spacer
spacer

SAS results for UniProt accession no. E2RKA8

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA   to metal
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. E2RKA8 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. E2RKA8 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 25 unique sequences (including 12 consensus sequences) giving 110 sequence matches in all. The 12 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
E2RKA8 --------------------------------------------------------maalrplvk    60S ribosomal protein L32 OS=Canis familiaris GN=RPL32 PE=1  ...
3j3b:e --------------------------------------------------------maalrplvk    Structure of the human 60s ribosomal proteins
3j39:e ---------------------------------------------------------mtirpayr    Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:h*----------------------------------------------------------mavpllt×3  Localization of the large subunit ribosomal proteins into a  ...
4a17:X*-----------------------------------------------------------ikpvah×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:h*-----------------------------------------------------------maslph×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:e*------------------------------------------------------------aslph×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3o58:b*-----------------------------------------------------------maslph×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3zf7:i -----------------------------------------------------------vkpfvp    High-resolution cryo-electron microscopy structure of the  ...
1k5y:X*-----------------------------------------------------------------×3  Structure of the translating 80s ribosome from yeast,  ...
2zkr:9 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
  " :y ------------------------------------------------------------rplvk    Structure of a mammalian ribosomal 60s subunit within an  ...
3j21:b*-------------------------------------------------------ekefkrllrv×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4adx:Y -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
1jj2:X*------------------------------------------telqargltektpdlsdedarll×64 Fully refined crystal structure of the haloarcula  ...
1w2b:X ------------------------------------------telqargltektpdlsdedarll    Trigger factor ribosome binding domain in complex with 50s
4hub:Y ------------------------------------------telqargltektpdlsdedarll    The re-refined crystal structure of the haloarcula  ...
1ffk:V ---------------------------------------------qargltektpdlsdedarll    Crystal structure of the large ribosomal subunit from  ...
3j20:E*--------------------------------rkgpkrhlkrlaaptswyierkaykwavrprpg×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1a87:A ------------------sakvgeititpdnskpgryissnpeysllaklidaesikgtevytfh    Colicin n
4bqh:A plgsmsdrdvciqrltganqdhiltalehgseaerasltaqitnelagvdfrhfndvlresleis    Crystal structure of the uridine diphosphate n-  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
E2RKA8 pkivkkrtkk-firhqsdryvkikrn--wrk--prg---idnrvrrrfkgqi-lmpnigygsnkk    60S ribosomal protein L32 OS=Canis familiaris GN=RPL32 PE=1  ...
3j3b:e pkivkkrtkk-firhqsdryvkikrn--wrk--prg---idnrvrrrfkgqi-lmpnigygsnkk    Structure of the human 60s ribosomal proteins
3j39:e pkivkkrtkh-firhqsdryaklshk--wrk--pkg---idnrvrrrfkgqy-lmpnigygsnkr    Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:h*kkivkkrvkq-fkrphsdryiglkts--wrr--pkg---idsrvrrkfkgct-lmpnigygsdkk×3  Localization of the large subunit ribosomal proteins into a  ...
4a17:X*kkiikkrtkk-fvrfesedfakldss--wrr--prg---idnrvrrrfrgqr-rmakigfasdaa×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:h*pkivkkhtkk-fkrhhsdryhrvaen--wrk--qkg---idsvvrrrfrgni-sqpkigygsnkk×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:e*pkivkkhtkk-fkrhhsdryhrvaen--wrk--qkg---idsvvrrrfrgni-sqpkigygsnkk×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3o58:b*pkivkkhtkk-fkrhhsdryhrvaen--wrk--qkg---idsvvrrrfrgni-sqpkigygsnkk×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3zf7:i rnivkkrtkk-ftrhrcelfpqlsss--wrk--prg---edspvrrrykgqk-ampnkgygsdrr    High-resolution cryo-electron microscopy structure of the  ...
1k5y:X*-------tkk-fkrhhsdryhrvaen--wrk--qkg---idsvvrrrfrgni-sqpkigygsnkk×3  Structure of the translating 80s ribosome from yeast,  ...
2zkr:9 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
  " :y pkivkkrtkk--irhqsdryvkikr---wrk--prg---idnrvrrr-kgqi-lmpnigygsnkk    Structure of a mammalian ribosomal 60s subunit within an  ...
3j21:b*rarlkrkkpr-flrqewwrypkfkndpkwrr--pkg---idskmrlklkgkp-rspsigwsspkl×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4adx:Y -------kpq-fnrqdhhkkkrvsts--wrk--prg---qlskqrrgikgkg-dtveagfrspta    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
1jj2:X*tqrhrvgkpq-fnrqdhhkkkrvsts--wrk--prg---qlskqrrgikgkg-dtveagfrspta×64 Fully refined crystal structure of the haloarcula  ...
1w2b:X tqrhrvgkpq-fnrqdhhkkkrvsts--wrk--prg---qlskqrrgikgkg-dtveagfrspta    Trigger factor ribosome binding domain in complex with 50s
4hub:Y tqrhrvgkpq-fnrqdhhkkkrvsts--wrk--prg---qlskqrrgikgkg-dtveagfrspta    The re-refined crystal structure of the haloarcula  ...
1ffk:V tqrhrvgkpq-fnrqdhhkkkrvsts--wrk--prg---qlskqrrgikgkg-dtveagfrspta    Crystal structure of the large ribosomal subunit from  ...
3j20:E*phnmrtsipllyivrdylgyaktare--arkilnegkflvdgrvrkdykfpvgimdvvsipetge×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1a87:A trkgqyvkvt-vpdsnidkmrvdyvn--wkg--pk----ynnklvkrfvsqf-ll----frkeek    Colicin n
4bqh:A kslaeppakd-sffdissvdrrrgqa--kri--knl---eavgykaiqkgqi-aflilaggsgtr    Crystal structure of the uridine diphosphate n-  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
E2RKA8 tkhmlpsgfr-kflvhnv--kelevllm--cnk-sycaeiahnvss---knrkaiveraaqlair    60S ribosomal protein L32 OS=Canis familiaris GN=RPL32 PE=1  ...
3j3b:e tkhmlpsgfr-kflvhnv--kelevllm--cnk-sycaeiahnvss---knrkaiveraaqlair    Structure of the human 60s ribosomal proteins
3j39:e trhmlptgfk-kflvhnv--relevllm--qnr-vycgeiahgvss---kkrkeiverakqlsvr    Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:h*trhylpnkfk-kfvvhnv--selellmm--hnr-tycaeiahnvst---rkrkeiveraaqldiv×3  Localization of the large subunit ribosomal proteins into a  ...
4a17:X*tkhllpngfk-kflirnp--adleillm--nnr-tycgeiahnisa---qvkaalvkraaelgvr×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:h*tkflspsghk-tflvanv--kdletltm--htk-tyaaeiahnisa---knrvvilarakalgik×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:e*tkflspsghk-tflvanv--kdletltm--htk-tyaaeiahnisa---knrvvilarakalgik×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3o58:b*tkflspsghk-tflvanv--kdletltm--htk-tyaaeiahnisa---knrvvilarakalgik×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3zf7:i tkyitpsgfk-nfpvnnv--qdlymllm--qnr-kyagvishtvga---karkaivrkaheldvr    High-resolution cryo-electron microscopy structure of the  ...
1k5y:X*tkflspsghk-tflvanv--kdletltm--htk-tyaaeiahnisa---knrvvilarakalgik×3  Structure of the translating 80s ribosome from yeast,  ...
2zkr:9 --hmlpsgfr-kflvhnv--kelevllm--cnk-sycaeiahnvss---knrkaiveraaqlair    Structure of a mammalian ribosomal 60s subunit within an  ...
  " :y tk---------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j21:b*vrglhpsgye-evlvhnv--keleald----pk-rqaariahtvgk---kkrieiikraeelgik×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4adx:Y vrgkhpsgfe-evrvhnv--ddlegvd----gd-teavriaskvga---rkrerieeeaedagir    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
1jj2:X*vrgkhpsgfe-evrvhnv--ddlegvd----gd-teavriaskvga---rkrerieeeaedagir×64 Fully refined crystal structure of the haloarcula  ...
1w2b:X vrgkhpsgfe-evrvhnv--ddlegvd----gd-teavriaskvga---rkrerieeeaedagir    Trigger factor ribosome binding domain in complex with 50s
4hub:Y vrgkhpsgfe-evrvhnv--ddlegvd----gd-teavriaskvga---rkrerieeeaedagir    The re-refined crystal structure of the haloarcula  ...
1ffk:V vrgkhpsgfe-evrvhnv--ddlegvd----gd-teavrinskvga---rkrerieeeaedagir    Crystal structure of the large ribosomal subunit from  ...
3j20:E*hyrvlpnrig-klilhpi--sedeafik--plr-irnkrmikgarv---qlnfhdgtnhivsiae×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1a87:A eknekeallkaselvsgmgdklgeylgv--kyk-nvakevandiknfhgrnirsyneamaslnkv    Colicin n
4bqh:A lgfdkpkgf---ftcdgl--qqrkslfmmhcekirrrqeiaesisg---sgrkarvqllvmtsgq    Crystal structure of the uridine diphosphate n-  ...

           2         2         2         2         2         2         2
           0         1         2         3         4         5         6
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
E2RKA8 vtnpnarlrseene---------------------------------------------------    60S ribosomal protein L32 OS=Canis familiaris GN=RPL32 PE=1  ...
3j3b:e vtnpnarlrsee-----------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:e ltnpngrlrsqe-----------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:h*vtnklarlrsqede---------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
4a17:X*ltnanak----------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:h*vtnpkgrlalea-----------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:e*vtnpkgrlal-------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3o58:b*vtnpkgr----------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3zf7:i lingnaklrrv------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
1k5y:X*vtnp-------------------------------------------------------------×3  Structure of the translating 80s ribosome from yeast,  ...
2zkr:9 vtnp-------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
  " :y -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j21:b*vlnpr------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4adx:Y vlnpt------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
1jj2:X*vlnptyvev--------------------------------------------------------×64 Fully refined crystal structure of the haloarcula  ...
1w2b:X vlnptyveve-------------------------------------------------------    Trigger factor ribosome binding domain in complex with 50s
4hub:Y vlnptyvevev------------------------------------------------------    The re-refined crystal structure of the haloarcula  ...
1ffk:V vlnptyvevevse----------------------------------------------------    Crystal structure of the large ribosomal subunit from  ...
3j20:E*kdnyftsytvlmkvpereilevlpfekgayvfvtqgknvarkgriveikrfpmgwpdvvtiedee×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1a87:A lanpkmkvnksdkdaivnawkqvnakdmankignlgkafkvadlaikvekireksiegyntgnwg    Colicin n
4bqh:A ndaetqrffeensyfglereqvhffaqssvpcydentgriimenrgricaapggngavfaalaap    Crystal structure of the uridine diphosphate n-  ...

                2         2         2         3         3         3     
                7         8         9         0         1         2     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
E2RKA8 -----------------------------------------------------------------    60S ribosomal protein L32 OS=Canis familiaris GN=RPL32 PE=1  ...
3j3b:e -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:e -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:h*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
4a17:X*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:h*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:e*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3o58:b*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3zf7:i -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
1k5y:X*-----------------------------------------------------------------×3  Structure of the translating 80s ribosome from yeast,  ...
2zkr:9 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
  " :y -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j21:b*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4adx:Y -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
1jj2:X*-----------------------------------------------------------------×64 Fully refined crystal structure of the haloarcula  ...
1w2b:X -----------------------------------------------------------------    Trigger factor ribosome binding domain in complex with 50s
4hub:Y -----------------------------------------------------------------    The re-refined crystal structure of the haloarcula  ...
1ffk:V -----------------------------------------------------------------    Crystal structure of the large ribosomal subunit from  ...
3j20:E*gelfdtlkeyafvvgtdkpkislp-----------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1a87:A pllleveswiiggvvagvaislfgavlsflpisglavtalgvigimtisylssfidanrvsninn    Colicin n
4bqh:A ratktlqvkesllqhlrklgiayvqignidnllanvadpvfigyaieeeahvvvktcpkrgpder    Crystal structure of the uridine diphosphate n-  ...

           3         3         3         3         3         3         3
           3         4         5         6         7         8         9
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
E2RKA8 -----------------------------------------------------------------    60S ribosomal protein L32 OS=Canis familiaris GN=RPL32 PE=1  ...
3j3b:e -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:e -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:h*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
4a17:X*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:h*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:e*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3o58:b*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3zf7:i -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
1k5y:X*-----------------------------------------------------------------×3  Structure of the translating 80s ribosome from yeast,  ...
2zkr:9 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
  " :y -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j21:b*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4adx:Y -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
1jj2:X*-----------------------------------------------------------------×64 Fully refined crystal structure of the haloarcula  ...
1w2b:X -----------------------------------------------------------------    Trigger factor ribosome binding domain in complex with 50s
4hub:Y -----------------------------------------------------------------    The re-refined crystal structure of the haloarcula  ...
1ffk:V -----------------------------------------------------------------    Crystal structure of the large ribosomal subunit from  ...
3j20:E*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1a87:A iissvir----------------------------------------------------------    Colicin n
4bqh:A vgvfvrasgkwgvveyteirakeiddatgelkfncanissnlcslhfmslaaermksftqyhaar    Crystal structure of the uridine diphosphate n-  ...

                4         4         4         4         4         4     
                0         1         2         3         4         5     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
E2RKA8 -----------------------------------------------------------------    60S ribosomal protein L32 OS=Canis familiaris GN=RPL32 PE=1  ...
3j3b:e -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:e -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:h*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
4a17:X*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:h*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:e*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3o58:b*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3zf7:i -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
1k5y:X*-----------------------------------------------------------------×3  Structure of the translating 80s ribosome from yeast,  ...
2zkr:9 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
  " :y -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j21:b*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4adx:Y -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
1jj2:X*-----------------------------------------------------------------×64 Fully refined crystal structure of the haloarcula  ...
1w2b:X -----------------------------------------------------------------    Trigger factor ribosome binding domain in complex with 50s
4hub:Y -----------------------------------------------------------------    The re-refined crystal structure of the haloarcula  ...
1ffk:V -----------------------------------------------------------------    Crystal structure of the large ribosomal subunit from  ...
3j20:E*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1a87:A -----------------------------------------------------------------    Colicin n
4bqh:A kkiptikgpvmgikleaflfdlfrfvdecdhppkdsgafrimqvdrddefgpvknadgaasdtpa    Crystal structure of the uridine diphosphate n-  ...

           4         4         4         4         5         5         5
           6         7         8         9         0         1         2
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
E2RKA8 -----------------------------------------------------------------    60S ribosomal protein L32 OS=Canis familiaris GN=RPL32 PE=1  ...
3j3b:e -----------------------------------------------------------------    Structure of the human 60s ribosomal proteins
3j39:e -----------------------------------------------------------------    Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:h*-----------------------------------------------------------------×3  Localization of the large subunit ribosomal proteins into a  ...
4a17:X*-----------------------------------------------------------------×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:h*-----------------------------------------------------------------×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:e*-----------------------------------------------------------------×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3o58:b*-----------------------------------------------------------------×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3zf7:i -----------------------------------------------------------------    High-resolution cryo-electron microscopy structure of the  ...
1k5y:X*-----------------------------------------------------------------×3  Structure of the translating 80s ribosome from yeast,  ...
2zkr:9 -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
  " :y -----------------------------------------------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3j21:b*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4adx:Y -----------------------------------------------------------------    The cryo-em structure of the archaeal 50s ribosomal subunit  ...
1jj2:X*-----------------------------------------------------------------×64 Fully refined crystal structure of the haloarcula  ...
1w2b:X -----------------------------------------------------------------    Trigger factor ribosome binding domain in complex with 50s
4hub:Y -----------------------------------------------------------------    The re-refined crystal structure of the haloarcula  ...
1ffk:V -----------------------------------------------------------------    Crystal structure of the large ribosomal subunit from  ...
3j20:E*-----------------------------------------------------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1a87:A -----------------------------------------------------------------    Colicin n
4bqh:A davrlllsqhtrwlitaletaamgvdvteakeavavmrscsikaeisplvsvggeglrqhlprvi    Crystal structure of the uridine diphosphate n-  ...

                5        
                3        
       123456789012345678                                                   Protein name
       ---------+--------                                                   ------------
E2RKA8 ------------------                                                   60S ribosomal protein L32 OS=Canis familiaris GN=RPL32 PE=1  ...
3j3b:e ------------------                                                   Structure of the human 60s ribosomal proteins
3j39:e ------------------                                                   Structure of the d. Melanogaster 60s ribosomal proteins
3iz5:h*------------------                                               ×3  Localization of the large subunit ribosomal proteins into a  ...
4a17:X*------------------                                               ×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3izc:h*------------------                                               ×2  Localization of the large subunit ribosomal proteins into a  ...
3u5e:e*------------------                                               ×5  The structure of the eukaryotic ribosome at 3.0 a  ...
3o58:b*------------------                                               ×2  Yeast 80s ribosome. This entry consists of the 60s subunit  ...
3zf7:i ------------------                                                   High-resolution cryo-electron microscopy structure of the  ...
1k5y:X*------------------                                               ×3  Structure of the translating 80s ribosome from yeast,  ...
2zkr:9 ------------------                                                   Structure of a mammalian ribosomal 60s subunit within an  ...
  " :y ------------------                                                   Structure of a mammalian ribosomal 60s subunit within an  ...
3j21:b*------------------                                               ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
4adx:Y ------------------                                                   The cryo-em structure of the archaeal 50s ribosomal subunit  ...
1jj2:X*------------------                                               ×64 Fully refined crystal structure of the haloarcula  ...
1w2b:X ------------------                                                   Trigger factor ribosome binding domain in complex with 50s
4hub:Y ------------------                                                   The re-refined crystal structure of the haloarcula  ...
1ffk:V ------------------                                                   Crystal structure of the large ribosomal subunit from  ...
3j20:E*------------------                                               ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
1a87:A ------------------                                                   Colicin n
4bqh:A hqllrnpppvifirrdde                                                   Crystal structure of the uridine diphosphate n-  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. E2RKA8. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 135 - - E2RKA8 60S ribosomal protein L32 OS=Canis familiaris GN=RPL32 PE=1 SV=1
2. 875 100.0% 133 133 1153.2 3e-57 3j3b:e Structure of the human 60s ribosomal proteins
3. 704 76.9% 130 132 929.7 8.3e-45 3j39:e Structure of the d. Melanogaster 60s ribosomal proteins
4. 605 67.7% 130 133 800.3 1.3e-37 3iz5:h * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
5. " " " " " "  = 3izr:h *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
6. " " " " " "  = 3j61:e *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
7. 521 55.2% 125 125 690.8 1.7e-31 4a17:X * T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 2.
8. " " " " " "  = 4a1a:X *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 3.
9. " " " " " "  = 4a1c:X *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 4.
10. " " " " " "  = 4a1e:X *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 1
11. 513 62.7% 126 130 680.2 6.6e-31 3izc:h * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
12. " " " " " "  = 3izs:h *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
13. 512 63.4% 123 127 679.0 7.6e-31 3u5e:e * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
14. " " " " " "  = 3u5i:e *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
15. " " " " " "  = 4b6a:e *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
16. " " " " " "  = 4byn:e *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
17. " " " " " "  = 4byu:e *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
18. 507 63.1% 122 125 672.5 1.7e-30 3o58:b * Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
19. " " " " " "  = 3o5h:b *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
20. 464 52.8% 127 129 616.2 2.4e-27 3zf7:i High-resolution cryo-electron microscopy structure of the tr brucei ribosome
21. 460 63.3% 109 109 611.8 4.2e-27 1k5y:X * Structure of the translating 80s ribosome from yeast, obtained by docking atomic models for RNA and protein components into a 15a cryo-em map. This file 1k5y contains the 60s ribosomal subunit. The file 1k5x contains the 40s ribosomal subunit, the p-site bound tRNA and the mRNA codon.
22. " " " " " "  = 1s1i:0 *
Structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 a cryo-em map. This file, 1s1i, contains 60s subunit. The 40s ribosomal subunit is in file 1s1h.
23. " " " " " "  = 3jyw:0 *
Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
24. 376 100.0% 58 58 505.4 3.6e-21 2zkr:9 Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
25. 370 95.2% 63 60 497.3 1e-20 2zkr:y Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
26. 315 43.5% 115 127 421.5 1.7e-16 3j21:b * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
27. " " " " " "  = 3j44:b *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
28. 196 33.6% 107 108 266.8 6.9e-08 4adx:Y The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
29. 196 33.6% 107 142 265.4 8.3e-08 1jj2:X * Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
30. " " " " " "  = 1k73:Z *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
31. " " " " " "  = 1k8a:Z *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
32. " " " " " "  = 1k9m:Z *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1kc8:Z *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
34. " " " " " "  = 1kd1:Z *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
35. " " " " " "  = 1kqs:X *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
36. " " " " " "  = 1m1k:Z *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
37. " " " " " "  = 1m90:Z *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
38. " " " " " "  = 1n8r:Z *
Structure of large ribosomal subunit in complex with virginiamycin m
39. " " " " " "  = 1nji:Z *
Structure of chloramphenicol bound to the 50s ribosomal subunit
40. " " " " " "  = 1q7y:Z *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
41. " " " " " "  = 1q81:Z *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
42. " " " " " "  = 1q82:Z *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
43. " " " " " "  = 1q86:Z *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
44. " " " " " "  = 1qvf:X *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
45. " " " " " "  = 1qvg:X *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
46. " " " " " "  = 1s72:Y *
Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
47. " " " " " "  = 1vq4:Y *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
48. " " " " " "  = 1vq5:Y *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
49. " " " " " "  = 1vq6:Y *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
50. " " " " " "  = 1vq7:Y *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
51. " " " " " "  = 1vq8:Y *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
52. " " " " " "  = 1vq9:Y *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
53. " " " " " "  = 1vqk:Y *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
54. " " " " " "  = 1vql:Y *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
55. " " " " " "  = 1vqm:Y *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
56. " " " " " "  = 1vqn:Y *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
57. " " " " " "  = 1vqo:Y *
The structure of ccpmn bound to the large ribosomal subunit marismortui
58. " " " " " "  = 1vqp:Y *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
59. " " " " " "  = 1yhq:Y *
Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
60. " " " " " "  = 1yi2:Y *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
61. " " " " " "  = 1yij:Y *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
62. " " " " " "  = 1yit:Y *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
63. " " " " " "  = 1yj9:Y *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
64. " " " " " "  = 1yjn:Y *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
65. " " " " " "  = 1yjw:Y *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
66. " " " " " "  = 2otj:Y *
13-deoxytedanolide bound to the large subunit of haloarcula marismortui
67. " " " " " "  = 2otl:Y *
Girodazole bound to the large subunit of haloarcula marismor
68. " " " " " "  = 2qa4:Y *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
69. " " " " " "  = 2qex:Y *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
70. " " " " " "  = 3cc2:Y *
The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
71. " " " " " "  = 3cc4:Y *
Co-crystal structure of anisomycin bound to the 50s ribosoma
72. " " " " " "  = 3cc7:Y *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
73. " " " " " "  = 3cce:Y *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
74. " " " " " "  = 3ccj:Y *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
75. " " " " " "  = 3ccl:Y *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
76. " " " " " "  = 3ccm:Y *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
77. " " " " " "  = 3ccq:Y *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
78. " " " " " "  = 3ccr:Y *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
79. " " " " " "  = 3ccs:Y *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
80. " " " " " "  = 3ccu:Y *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
81. " " " " " "  = 3ccv:Y *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
82. " " " " " "  = 3cd6:Y *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
83. " " " " " "  = 3cma:Y *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
84. " " " " " "  = 3cme:Y *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
85. " " " " " "  = 3cpw:X *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
86. " " " " " "  = 3cxc:X *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
87. " " " " " "  = 3g4s:Y *
Co-crystal structure of tiamulin bound to the large ribosoma
88. " " " " " "  = 3g6e:Y *
Co-crystal structure of homoharringtonine bound to the large subunit
89. " " " " " "  = 3g71:Y *
Co-crystal structure of bruceantin bound to the large riboso subunit
90. " " " " " "  = 3i55:Y *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
91. " " " " " "  = 3i56:Y *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
92. " " " " " "  = 3ow2:X *
Crystal structure of enhanced macrolide bound to 50s ribosom
93. 196 33.6% 107 143 265.3 8.4e-08 1w2b:X Trigger factor ribosome binding domain in complex with 50s
94. 196 33.6% 107 144 265.3 8.4e-08 4hub:Y The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins
95. 190 32.7% 107 143 257.5 2.3e-07 1ffk:V Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
96. 82 24.5% 94 241 113.6 24 3j20:E * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal subunit)
97. " " " " " "  = 3j43:E *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (30s ribosomal subunit)
98. 82 22.2% 108 297 112.5 27 1a87:A Colicin n
99. 84 32.8% 67 521 112.1 29 4bqh:A Crystal structure of the uridine diphosphate n- acetylglucosamine pyrophosphorylase from trypanosoma brucei in complex with inhibitor

Number of sequences: 99

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 73 37.1% 35 48 110.4 36 3jyw:1 * Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
2. " " " " " "  = 3o58:e *
Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
3. " " " " " "  = 3o5h:e *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
4. 73 37.1% 35 50 110.1 37 3u5e:l * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
5. " " " " " "  = 3u5i:l *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
6. " " " " " "  = 4b6a:l *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
7. " " " " " "  = 4byn:l *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
8. " " " " " "  = 4byu:l *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
9. 73 37.1% 35 51 110.0 37 3izc:o * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
10. " " " " " "  = 3izs:o *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
11. 77 35.0% 40 178 108.7 45 2wbn:A Crystal structure of the g2p (large terminase) nuclease domain from the bacteriophage spp1
12. 77 35.0% 40 177 108.7 44 2wc9:A Crystal structure of the g2p (large terminase) nuclease domain from the bacteriophage spp1 with bound mn

Number of sequences: 12

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer