spacer
spacer

SAS results for UniProt accession no. P13183

Sequence annotated by structure

Key:
Sec. struc: Predicted
  Helix Strand
Residue contacts:   to ligand
Active sites:   (from PDB SITE records)

Predicted secondary structure (green) comes from the DSC program. The lighter the green the less certain the prediction.

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P13183 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P13183 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 10 unique sequences (including 2 consensus sequences) giving 36 sequence matches in all.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P13183 -----------------------------------------------------------------    Cytochrome c oxidase subunit 7B, mitochondrial OS=Bos  ...
1occ:K*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
2yna:A*------sglvkmsapsgavencivqvtcgsmtlnglwldntvwcprhimcpadqltdpnydalli×2  Crystal structure of the main protease of coronavirus hku4
1wrg:A -----------------------------------------------------------------    Light-harvesting complex 1 beta subunit from wild-type  ...
1mx2:A -----------------------------------------------------------------    Structure of f71n mutant of p18ink4c
2v05:A -----------------------------------------------------------------    Crystal structure of choline binding protein f from  ...
2ftp:A mnlpkkvrlvevgprdglqnekqpievadkirlvddlsaagldyievgsfvspkwvpqmagsaev    Crystal structure of hydroxymethylglutaryl-coa lyase from  ...
4bsj:A -----------------------------------------------------------------    Crystal structure of vegfr-3 extracellular domains d4-5
3iy3:B -----------------------------------------------------------------    Variable domains of the computer generated model (wam) of  ...
3grw:H -----------------------------------------------------------------    Fgfr3 in complex with a fab
4oaw:B -----------------------------------------------------------------    Fab structure of anti-HIV gp120 v2 mab 2158

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P13183 -----------------------------------------------------------------    Cytochrome c oxidase subunit 7B, mitochondrial OS=Bos  ...
1occ:K*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
2yna:A*sktnhsfivqkhigaqanlrvvahsmvgvllkltvdvanpstpaytfstvkpgasfsvlacyngk×2  Crystal structure of the main protease of coronavirus hku4
1wrg:A -----------------------------------------------------------------    Light-harvesting complex 1 beta subunit from wild-type  ...
1mx2:A -----------------------------------------------------------------    Structure of f71n mutant of p18ink4c
2v05:A ----------------------nttggrfvdkdnrkyyvkddhkaiywhkidgktyyfgdigemv    Crystal structure of choline binding protein f from  ...
2ftp:A fagirqrpgvtyaalapnlkgfeaalesgvkevavfaaaseafsqrnincsikdslerfvpvlea    Crystal structure of hydroxymethylglutaryl-coa lyase from  ...
4bsj:A -------------------------------------dhnpfisvewlkgpileatagdelvklp    Crystal structure of vegfr-3 extracellular domains d4-5
3iy3:B -----------------------------------------------------------------    Variable domains of the computer generated model (wam) of  ...
3grw:H -----------------------------------------------------------------    Fgfr3 in complex with a fab
4oaw:B -----------------------------------------------------------------    Fab structure of anti-HIV gp120 v2 mab 2158

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P13183 --------------------------------------------mfplaknalsrlrvqsiqqa-    Cytochrome c oxidase subunit 7B, mitochondrial OS=Bos  ...
1occ:K*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
2yna:A*ptgvftvnlrhnstikgsflcgscgsvgytenggvinfvymhqmelsngthtgssfdgvmygaf-×2  Crystal structure of the main protease of coronavirus hku4
1wrg:A ----------------------------------------------------------aevkqe-    Light-harvesting complex 1 beta subunit from wild-type  ...
1mx2:A --------------------wgnelasaaargdleqltsllqnnvnvnaqngfgrtalqvmklgn    Structure of f71n mutant of p18ink4c
2v05:A vgwqyleipgtgyrdnlfdnqpvneiglqekwyyfgqdgalleqtdkqvleaktsentgkvyge-    Crystal structure of choline binding protein f from  ...
2ftp:A arqhqvrvrgyiscvlgcpydgdvdprqvawvarelqqmgcyevslgdtigvgtagatrrliea-    Crystal structure of hydroxymethylglutaryl-coa lyase from  ...
4bsj:A vklaaypppefqwykdgkalsgrhsphalvlkevteastgtytlalwnsaaglrrnislelvvn-    Crystal structure of vegfr-3 extracellular domains d4-5
3iy3:B ---------------------------------------------------------------e-    Variable domains of the computer generated model (wam) of  ...
3grw:H ---------------------------------------------------------------e-    Fgfr3 in complex with a fab
4oaw:B ---------------------------------------------------------------q-    Fab structure of anti-HIV gp120 v2 mab 2158

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P13183 --varqihqkr-a--pdfhdkygnavlasgat---fc--va--vwvymatqigiew--npspvgr    Cytochrome c oxidase subunit 7B, mitochondrial OS=Bos  ...
1occ:K*------------A--PDFHDKYGNAVLASGAT---FC--VA--VWVYMATQIGIEW--NPSPVGR×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
2yna:A*--edkqthqlq------ltdky--------ct---in--vv--awlyaavlngckwfvkptrvgi×2  Crystal structure of the main protease of coronavirus hku4
1wrg:A --slsgitege-a--kefhkiftssilv---f---fg--va--afahllvwiwrpw--vpgpngy    Light-harvesting complex 1 beta subunit from wild-type  ...
1mx2:A peiarrlllrg-an-pdlkdrtgnavihdaar---ag--fl--dtlqtllefqadv--niedneg    Structure of f71n mutant of p18ink4c
2v05:A --qyplsaekr-t--yyfdnnya---vktgwi---ye--dg--nwyyl-nklgnfy--nplpige    Crystal structure of choline binding protein f from  ...
2ftp:A --vasevprerla--ghfhdtygqalaniyas---ll--eg--iavfdssvaglgg--cpyakga    Crystal structure of hydroxymethylglutaryl-coa lyase from  ...
4bsj:A --vppqiheke-asspsiysrhsrqalt--------c--ta--ygvplplsiqwhw--rpwtpck    Crystal structure of vegfr-3 extracellular domains d4-5
3iy3:B --iqlqqtgpe-l--vqpgasvkisckasgys---ftdyim--vwvkqshgkglew------ign    Variable domains of the computer generated model (wam) of  ...
3grw:H --vqlvesggg-l--vqpggslrlscaasgft---ft--stgiswvrqapgkglew------vgr    Fgfr3 in complex with a fab
4oaw:B --vqlvqsgae-v--kkpgssvkvsceasgvtsssyt--is---wvrlapgqglew------mgr    Fab structure of anti-HIV gp120 v2 mab 2158

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
P13183 vtp--kewreq------------------------------------------------------    Cytochrome c oxidase subunit 7B, mitochondrial OS=Bos  ...
1occ:K*VTP--KEWR--------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
2yna:A*vty--newalsnqftefvgtqsidmlahrtgvsveqmlaaiqslhagfqgktilgqstledeftp×2  Crystal structure of the main protease of coronavirus hku4
1wrg:A s----------------------------------------------------------------    Light-harvesting complex 1 beta subunit from wild-type  ...
1mx2:A nlp--lhlaakeghlrvveflvkhtasnvghrnhkgdtacdlarlygrnevvslmqang------    Structure of f71n mutant of p18ink4c
2v05:A va---kgwtqdfhpapwyyldasgkmltdwqkvngkwyyfgssgsmatgwkyvrgkwyyldnkng    Crystal structure of choline binding protein f from  ...
2ftp:A tgn--vasedvlyllngleihtgvdmhalvdagqricavlgksngsraakallaka---------    Crystal structure of hydroxymethylglutaryl-coa lyase from  ...
4bsj:A mfpqcrdwravttqdavnpiesldtwtefvegknktvsklviqnanvsamykcvvsnkvgqderl    Crystal structure of vegfr-3 extracellular domains d4-5
3iy3:B inp--yhgrtaynlkfkgkatltvdkssstafmqlnslisedsavfycvrkgyvegggldywgqg    Variable domains of the computer generated model (wam) of  ...
3grw:H iyp--tngstnyadsvkgrftisadtskntaylqmnslraedtavyycartygiydlyvdyteyv    Fgfr3 in complex with a fab
4oaw:B itp--ifditnyaqkfqgrvtltadkstgttymelsslrsddtavyycardksdvvvvtsirpay    Fab structure of anti-HIV gp120 v2 mab 2158

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
P13183 -----------------------------------------------------------------    Cytochrome c oxidase subunit 7B, mitochondrial OS=Bos  ...
1occ:K*-----------------------------------------------------------------×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
2yna:A*ddvnmqvmgvvmq----------------------------------------------------×2  Crystal structure of the main protease of coronavirus hku4
1wrg:A -----------------------------------------------------------------    Light-harvesting complex 1 beta subunit from wild-type  ...
1mx2:A -----------------------------------------------------------------    Structure of f71n mutant of p18ink4c
2v05:A dmktgwqylgnkwyylrssgamvtgwyqdgltwyylnagngdmktgwfqvngkwyyayssgalav    Crystal structure of choline binding protein f from  ...
2ftp:A -----------------------------------------------------------------    Crystal structure of hydroxymethylglutaryl-coa lyase from  ...
4bsj:A iyfyvtth---------------------------------------------------------    Crystal structure of vegfr-3 extracellular domains d4-5
3iy3:B tsvivs-----------------------------------------------------------    Variable domains of the computer generated model (wam) of  ...
3grw:H mdywgqgtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvh    Fgfr3 in complex with a fab
4oaw:B yygmdvwgqgttvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalts    Fab structure of anti-HIV gp120 v2 mab 2158

                4         4         4         4         4        
                0         1         2         3         4        
       1234567890123456789012345678901234567890123456789012345678           Protein name
       ---------+---------+---------+---------+---------+--------           ------------
P13183 ----------------------------------------------------------           Cytochrome c oxidase subunit 7B, mitochondrial OS=Bos  ...
1occ:K*----------------------------------------------------------       ×26 Structure of bovine heart cytochromE C oxidase at the fully  ...
2yna:A*----------------------------------------------------------       ×2  Crystal structure of the main protease of coronavirus hku4
1wrg:A ----------------------------------------------------------           Light-harvesting complex 1 beta subunit from wild-type  ...
1mx2:A ----------------------------------------------------------           Structure of f71n mutant of p18ink4c
2v05:A nttvdgysvnyngewvq-----------------------------------------           Crystal structure of choline binding protein f from  ...
2ftp:A ----------------------------------------------------------           Crystal structure of hydroxymethylglutaryl-coa lyase from  ...
4bsj:A ----------------------------------------------------------           Crystal structure of vegfr-3 extracellular domains d4-5
3iy3:B ----------------------------------------------------------           Variable domains of the computer generated model (wam) of  ...
3grw:H tfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc------           Fgfr3 in complex with a fab
4oaw:B gvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkt           Fab structure of anti-HIV gp120 v2 mab 2158

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P13183. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 80 - - P13183 Cytochrome c oxidase subunit 7B, mitochondrial OS=Bos taurus GN=COX7B PE=1 SV=3
2. 354 100.0% 49 49 516.2 8.9e-22 1occ:K * Structure of bovine heart cytochromE C oxidase at the fully oxidized state
3. " " " " " "  = 1oco:K *
Bovine heart cytochromE C oxidase in carbon monoxide-bound state
4. " " " " " "  = 1ocr:K *
Bovine heart cytochromE C oxidase in the fully reduced state
5. " " " " " "  = 1ocz:K *
Bovine heart cytochromE C oxidase in azide-bound state
6. " " " " " "  = 1v54:K *
Bovine heart cytochromE C oxidase at the fully oxidized stat
7. " " " " " "  = 1v55:K *
Bovine heart cytochromE C oxidase at the fully reduced state
8. " " " " " "  = 2dyr:K *
Bovine heart cytochromE C oxidase at the fully oxidized stat
9. " " " " " "  = 2dys:K *
Bovine heart cytochromE C oxidase modified by dccd
10. " " " " " "  = 2eij:K *
Bovine heart cytochromE C oxidase in the fully reduced state
11. " " " " " "  = 2eik:K *
Cadmium ion binding structure of bovine heart cytochromE C o the fully reduced state
12. " " " " " "  = 2eil:K *
Cadmium ion binding structure of bovine heart cytochromE C o the fully oxidized state
13. " " " " " "  = 2eim:K *
Zinc ion binding structure of bovine heart cytochromE C oxid fully reduced state
14. " " " " " "  = 2ein:K *
Zinc ion binding structure of bovine heart cytochromE C oxidase in the fully oxidized state
15. " " " " " "  = 2occ:K *
Bovine heart cytochromE C oxidase at the fully oxidized stat
16. " " " " " "  = 2y69:K *
Bovine heart cytochromE C oxidase re-refined with molecular oxygen
17. " " " " " "  = 2ybb:V *
Fitted model for bovine mitochondrial supercomplex i1iii2iv single particle cryo-em (emd-1876)
18. " " " " " "  = 2zxw:K *
Bovine heart cytochromE C oxidase at the fully oxidized stat ray exposure dataset)
19. " " " " " "  = 3abk:K *
Bovine heart cytochromE C oxidase at the no-bound fully redu (50k)
20. " " " " " "  = 3abl:K *
Bovine heart cytochromE C oxidase at the fully oxidized state (15-s x-ray exposure dataset)
21. " " " " " "  = 3abm:K *
Bovine heart cytochromE C oxidase at the fully oxidized state (200-s x-ray exposure dataset)
22. " " " " " "  = 3ag1:K *
Bovine heart cytochromE C oxidase in the carbon monoxide-bou reduced state at 280 k
23. " " " " " "  = 3ag2:K *
Bovine heart cytochromE C oxidase in the carbon monoxide-bou reduced state at 100 k
24. " " " " " "  = 3ag3:K *
Bovine heart cytochromE C oxidase in the nitric oxide-bound reduced state at 100 k
25. " " " " " "  = 3ag4:K *
Bovine heart cytochromE C oxidase in the cyanide ion-bound f reduced state at 100 k
26. " " " " " "  = 3asn:K *
Bovine heart cytochromE C oxidase in the fully oxidized stat at 1.7470 angstrom wavelength
27. " " " " " "  = 3aso:K *
Bovine heart cytochromE C oxidase in the fully oxidized stat at 0.9 angstrom wavelength
28. 87 35.1% 57 306 127.3 4.1 2yna:A * Crystal structure of the main protease of coronavirus hku4
29. " " " " " "  = 2ynb:A *
Crystal structure of the main protease of coronavirus hku4 in complex with a michael acceptor sg85
30. 75 25.9% 54 55 121.9 8.2 1wrg:A Light-harvesting complex 1 beta subunit from wild-type rhodospirillum rubrum
31. 76 32.6% 46 156 116.3 17 1mx2:A Structure of f71n mutant of p18ink4c
32. 79 28.3% 53 298 116.2 17 2v05:A Crystal structure of choline binding protein f from streptococcus pneumoniae. Crystal form ii.
33. 79 30.2% 53 300 116.1 17 2ftp:A Crystal structure of hydroxymethylglutaryl-coa lyase from ps aeruginosa
34. 77 27.4% 62 213 115.6 18 4bsj:A Crystal structure of vegfr-3 extracellular domains d4-5
35. 71 34.2% 38 119 111.1 33 3iy3:B Variable domains of the computer generated model (wam) of fab 8 fitted into the cryoem reconstruction of the virus- fab 8 complex
36. 72 44.1% 34 230 108.0 48 3grw:H Fgfr3 in complex with a fab
37. 72 40.0% 35 236 107.9 49 4oaw:B Fab structure of anti-HIV gp120 v2 mab 2158

Number of sequences: 37

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer