spacer
spacer

SAS results for UniProt accession no. P80176

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand
Active sites:   (from PDB SITE records)

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P80176 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P80176 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 27 unique sequences (including 4 consensus sequences) giving 37 sequence matches in all. The 7 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P80176 -----------------------------------------------------------------   High-potential iron-sulfur protein OS=Thermochromatium  ...
1eyt:A*-----------------------------------------------------------------×6 Crystal structure of high-potential iron-sulfur protein  ...
1cku:A*-----------------------------------------------------------------×4 Ab initio solution and refinement of two high potential  ...
1hip:A -----------------------------------------------------------------   Two-angstrom crystal structure of oxidized chromatium high  ...
1noe:A -----------------------------------------------------------------   Nmr study of reduced high potential iron sulfur protein
1js2:A -----------------------------------------------------------------   Crystal structure of c77s hipip: a serine ligated [4fe-4s] c
1b0y:A -----------------------------------------------------------------   Mutant h42q of hipip from chromatium vinosum at 0.93a
3hip:A -----------------------------------------------------------------   High-potential iron-sulfur protein from chromatium  ...
1hpi:A -----------------------------------------------------------------   Molecular structure of the oxidized high-potential iron-  ...
1hlq:A -----------------------------------------------------------------   Crystal structure of rhodoferax fermentans high potential  ...
3h31:A -----------------------------------------------------------------   Structure of rhodothermus marinus hipip at 1.0 a resolution
2hip:A -----------------------------------------------------------------   The molecular structure of the high potential iron-sulfur  ...
1pih:A*-----------------------------------------------------------------×2 The three dimensional structure of the paramagnetic protein  ...
3m9p:A*-----------------------------------------------------------------×2 Human msl3 chromodomain bound to DNA and h4k20me1 peptide
3ob9:A -----------------------------------------------------------------   Structure of the human msl3 chromo-barrel domain at 2.5  ...
  " :D -----------------------------------------------------------------   Structure of the human msl3 chromo-barrel domain at 2.5  ...
1cp9:B snvwlvgktkasgakaillngpqfgwfnpaytygiglhgagfnivgntpfaypailfghnghvsw   Crystal structure of penicillin g acylase from the bro1  ...
2dar:A -----------------------------------------------------------------   Solution structure of first lim domain of enigma-like pdz  ...
1koy:A -----------------------------------------------------------------   Nmr structure of dff-c domain
4f65:A -----------------------------------------------------------------   Crystal structure of human fibroblast growth factor  ...
2psq:A -----------------------------------------------------------------   Crystal structure of unphosphorylated unactivated wild type  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P80176 -----------------------------------------------------------------   High-potential iron-sulfur protein OS=Thermochromatium  ...
1eyt:A*-----------------------------------------------------------------×6 Crystal structure of high-potential iron-sulfur protein  ...
1cku:A*-----------------------------------------------------------------×4 Ab initio solution and refinement of two high potential  ...
1hip:A -----------------------------------------------------------------   Two-angstrom crystal structure of oxidized chromatium high  ...
1noe:A -----------------------------------------------------------------   Nmr study of reduced high potential iron sulfur protein
1js2:A -----------------------------------------------------------------   Crystal structure of c77s hipip: a serine ligated [4fe-4s] c
1b0y:A -----------------------------------------------------------------   Mutant h42q of hipip from chromatium vinosum at 0.93a
3hip:A -----------------------------------------------------------------   High-potential iron-sulfur protein from chromatium  ...
1hpi:A -----------------------------------------------------------------   Molecular structure of the oxidized high-potential iron-  ...
1hlq:A -----------------------------------------------------------------   Crystal structure of rhodoferax fermentans high potential  ...
3h31:A -----------------------------------------------------------------   Structure of rhodothermus marinus hipip at 1.0 a resolution
2hip:A -----------------------------------------------------------------   The molecular structure of the high potential iron-sulfur  ...
1pih:A*-----------------------------------------------------------------×2 The three dimensional structure of the paramagnetic protein  ...
3m9p:A*-----------------------------------------------------------------×2 Human msl3 chromodomain bound to DNA and h4k20me1 peptide
3ob9:A -----------------------------------------------------------------   Structure of the human msl3 chromo-barrel domain at 2.5  ...
  " :D -----------------------------------------------------------------   Structure of the human msl3 chromo-barrel domain at 2.5  ...
1cp9:B gstagfgdgvdifaeqvspedpnsylhqgqwkkmlsrqetlnvkgeqpitfeiyrtvhgnvvkrd   Crystal structure of penicillin g acylase from the bro1  ...
2dar:A -----------------------------------------------------------------   Solution structure of first lim domain of enigma-like pdz  ...
1koy:A -----------------------------------------------------------------   Nmr structure of dff-c domain
4f65:A --------------elpedprwelprdrlvlgkplgegafgqvvlaeaigldkpnrvtkvavkml   Crystal structure of human fibroblast growth factor  ...
2psq:A -------------lpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkml   Crystal structure of unphosphorylated unactivated wild type  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P80176 ----------------------------aapanavtaddptaialkynqd-atkservaaarpgl   High-potential iron-sulfur protein OS=Thermochromatium  ...
1eyt:A*----------------------------AAPANAVTADDPTAIALKYNQD-ATKSERVAAARPGL×6 Crystal structure of high-potential iron-sulfur protein  ...
1cku:A*----------------------------SAPANAVAADDATAIALKYNQD-ATKSERVAAARPGL×4 Ab initio solution and refinement of two high potential  ...
1hip:A ----------------------------SAPANAVAADNATAIALKYNQD-ATKSERVAAARPGL   Two-angstrom crystal structure of oxidized chromatium high  ...
1noe:A ---------------------------ASAPANAVAADDATAIALKYNQD-ATKSERVAAARPGL   Nmr study of reduced high potential iron sulfur protein
1js2:A ------------------------MEFMSAPANAVAADDATAIALKYNQD-ATKSERVAAARPGL   Crystal structure of c77s hipip: a serine ligated [4fe-4s] c
1b0y:A ----------------------------SAPANAVAADNATAIALKYNQD-ATKSERVAAARPGL   Mutant h42q of hipip from chromatium vinosum at 0.93a
3hip:A -----------------------------VPANAVTESDPAAVALKYHRD-AASSERVAAARPGL   High-potential iron-sulfur protein from chromatium  ...
1hpi:A -------------------------------MERLSEDDPAAQALEYRHD-ASSVQHPAYE----   Molecular structure of the oxidized high-potential iron-  ...
1hlq:A ----------------------------AAPLVAET--DANAKSLGYVAD-TTKADKTKYPKH--   Crystal structure of rhodoferax fermentans high potential  ...
3h31:A ------------------------------------aeltctdvsgltae-eiqmreslqytdhs   Structure of rhodothermus marinus hipip at 1.0 a resolution
2hip:A ------------------------------------------epraedgh-ahdyvneaadasgh   The molecular structure of the high potential iron-sulfur  ...
1pih:A*----------------------------------------asepraedgh-ahdyvneaadasgh×2 The three dimensional structure of the paramagnetic protein  ...
3m9p:A*------------------------------------------------fk-fhsgekvlcfepd-×2 Human msl3 chromodomain bound to DNA and h4k20me1 peptide
3ob9:A --------------------------------------------egmkfk-fhsgekvlcfepd-   Structure of the human msl3 chromo-barrel domain at 2.5  ...
  " :D ---------------------------------------gssasegmkfk-fhsgekvlcfepd-   Structure of the human msl3 chromo-barrel domain at 2.5  ...
1cp9:B ktthtayskarawdgkeltslmawvkqgqaqnwqqwldqaqnqaltinwyyadkdgnigyvhtgh   Crystal structure of penicillin g acylase from the bro1  ...
2dar:A ----------------gssgssgdqdtlvqraehipagkrtpmcahcnq--virgpflvalgksw   Solution structure of first lim domain of enigma-like pdz  ...
1koy:A ----------shiltalrekqapelslssqdlelvtkedpkalavalnwd-ikktetvqeacere   Nmr structure of dff-c domain
4f65:A ksdatekdlsdlisememmkmigkhkniinllgactqdgplyviveyask-gnlreylqarrp--   Crystal structure of human fibroblast growth factor  ...
2psq:A kddatekdlsdlvsememmkmigkhkniinllgactqdgplyviveyask-gnlreylrarrp--   Crystal structure of unphosphorylated unactivated wild type  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P80176 p--peeqhcancqfmqanv-gegd-wkg---cql--fpg--klinv-ngwcaswtlkag------   High-potential iron-sulfur protein OS=Thermochromatium  ...
1eyt:A*P--PEEQHCANCQFMQANV-GEGD-WKG---CQL--FPG--KLINV-NGWCASWTLKAG------×6 Crystal structure of high-potential iron-sulfur protein  ...
1cku:A*P--PEEQHCANCQFMQADAAGATDEWKG---CQL--FPG--KLINV-NGWCASWTLKAG------×4 Ab initio solution and refinement of two high potential  ...
1hip:A P--PEEQHCADCQFMQADAAGATDEWKG---CQL--FPG--KLINV-NGWCASWTLKAG------   Two-angstrom crystal structure of oxidized chromatium high  ...
1noe:A P--PEEQHCANCQFMQADAAGATDEWKG---CQL--FPG--KLINV-NGWSASWTLKAG------   Nmr study of reduced high potential iron sulfur protein
1js2:A P--PEEQHCANCQFMQADAAGATDEWKG---CQL--FPG--KLINV-NGWSASWTLKAG------   Crystal structure of c77s hipip: a serine ligated [4fe-4s] c
1b0y:A P--PEEQQCANCQFMQADAAGATDEWKG---CQL--FPG--KLINV-NGWCASWTLKAG------   Mutant h42q of hipip from chromatium vinosum at 0.93a
3hip:A P--PEEQHCENCQFMNPDS-AAAD-WKG---CQL--FPG--KLINL-SGWCASWTLRAG------   High-potential iron-sulfur protein from chromatium  ...
1hpi:A ----EGQTCLNC-LLYTDA-SAQD-WGP---CSV--FPG--KLVSA-NGWCTAWVAR--------   Molecular structure of the oxidized high-potential iron-  ...
1hlq:A ---TKDQSCSTCALYQ----GKTA-PQGA--CPL--FAG--KEVVA-KGWCSAWAKKA-------   Crystal structure of rhodoferax fermentans high potential  ...
3h31:A p--ypdktcancqlyvpae-spdq-cgg---cql--ikg--p-ihp-ngyctswvqkat------   Structure of rhodothermus marinus hipip at 1.0 a resolution
2hip:A pryqegqlcencafwgeav-qdg--wgr---cthpdfde--vlvka-egwcsvyapas-------   The molecular structure of the high potential iron-sulfur  ...
1pih:A*pryqegqlcencafwgeav-qdg--wgr---cthpdfde--vlvka-egwcsvyapas-------×2 The three dimensional structure of the paramagnetic protein  ...
3m9p:A*p--tkarvlydakivdviv-gk-d-ekg---rki---pe--ylihf-ngwnrswdrwaaedhvlr×2 Human msl3 chromodomain bound to DNA and h4k20me1 peptide
3ob9:A p--tkarvlydakivdviv-gk-d-ekg---rki---pe--ylihf-ngwnrswdrwaaedhvlr   Structure of the human msl3 chromo-barrel domain at 2.5  ...
  " :D p--tkarvlydakivdviv-gk-d-ekg---rki---pe--ylihf-ngwnrswdrwaaedhvlr   Structure of the human msl3 chromo-barrel domain at 2.5  ...
1cp9:B y--pdrqinhdprlpvsgt-gewd-wkg---iqp--fannpkvynpksgyianwnnspaknypas   Crystal structure of penicillin g acylase from the bro1  ...
2dar:A h--peefncahckntmayi-gfve-ekgalycel--cye--kffas-gpssg-------------   Solution structure of first lim domain of enigma-like pdz  ...
1koy:A l--alrlqqt-------------------------------------------------------   Nmr structure of dff-c domain
4f65:A p--peeqlsskdlvscayq-varg-mey---las--kkc--ihrdl-aarnvlvtednvmkiadf   Crystal structure of human fibroblast growth factor  ...
2psq:A p--peeqmtfkdlvsctyq-larg-mey---las--qkc--ihrdl-aarnvlvtennvmkiadf   Crystal structure of unphosphorylated unactivated wild type  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P80176 -----------------------------------------------------------------   High-potential iron-sulfur protein OS=Thermochromatium  ...
1eyt:A*-----------------------------------------------------------------×6 Crystal structure of high-potential iron-sulfur protein  ...
1cku:A*-----------------------------------------------------------------×4 Ab initio solution and refinement of two high potential  ...
1hip:A -----------------------------------------------------------------   Two-angstrom crystal structure of oxidized chromatium high  ...
1noe:A -----------------------------------------------------------------   Nmr study of reduced high potential iron sulfur protein
1js2:A -----------------------------------------------------------------   Crystal structure of c77s hipip: a serine ligated [4fe-4s] c
1b0y:A -----------------------------------------------------------------   Mutant h42q of hipip from chromatium vinosum at 0.93a
3hip:A -----------------------------------------------------------------   High-potential iron-sulfur protein from chromatium  ...
1hpi:A -----------------------------------------------------------------   Molecular structure of the oxidized high-potential iron-  ...
1hlq:A -----------------------------------------------------------------   Crystal structure of rhodoferax fermentans high potential  ...
3h31:A -----------------------------------------------------------------   Structure of rhodothermus marinus hipip at 1.0 a resolution
2hip:A -----------------------------------------------------------------   The molecular structure of the high potential iron-sulfur  ...
1pih:A*-----------------------------------------------------------------×2 The three dimensional structure of the paramagnetic protein  ...
3m9p:A*dtdenrrlqrklarkava-----------------------------------------------×2 Human msl3 chromodomain bound to DNA and h4k20me1 peptide
3ob9:A dtdenrrlqrklarkavar----------------------------------------------   Structure of the human msl3 chromo-barrel domain at 2.5  ...
  " :D dtdenrrlqrklarkava-----------------------------------------------   Structure of the human msl3 chromo-barrel domain at 2.5  ...
1cp9:B dlfaflwgsadrvkeidnrieaydkltaddmwailqqtsrvdlnhrlftpfltqatqglpsndns   Crystal structure of penicillin g acylase from the bro1  ...
2dar:A -----------------------------------------------------------------   Solution structure of first lim domain of enigma-like pdz  ...
1koy:A -----------------------------------------------------------------   Nmr structure of dff-c domain
4f65:A yykkttngrlpvkwmapealfdriythqsdvwsfgvllweiftlggspypgvpveelfkllkegh   Crystal structure of human fibroblast growth factor  ...
2psq:A glardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipve   Crystal structure of unphosphorylated unactivated wild type  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P80176 -----------------------------------------------------------------   High-potential iron-sulfur protein OS=Thermochromatium  ...
1eyt:A*-----------------------------------------------------------------×6 Crystal structure of high-potential iron-sulfur protein  ...
1cku:A*-----------------------------------------------------------------×4 Ab initio solution and refinement of two high potential  ...
1hip:A -----------------------------------------------------------------   Two-angstrom crystal structure of oxidized chromatium high  ...
1noe:A -----------------------------------------------------------------   Nmr study of reduced high potential iron sulfur protein
1js2:A -----------------------------------------------------------------   Crystal structure of c77s hipip: a serine ligated [4fe-4s] c
1b0y:A -----------------------------------------------------------------   Mutant h42q of hipip from chromatium vinosum at 0.93a
3hip:A -----------------------------------------------------------------   High-potential iron-sulfur protein from chromatium  ...
1hpi:A -----------------------------------------------------------------   Molecular structure of the oxidized high-potential iron-  ...
1hlq:A -----------------------------------------------------------------   Crystal structure of rhodoferax fermentans high potential  ...
3h31:A -----------------------------------------------------------------   Structure of rhodothermus marinus hipip at 1.0 a resolution
2hip:A -----------------------------------------------------------------   The molecular structure of the high potential iron-sulfur  ...
1pih:A*-----------------------------------------------------------------×2 The three dimensional structure of the paramagnetic protein  ...
3m9p:A*-----------------------------------------------------------------×2 Human msl3 chromodomain bound to DNA and h4k20me1 peptide
3ob9:A -----------------------------------------------------------------   Structure of the human msl3 chromo-barrel domain at 2.5  ...
  " :D -----------------------------------------------------------------   Structure of the human msl3 chromo-barrel domain at 2.5  ...
1cp9:B vklvsmlqqwdginqlssdgkhyihpgsaildiwlkemlkatlgqtvpapfdkwylasgyettqe   Crystal structure of penicillin g acylase from the bro1  ...
2dar:A -----------------------------------------------------------------   Solution structure of first lim domain of enigma-like pdz  ...
1koy:A -----------------------------------------------------------------   Nmr structure of dff-c domain
4f65:A rmdkpsnctnelymmmrdcwhavpsqrptfkqlvedldrivaltsnqe-----------------   Crystal structure of human fibroblast growth factor  ...
2psq:A elfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltltt----------   Crystal structure of unphosphorylated unactivated wild type  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P80176 -----------------------------------------------------------------   High-potential iron-sulfur protein OS=Thermochromatium  ...
1eyt:A*-----------------------------------------------------------------×6 Crystal structure of high-potential iron-sulfur protein  ...
1cku:A*-----------------------------------------------------------------×4 Ab initio solution and refinement of two high potential  ...
1hip:A -----------------------------------------------------------------   Two-angstrom crystal structure of oxidized chromatium high  ...
1noe:A -----------------------------------------------------------------   Nmr study of reduced high potential iron sulfur protein
1js2:A -----------------------------------------------------------------   Crystal structure of c77s hipip: a serine ligated [4fe-4s] c
1b0y:A -----------------------------------------------------------------   Mutant h42q of hipip from chromatium vinosum at 0.93a
3hip:A -----------------------------------------------------------------   High-potential iron-sulfur protein from chromatium  ...
1hpi:A -----------------------------------------------------------------   Molecular structure of the oxidized high-potential iron-  ...
1hlq:A -----------------------------------------------------------------   Crystal structure of rhodoferax fermentans high potential  ...
3h31:A -----------------------------------------------------------------   Structure of rhodothermus marinus hipip at 1.0 a resolution
2hip:A -----------------------------------------------------------------   The molecular structure of the high potential iron-sulfur  ...
1pih:A*-----------------------------------------------------------------×2 The three dimensional structure of the paramagnetic protein  ...
3m9p:A*-----------------------------------------------------------------×2 Human msl3 chromodomain bound to DNA and h4k20me1 peptide
3ob9:A -----------------------------------------------------------------   Structure of the human msl3 chromo-barrel domain at 2.5  ...
  " :D -----------------------------------------------------------------   Structure of the human msl3 chromo-barrel domain at 2.5  ...
1cp9:B gptgslnistgakllyeslledkspisqsidlfsgqpqndvirktlnttyqkmiekygdnpanwq   Crystal structure of penicillin g acylase from the bro1  ...
2dar:A -----------------------------------------------------------------   Solution structure of first lim domain of enigma-like pdz  ...
1koy:A -----------------------------------------------------------------   Nmr structure of dff-c domain
4f65:A -----------------------------------------------------------------   Crystal structure of human fibroblast growth factor  ...
2psq:A -----------------------------------------------------------------   Crystal structure of unphosphorylated unactivated wild type  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P80176 -----------------------------------------------------------------   High-potential iron-sulfur protein OS=Thermochromatium  ...
1eyt:A*-----------------------------------------------------------------×6 Crystal structure of high-potential iron-sulfur protein  ...
1cku:A*-----------------------------------------------------------------×4 Ab initio solution and refinement of two high potential  ...
1hip:A -----------------------------------------------------------------   Two-angstrom crystal structure of oxidized chromatium high  ...
1noe:A -----------------------------------------------------------------   Nmr study of reduced high potential iron sulfur protein
1js2:A -----------------------------------------------------------------   Crystal structure of c77s hipip: a serine ligated [4fe-4s] c
1b0y:A -----------------------------------------------------------------   Mutant h42q of hipip from chromatium vinosum at 0.93a
3hip:A -----------------------------------------------------------------   High-potential iron-sulfur protein from chromatium  ...
1hpi:A -----------------------------------------------------------------   Molecular structure of the oxidized high-potential iron-  ...
1hlq:A -----------------------------------------------------------------   Crystal structure of rhodoferax fermentans high potential  ...
3h31:A -----------------------------------------------------------------   Structure of rhodothermus marinus hipip at 1.0 a resolution
2hip:A -----------------------------------------------------------------   The molecular structure of the high potential iron-sulfur  ...
1pih:A*-----------------------------------------------------------------×2 The three dimensional structure of the paramagnetic protein  ...
3m9p:A*-----------------------------------------------------------------×2 Human msl3 chromodomain bound to DNA and h4k20me1 peptide
3ob9:A -----------------------------------------------------------------   Structure of the human msl3 chromo-barrel domain at 2.5  ...
  " :D -----------------------------------------------------------------   Structure of the human msl3 chromo-barrel domain at 2.5  ...
1cp9:B tpataltfrennffgipqalpqenfhqneyhnrgtendlivfteegvsawdvvapgqsgfispqg   Crystal structure of penicillin g acylase from the bro1  ...
2dar:A -----------------------------------------------------------------   Solution structure of first lim domain of enigma-like pdz  ...
1koy:A -----------------------------------------------------------------   Nmr structure of dff-c domain
4f65:A -----------------------------------------------------------------   Crystal structure of human fibroblast growth factor  ...
2psq:A -----------------------------------------------------------------   Crystal structure of unphosphorylated unactivated wild type  ...

                5         5         5         5  
                3         4         5         6  
       123456789012345678901234567890123456789012                          Protein name
       ---------+---------+---------+---------+--                          ------------
P80176 ------------------------------------------                          High-potential iron-sulfur protein OS=Thermochromatium  ...
1eyt:A*------------------------------------------                       ×6 Crystal structure of high-potential iron-sulfur protein  ...
1cku:A*------------------------------------------                       ×4 Ab initio solution and refinement of two high potential  ...
1hip:A ------------------------------------------                          Two-angstrom crystal structure of oxidized chromatium high  ...
1noe:A ------------------------------------------                          Nmr study of reduced high potential iron sulfur protein
1js2:A ------------------------------------------                          Crystal structure of c77s hipip: a serine ligated [4fe-4s] c
1b0y:A ------------------------------------------                          Mutant h42q of hipip from chromatium vinosum at 0.93a
3hip:A ------------------------------------------                          High-potential iron-sulfur protein from chromatium  ...
1hpi:A ------------------------------------------                          Molecular structure of the oxidized high-potential iron-  ...
1hlq:A ------------------------------------------                          Crystal structure of rhodoferax fermentans high potential  ...
3h31:A ------------------------------------------                          Structure of rhodothermus marinus hipip at 1.0 a resolution
2hip:A ------------------------------------------                          The molecular structure of the high potential iron-sulfur  ...
1pih:A*------------------------------------------                       ×2 The three dimensional structure of the paramagnetic protein  ...
3m9p:A*------------------------------------------                       ×2 Human msl3 chromodomain bound to DNA and h4k20me1 peptide
3ob9:A ------------------------------------------                          Structure of the human msl3 chromo-barrel domain at 2.5  ...
  " :D ------------------------------------------                          Structure of the human msl3 chromo-barrel domain at 2.5  ...
1cp9:B kpsphyqdqlslyqqfgkkplwlnsedvapyiestetliier                          Crystal structure of penicillin g acylase from the bro1  ...
2dar:A ------------------------------------------                          Solution structure of first lim domain of enigma-like pdz  ...
1koy:A ------------------------------------------                          Nmr structure of dff-c domain
4f65:A ------------------------------------------                          Crystal structure of human fibroblast growth factor  ...
2psq:A ------------------------------------------                          Crystal structure of unphosphorylated unactivated wild type  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P80176. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 83 - - P80176 High-potential iron-sulfur protein OS=Thermochromatium tepidum GN=hip PE=1 SV=1
2. 591 100.0% 83 83 833.9 1.8e-39 1eyt:A * Crystal structure of high-potential iron-sulfur protein from thermochromatium tepidum
3. " " " " " "  = 1iua:A *
Ultra-high resolution structure of hipip from thermochromatium tepidum
4. " " " " " "  = 2ams:A *
Strucutre of the oxidized hipip from thermochromatium tepidu angstrom resolution
5. " " " " " "  = 2fla:A *
Structure of thereduced hipip from thermochromatium tepidum angstrom resolution
6. " " " " " "  = 3a38:A *
Crystal structure of high-potential iron-sulfur protein from thermochromatium tepidum at 0.7 angstrom resolution
7. " " " " " "  = 3a39:A *
Crystal structure of high-potential iron-sulfur protein from thermochromatium tepidum at 0.72 angstrom resolution
8. 520 89.4% 85 85 735.1 5.7e-34 1cku:A * Ab initio solution and refinement of two high potential iron protein structures at atomic resolution
9. " " " " " "  = 1hrq:A *
The three-dimensional solution structure of the reduced high-potential iron-sulfur protein from chromatium vinosum through nmr
10. " " " " " "  = 1hrr:A *
The three dimensional structure of the reduced high potential iron-sulfur protein from chromatium vinosum through nmr
11. " " " " " "  = 1neh:A *
High potential iron-sulfur protein
12. 509 87.1% 85 85 719.8 4.1e-33 1hip:A Two-angstrom crystal structure of oxidized chromatium high potential iron protein
13. 506 88.2% 85 86 715.5 7e-33 1noe:A Nmr study of reduced high potential iron sulfur protein
14. 506 88.2% 85 89 715.3 7.2e-33 1js2:A Crystal structure of c77s hipip: a serine ligated [4fe-4s] c
15. 505 87.1% 85 85 714.2 8.3e-33 1b0y:A Mutant h42q of hipip from chromatium vinosum at 0.93a
16. 471 76.5% 81 82 667.2 3.5e-30 3hip:A High-potential iron-sulfur protein from chromatium purpuratum
17. 205 37.3% 75 71 298.3 1.2e-09 1hpi:A Molecular structure of the oxidized high-potential iron- sulfur protein isolated from ectothiorhodospira vacuolata
18. 153 34.9% 83 75 225.6 1.4e-05 1hlq:A Crystal structure of rhodoferax fermentans high potential iron-sulfur protein refined to 1.45 a
19. 126 41.3% 46 74 188.2 0.0017 3h31:A Structure of rhodothermus marinus hipip at 1.0 a resolution
20. 99 37.3% 51 71 150.9 0.2 2hip:A The molecular structure of the high potential iron-sulfur protein isolated from ectothiorhodospira halophila determined at 2.5-angstroms resolution
21. 99 37.3% 51 73 150.7 0.2 1pih:A * The three dimensional structure of the paramagnetic protein hipip i from e.Halophila through nuclear magnetic resonance
22. " " " " " "  = 1pij:A *
The three dimensional structure of the paramagnetic protein hipip i from e.Halophila through nuclear magnetic resonance
23. 78 32.7% 52 84 120.6 9.7 3m9p:A * Human msl3 chromodomain bound to DNA and h4k20me1 peptide
24. " " " " " "  = 3oa6:A *
Human msl3 chromodomain bound to DNA and h4k20me1 peptide
25. 78 32.7% 52 89 120.2 10 3ob9:A Structure of the human msl3 chromo-barrel domain at 2.5 angs resolution
26. 78 32.7% 52 93 119.9 11 3ob9:D Structure of the human msl3 chromo-barrel domain at 2.5 angs resolution
27. 86 30.1% 73 553 119.3 11 1cp9:B Crystal structure of penicillin g acylase from the bro1 mutant strain of providencia rettgeri
28. 75 28.6% 63 90 116.0 17 2dar:A Solution structure of first lim domain of enigma-like pdz and lim domains protein
29. 72 46.2% 26 62 114.3 22 1koy:A Nmr structure of dff-c domain
30. 79 38.9% 36 279 114.1 22 4f65:A Crystal structure of human fibroblast growth factor receptor domain in complex with compound 8
31. 78 38.9% 36 287 112.5 27 2psq:A Crystal structure of unphosphorylated unactivated wild type fgf receptor 2 (fgfr2) kinase domain

Number of sequences: 31

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 72 46.2% 26 83 112.3 28 1iyr:A Nmr structure ensemble of dff-c domain
2. 74 46.7% 30 135 111.9 29 4eb7:C A. Fulgidus iscs-iscu complex structure
3. 74 46.7% 30 138 111.8 30 4eb5:C A. Fulgidus iscs-iscu complex structure
4. 68 27.9% 43 62 108.7 44 1isu:A The three-dimensional structure of the high-potential iron- sulfur protein isolated from the purple phototrophic bacterium rhodocyclus tenuis determined and refined at 1.5 angstroms resolution
5. 76 32.4% 37 381 107.8 50 1vfh:A Crystal structure of alanine racemase from d-cycloserine pro streptomyces lavendulae
6. 76 32.4% 37 382 107.8 50 1vfs:A Crystal structure of d-cycloserine-bound form of alanine racemase from d-cycloserine-producing streptomyces lavendulae
7. 76 32.4% 37 381 107.8 50 1vft:A Crystal structure of l-cycloserine-bound form of alanine racemase from d-cycloserine-producing streptomyces lavendulae

Number of sequences: 7

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer