C oxidase at the no-bound fully redu (50k)
20. " " " " " "  = 3abl:M *
Bovine heart cytochromE C oxidase at the fully oxidized state (15-s x-ray exposure dataset)
21. " " " " " "  = 3abm:M *
Bovine heart cytochromE C oxidase at the fully oxidized state (200-s x-ray exposure dataset)
22. " " " " " "  = 3ag1:M *
Bovine heart cytochromE C oxidase in the carbon monoxide-bou reduced state at 280 k
23. " " " " " "  = 3ag2:M *
Bovine heart cytochromE C oxidase in the carbon monoxide-bou reduced state at 100 k
24. " " " " " "  = 3ag3:M *
Bovine heart cytochromE C oxidase in the nitric oxide-bound reduced state at 100 k
25. " " " " " "  = 3ag4:M *
Bovine heart cytochromE C oxidase in the cyanide ion-bound f reduced state at 100 k
26. " " " " " "  = 3asn:M *
Bovine heart cytochromE C oxidase in the fully oxidized stat at 1.7470 angstrom wavelength
27. " " " " " "  = 3aso:M *
Bovine heart cytochromE C oxidase in the fully oxidized stat at 0.9 angstrom wavelength
28. 81 32.9% 76 294 125.4 5.1 3sjp:A Structural characterization of a gii.4 2004 norovirus varian
29. 78 31.1% 61 208 123.4 6.6 2vge:A Crystal structure of thE C-terminal region of human iaspp
30. 77 34.4% 61 291 119.5 11 3skb:I Structural characterization of a gii.4 2004 norovirus varian
31. 76 32.9% 70 261 118.8 12 1zjj:A Crystal structure of hypothetical protein ph1952 from pyroco horikoshii ot3
32. 75 33.9% 62 284 116.7 16 3sej:I Structural characterization of a gii.4 2004 norovirus varian bound to secretor lewis hbga (leb)
33. 75 33.9% 62 292 116.5 16 3sln:H Structural characterization of a gii.4 2004 norovirus varian bound to h pentasaccharide
34. 75 33.9% 62 293 116.4 16 3sld:H Structural characterization of a gii.4 2004 norovirus varian bound to a trisaccharide
35. 74 41.9% 31 250 116.1 17 3l81:A Crystal structure of adaptor protein complex 4 (ap-4) mu4 su terminal domain, in complex with a sorting peptide from the precursor protein (app)
36. 74 35.0% 40 306 114.6 20 4n2r:A Crystal structure of the alpha-l-arabinofuranosidase umabf62 ustilago maydis in complex with l-arabinofuranose
37. 74 35.0% 40 312 114.5 21 4n1i:A Crystal structure of the alpha-l-arabinofuranosidase umabf62 ustilago maidys
38. 73 28.3% 53 274 113.9 22 2c3a:B Structure of unliganded hsv gd reveals a mechanism for receptor-mediated activation of virus entry
39. 67 28.6% 56 95 112.6 27 1hk6:A Ral binding domain from sec5
40. 65 27.6% 58 63 112.5 27 2bl0:A Physarum polycephalum myosin ii regulatory domain
41. 73 35.4% 48 359 112.0 29 3cyj:A Crystal structure of a mandelate racemase/muconate lactonizi like protein from rubrobacter xylanophilus
42. 70 27.1% 59 218 111.1 32 3cbg:A Functional and structural characterization of a cationdependent o-methyltransferase from the cyanobacterium synechocystis sp. Strain pcc 6803
43. 74 37.5% 32 525 110.7 34 3rcn:A Crystal structure of beta-n-acetylhexosaminidase from arthro aurescens
44. 64 29.1% 55 92 108.3 46 1uad:C Crystal structure of the rala-gppnhp-sec5 ral-binding domain complex
45. 72 37.5% 48 512 107.9 48 2r0p:A K252c-soaked rebc
46. 72 37.5% 48 516 107.9 49 3ept:A Structure of the rebeccamycin biosynthetic enzyme rebc with reduced flavin

Number of sequences: 46

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 72 37.5% 48 514 107.9 48 4eiq:A Chromopyrrolic acid-soaked rebc-10x with bound 7-carboxy-k25
2. 72 37.5% 48 522 107.8 49 2r0g:A Chromopyrrolic acid-soaked rebc with bound 7-carboxy-k252c
3. 72 37.5% 48 521 107.8 49 4eip:A Native and k252c bound rebc-10x
4. 66 36.6% 41 153 107.7 50 3fk9:A Crystal structure of mmutator mutt protein from bacillus halodurans

Number of sequences: 4

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer