spacer
spacer

SAS results for UniProt accession no. J9PBD3

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to DNA/RNA   to metal
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. J9PBD3 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. J9PBD3 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 32 unique sequences (including 13 consensus sequences) giving 110 sequence matches in all. The 36 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
J9PBD3 mgrrparcyrycknkpypksrfcrgvpdakirifdlgrkkakvdefplcghmvsdeyeqlsseal    Uncharacterized protein OS=Canis familiaris GN=RPL10L PE=1  ...
3j3b:I -grrparcyrycknkpypksrfcrgvpdakirifdlgrkkakvdefplgghmvsdeyeqlsseal    Structure of the human 60s ribosomal proteins
3j39:I -grrparcyrycknkpypksrfcrgvpdpkirifdlgrkkatvedfplcvhlvsdeyeqlsseal    Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:h ---rparcyrycknkpypksrfcrgvpdakirifdlgrkkakvdefplcghmvsdeyeqlsseal    Structure of a mammalian ribosomal 60s subunit within an  ...
3izr:I*mgrrparcyrqiknkpypksrycrgvpdpkiriydvgmkkkgvdefpycvhlvswekenvsseal×2  Localization of the large subunit ribosomal proteins into a  ...
3izs:I marrparcyryqknkpypksrynravpdskiriydlgkkkatvdefplcvhlvsneleqlsseal    Localization of the large subunit ribosomal proteins into a  ...
3zf7:K -arrparcyrfcknkpypksrfcrgvpdprirtfdigkrrapvdefpvcvhvvsreleqisseal    High-resolution cryo-electron microscopy structure of the  ...
3u5i:I*-arrparcyryqknkpypksrynravpdskiriydlgkkkatvdefplcvhlvsneleqlsseal×4  The structure of the eukaryotic ribosome at 3.0 a  ...
1k5y:I*---rparcyryqknkpypksrynravpdskiriydlgkkkatvdefplcvhlvsneleqlsseal×3  Structure of the translating 80s ribosome from yeast,  ...
3izc:I --------------------------------iydlgkkkatvdefplcvhlvsneleqlsseal    Localization of the large subunit ribosomal proteins into a  ...
3iz5:I --------------------------------iydvgmkkkgvdefpycvhlvswekenvsseal    Localization of the large subunit ribosomal proteins into a  ...
3u5e:I -arrparcyryqknkpypksrynravpdskiriydlgkkkatvdefplcvhlvsneleqlsseal    The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:J*--rrparcyryqknkpypksrynravpdskiriydlgkkkatvdefplcvhlvsneleqlsseal×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
4a17:H*-grrparcyrqpkgkpypksrynrgvpdaririydsgrkkatveefpyvvhivsdekeqitseal×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:N*--lrpakidryvdkpaytrreyirgapgpkitifdmgnpagdf-efevslh--taepvqirqnal×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2pa2:A ---------------------------------------kakvdefplcghmvsdeyeqlsseal    Crystal structure of human ribosomal protein l10 core domain
1s72:H*---kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhgsl×13 Refined crystal structure of the haloarcula marismortui  ...
1yhq:H*---kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhgsl×7  Crystal structure of azithromycin bound to the g2099a  ...
2otj:H*---kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhgsl×4  13-deoxytedanolide bound to the large subunit of haloarcula  ...
3cc2:H*---kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhgsl×21 The refined crystal structure of the haloarcula marismortui  ...
4hub:H --dkpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhgsl    The re-refined crystal structure of the haloarcula  ...

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890    Protein name
       ----+---------+---------+---------+---------+---------+---------+    ------------
J9PBD3 eaaricankymvkscgkdg-fhirvrlhpfhvirinkmlscagadrlqtgmrgafgkpqgtvarv    Uncharacterized protein OS=Canis familiaris GN=RPL10L PE=1  ...
3j3b:I eaaricankymvkscgrdg-fhmrvrlhpfhvirinkmlscagadrlqtgmrgafgkpqgtvarv    Structure of the human 60s ribosomal proteins
3j39:I eagriccnkylvkycgkdq-fhirmrlhpfhvirinkmlscagadrlqtgmrgafgkpqgtvarv    Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:h eaaricankymvkscgkdg-fhirvrlhpfhvirinkmlscagadrlqtgmrgafgkpqgtvakv    Structure of a mammalian ribosomal 60s subunit within an  ...
3izr:I*eaariacnkymtknagkda-fhlrvrvhpfhvlrinkmlscagadrlqtgmrgafgkpqgtcarv×2  Localization of the large subunit ribosomal proteins into a  ...
3izs:I eaaricankymttvsgrda-fhlrvrvhpfhvlrinkmlscagadrlqqgmrgawgkphglaarv    Localization of the large subunit ribosomal proteins into a  ...
3zf7:K eaariqankymvkrankec-fhmrirahpfhvlrinkmlscagadrlqtgmrqsygkpngtcarv    High-resolution cryo-electron microscopy structure of the  ...
3u5i:I*eaaricankymttvsgrda-fhlrvrvhpfhvlrinkml-------lqqgmrgawgkphglaarv×4  The structure of the eukaryotic ribosome at 3.0 a  ...
1k5y:I*eaaricankymttvsgrda-fhlrvrvhpfhvlrinkmlscagadrlqqgmrgawgkphglaarv×3  Structure of the translating 80s ribosome from yeast,  ...
3izc:I eaaricankymttvsgrda-fhlrvrvhpfhvlrinkmlscagadrlqqgmrgawgkphglaarv    Localization of the large subunit ribosomal proteins into a  ...
3iz5:I eaariacnkymtknagkda-fhlrvrvhpfhvlrinkmlscagadrlqtgmrgafgkpqgtcarv    Localization of the large subunit ribosomal proteins into a  ...
3u5e:I eaaricankymttvsgrda-fhlrvrvhpfhvlrinkm---------qqgmrgawgkphglaarv    The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:J*eaaricankymttvsgrda-fhlrvrvhpfhvlrinkq-----------gmrgawgkphglaarv×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
4a17:H*eaariaanknlikfiskda-fhlrcrvhpwhvlrink-----------sgmrgafgkalgkaarv×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:N*eaarqqvnrylqknvgrsn-yhfkirvypfqvlrenpmatgrkadrygngmrrpfgkpiglaarl×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2pa2:A eaaricankymvkscgkdg-fhirvrlhpf-----------------------------gtvarv    Crystal structure of human ribosomal protein l10 core domain
1s72:H*easrlsanrhlikelgeegdykmtlrkfphqvlrenk-----------dgmraafgkivgtaarv×13 Refined crystal structure of the haloarcula marismortui  ...
1yhq:H*easrlsanrhlikelgeegdykmtlrkfphqvlrenk-----------dgmraafgkivgtaarv×7  Crystal structure of azithromycin bound to the g2099a  ...
2otj:H*easrlsanrhlikelgeegdykmtlrkfphqvlrenk-----------dgmraafgkivgtaarv×4  13-deoxytedanolide bound to the large subunit of haloarcula  ...
3cc2:H*easrlsanrhlikelgeegdykmtlrkfphqvlrenk-----------dgmraafgkivgtaarv×21 The refined crystal structure of the haloarcula marismortui  ...
4hub:H easrlsanrhlikelgeegdykmtlrkfphqvlrenk----------qdgmraafgkivgtaarv    The re-refined crystal structure of the haloarcula  ...

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345    Protein name
       ---------+---------+---------+---------+---------+---------+-----    ------------
J9PBD3 higqvimsvrtklqnkehviealrrakfkfpgrqkihiskkwgftkfnanefedkvakkrlipdg    Uncharacterized protein OS=Canis familiaris GN=RPL10L PE=1  ...
3j3b:I higqvimsirtklqneehviealrrakfkfpgrqkihiskkwgftkfnadefedmvakkclipdg    Structure of the human 60s ribosomal proteins
3j39:I rigqpimsvrssdrykaqviealrrakfkfpgrqkiyvskkwgftkyereryeelrddnrlepdg    Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:h higqvimsirtklqnkehviealrrakfkfpgrqkihisk-------------------------    Structure of a mammalian ribosomal 60s subunit within an  ...
3izr:I*digqvllsvrckesnakhaeealrrakfkfpgrqkiihsrkwgftkftreeyvkl----------×2  Localization of the large subunit ribosomal proteins into a  ...
3izs:I digqiifsvrtkdsnkdvvveglrrarykfpgqqkiilskkwgftnldrpey-------------    Localization of the large subunit ribosomal proteins into a  ...
3zf7:K rigqillsmrtkdtyvpqaleslrrakmkfpgrqiiviskywgftnilrneyeelrdagklqqrg    High-resolution cryo-electron microscopy structure of the  ...
3u5i:I*digqiifsvrtkdsnkdvvveglrrarykfpgqqkiilskkwgftnldrpeylkkreagevkddg×4  The structure of the eukaryotic ribosome at 3.0 a  ...
1k5y:I*digqiifsvrtkdsnkdvvveglrrarykfpgqqkiils--------------------------×3  Structure of the translating 80s ribosome from yeast,  ...
3izc:I digqiifsvrtkdsnkdvvveglrrarykfpgqqkiilskkwgftnldrpeylkkreagevkddg    Localization of the large subunit ribosomal proteins into a  ...
3iz5:I digqvllsvrckesnakhaeealrrakfkfpgrqkiihsrkwgftkftreeyvklkaegrimsdg    Localization of the large subunit ribosomal proteins into a  ...
3u5e:I digqiifsvrtkdsnkdvvveglrrarykfpgqqkiilskkwgftnldrpeylkkreagevkddg    The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:J*digqiifsvrtkdsnkdvvveglrrarykfpgqqkiilskkwgftnldrpeylkkreagevkddg×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
4a17:H*digsilfsvrvkephvkyaidaltrakakfpgrqkvvtsqkwgftkltraqysrlrnqkklvtdg×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:N*kkdqkilsirvnrqhlkfaiegarraamkfpckcyyriydkegn---------------------×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2pa2:A higqvimsirtklqnkehviealrrakfkfpgrqkihiskkwgftkf------------------    Crystal structure of human ribosomal protein l10 core domain
1s72:H*qageqlftaycnvedaehvkeafrraynkitpscridsspagna---------------------×13 Refined crystal structure of the haloarcula marismortui  ...
1yhq:H*qageqlftaycnvedaehvkeafrraynkitpscrikvergeel---------------------×7  Crystal structure of azithromycin bound to the g2099a  ...
2otj:H*qageqlftaycnvedaehvkeafrraynkitpscridsspagna---------------------×4  13-deoxytedanolide bound to the large subunit of haloarcula  ...
3cc2:H*qageqlftaycnvedaehvkeafrraynkitpscrikvergeel---------------------×21 The refined crystal structure of the haloarcula marismortui  ...
4hub:H qageqlftaycnvedaehvkeafrraynkitpscrikvergeellia------------------    The re-refined crystal structure of the haloarcula  ...

           2         2         2     
           0         1         2     
       678901234567890123456789012345                                       Protein name
       ----+---------+---------+-----                                       ------------
J9PBD3 cgvkyvpsrgsldtwralhs----------                                       Uncharacterized protein OS=Canis familiaris GN=RPL10L PE=1  ...
3j3b:I cgvkyvpshgpldkwrvlhs----------                                       Structure of the human 60s ribosomal proteins
3j39:I cnvkyrpehgpiaawekaqrdvya------                                       Structure of the d. Melanogaster 60s ribosomal proteins
2zkr:h ------------------------------                                       Structure of a mammalian ribosomal 60s subunit within an  ...
3izr:I*------------------------------                                   ×2  Localization of the large subunit ribosomal proteins into a  ...
3izs:I ------------------------------                                       Localization of the large subunit ribosomal proteins into a  ...
3zf7:K lhvklitpkgkitpynima-----------                                       High-resolution cryo-electron microscopy structure of the  ...
3u5i:I*afvkflskkgslennirefpeyfaaqa---                                   ×4  The structure of the eukaryotic ribosome at 3.0 a  ...
1k5y:I*------------------------------                                   ×3  Structure of the translating 80s ribosome from yeast,  ...
3izc:I afvkflskkgslennirefpeyfaaqa---                                       Localization of the large subunit ribosomal proteins into a  ...
3iz5:I vnaqllgshgrlakrapgkaflaetiqasa                                       Localization of the large subunit ribosomal proteins into a  ...
3u5e:I afvkflskkgslennirefpeyfaaqa---                                       The structure of the eukaryotic ribosome at 3.0 a  ...
3j0l:J*afvkflskkgslennirefpeyfaaqa---                                   ×4  Core of mammalian 80s pre-ribosome in complex with trnas  ...
4a17:H*snvkvigergplsrlelfr-----------                                   ×4  T.Thermophila 60s ribosomal subunit in complex with  ...
3j21:N*------------------------------                                   ×2  Promiscuous behavior of proteins in archaeal ribosomes  ...
2pa2:A ------------------------------                                       Crystal structure of human ribosomal protein l10 core domain
1s72:H*------------------------------                                   ×13 Refined crystal structure of the haloarcula marismortui  ...
1yhq:H*------------------------------                                   ×7  Crystal structure of azithromycin bound to the g2099a  ...
2otj:H*------------------------------                                   ×4  13-deoxytedanolide bound to the large subunit of haloarcula  ...
3cc2:H*------------------------------                                   ×21 The refined crystal structure of the haloarcula marismortui  ...
4hub:H ------------------------------                                       The re-refined crystal structure of the haloarcula  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. J9PBD3. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 214 - - J9PBD3 Uncharacterized protein OS=Canis familiaris GN=RPL10L PE=1 SV=1
2. 1403 94.4% 213 213 1746.1 2.8e-90 3j3b:I Structure of the human 60s ribosomal proteins
3. 1156 78.8% 208 217 1439.4 3.4e-73 3j39:I Structure of the d. Melanogaster 60s ribosomal proteins
4. 1140 98.8% 166 166 1421.0 3.6e-72 2zkr:h Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
5. 952 76.2% 181 184 1187.1 3.8e-59 3izr:I * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
6. " " " " " "  = 3j61:I *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
7. 944 74.0% 181 181 1177.3 1.3e-58 3izs:I Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
8. 921 62.9% 210 212 1147.9 5.8e-57 3zf7:K High-resolution cryo-electron microscopy structure of the tr brucei ribosome
9. 903 65.4% 205 213 1125.5 1e-55 3u5i:I * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
10. " " " " " "  = 4b6a:I *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
11. " " " " " "  = 4byn:I *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
12. " " " " " "  = 4byu:I *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
13. 873 75.8% 165 165 1089.7 1e-53 1k5y:I * Structure of the translating 80s ribosome from yeast, obtained by docking atomic models for RNA and protein components into a 15a cryo-em map. This file 1k5y contains the 60s ribosomal subunit. The file 1k5x contains the 40s ribosomal subunit, the p-site bound tRNA and the mRNA codon.
14. " " " " " "  = 1s1i:I *
Structure of the ribosomal 80s-eef2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 a cryo-em map. This file, 1s1i, contains 60s subunit. The 40s ribosomal subunit is in file 1s1h.
15. " " " " " "  = 3jyw:I *
Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
16. 793 66.3% 175 189 989.7 3.8e-48 3izc:I Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
17. 775 67.2% 174 192 967.2 6.7e-47 3iz5:I Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
18. 889 64.4% 205 211 706.1 2.3e-32 3u5e:I The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
19. 872 63.4% 205 208 697.5 7.1e-32 3j0l:J * Core of mammalian 80s pre-ribosome in complex with trnas fit 9.8a cryo-em map: classic pre state 1
20. " " " " " "  = 3j0q:J *
Core of mammalian 80s pre-ribosome in complex with trnas fit 10.6a cryo-em map: rotated pre state 2
21. " " " " " "  = 3o58:J *
Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
22. " " " " " "  = 3o5h:J *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
23. 770 57.1% 205 201 612.1 4.1e-27 4a17:H * T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 2.
24. " " " " " "  = 4a1a:H *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 3.
25. " " " " " "  = 4a1c:H *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 4.
26. " " " " " "  = 4a1e:H *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 5s rrna, 5.8s rrna and proteins of molecule 1
27. 399 39.6% 169 168 501.3 6e-21 3j21:N * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
28. " " " " " "  = 3j44:N *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
29. 661 78.1% 137 108 483.8 5.7e-20 2pa2:A Crystal structure of human ribosomal protein l10 core domain
30. 320 33.7% 166 160 275.7 2.2e-08 1s72:H * Refined crystal structure of the haloarcula marismortui larg ribosomal subunit at 2.4 angstrom resolution
31. " " " " " "  = 1vq4:H *
The structure of the transition state analogue "daa" bound t large ribosomal subunit of haloarcula marismortui
32. " " " " " "  = 1vq5:H *
The structure of the transition state analogue "raa" bound t large ribosomal subunit of haloarcula marismortui
33. " " " " " "  = 1vq6:H *
The structure of c-hpmn and cca-phe-cap-bio bound to the lar ribosomal subunit of haloarcula marismortui
34. " " " " " "  = 1vq7:H *
The structure of the transition state analogue "dca" bound t large ribosomal subunit of haloarcula marismortui
35. " " " " " "  = 1vq8:H *
The structure of ccda-phe-cap-bio and the antibiotic sparsom to the large ribosomal subunit of haloarcula marismortui
36. " " " " " "  = 1vq9:H *
The structure of cca-phe-cap-bio and the antibiotic sparsomy to the large ribosomal subunit of haloarcula marismortui
37. " " " " " "  = 1vqk:H *
The structure of ccda-phe-cap-bio bound to the a site of the subunit of haloarcula marismortui
38. " " " " " "  = 1vql:H *
The structure of the transition state analogue "dcsn" bound large ribosomal subunit of haloarcula marismortui
39. " " " " " "  = 1vqm:H *
The structure of the transition state analogue "dan" bound t large ribosomal subunit of haloarcula marismortui
40. " " " " " "  = 1vqn:H *
The structure of cc-hpmn and cca-phe-cap-bio bound to the la ribosomal subunit of haloarcula marismortui
41. " " " " " "  = 1vqo:H *
The structure of ccpmn bound to the large ribosomal subunit marismortui
42. " " " " " "  = 1vqp:H *
The structure of the transition state analogue "rap" bound t large ribosomal subunit of haloarcula marismortui
43. 325 32.9% 167 160 275.7 2.2e-08 1yhq:H * Crystal structure of azithromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
44. " " " " " "  = 1yi2:H *
Crystal structure of erythromycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
45. " " " " " "  = 1yij:H *
Crystal structure of telithromycin bound to the g2099a mutan ribosomal subunit of haloarcula marismortui
46. " " " " " "  = 1yit:H *
Crystal structure of virginiamycin m and s bound to the 50s subunit of haloarcula marismortui
47. " " " " " "  = 1yj9:H *
Crystal structure of the mutant 50s ribosomal subunit of hal marismortui containing a three residue deletion in l22
48. " " " " " "  = 1yjn:H *
Crystal structure of clindamycin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
49. " " " " " "  = 1yjw:H *
Crystal structure of quinupristin bound to the g2099a mutant ribosomal subunit of haloarcula marismortui
50. 320 33.7% 166 160 275.7 2.2e-08 2otj:H * 13-deoxytedanolide bound to the large subunit of haloarcula marismortui
51. " " " " " "  = 2otl:H *
Girodazole bound to the large subunit of haloarcula marismor
52. " " " " " "  = 2qa4:H *
A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
53. " " " " " "  = 2qex:H *
Negamycin binds to the wall of the nascent chain exit tunnel 50s ribosomal subunit
54. 325 32.9% 167 160 275.7 2.2e-08 3cc2:H * The refined crystal structure of the haloarcula marismortui ribosomal subunit at 2.4 angstrom resolution with rrna sequ the 23s rrna and genome-derived sequences for r-proteins
55. " " " " " "  = 3cc4:H *
Co-crystal structure of anisomycin bound to the 50s ribosoma
56. " " " " " "  = 3cc7:H *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2487u
57. " " " " " "  = 3cce:H *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535a
58. " " " " " "  = 3ccj:H *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation c2534u
59. " " " " " "  = 3ccl:H *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation u2535c. Density for anisomycin is visible but not in model.
60. " " " " " "  = 3ccm:H *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2611u
61. " " " " " "  = 3ccq:H *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488u
62. " " " " " "  = 3ccr:H *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation a2488c. Density for anisomycin is visible but not in the model.
63. " " " " " "  = 3ccs:H *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482a
64. " " " " " "  = 3ccu:H *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2482c
65. " " " " " "  = 3ccv:H *
Structure of anisomycin resistant 50s ribosomal subunit: 23s mutation g2616a
66. " " " " " "  = 3cd6:H *
Co-cystal of large ribosomal subunit mutant g2616a with cc-p
67. " " " " " "  = 3cma:H *
The structure of cca and cca-phe-cap-bio bound to the large subunit of haloarcula marismortui
68. " " " " " "  = 3cme:H *
The structure of ca and cca-phe-cap-bio bound to the large r subunit of haloarcula marismortui
69. " " " " " "  = 3cpw:H *
The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
70. " " " " " "  = 3g4s:H *
Co-crystal structure of tiamulin bound to the large ribosoma
71. " " " " " "  = 3g6e:H *
Co-crystal structure of homoharringtonine bound to the large subunit
72. " " " " " "  = 3g71:H *
Co-crystal structure of bruceantin bound to the large riboso subunit
73. " " " " " "  = 3i55:H *
Co-crystal structure of mycalamide a bound to the large ribosomal subunit
74. " " " " " "  = 3i56:H *
Co-crystal structure of triacetyloleandomcyin bound to the large ribosomal subunit
75. 334 33.5% 167 165 274.3 2.7e-08 4hub:H The re-refined crystal structure of the haloarcula marismort ribosomal subunit at 2.4 angstrom resolution: more complete of the l7/l12 and l1 stalk, l5 and lx proteins

Number of sequences: 75

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 285 36.5% 156 156 268.4 5.7e-08 1jj2:H * Fully refined crystal structure of the haloarcula marismortui large ribosomal subunit at 2.4 angstrom resolution
2. " " " " " "  = 1k73:J *
Co-crystal structure of anisomycin bound to the 50s ribosomal subunit
3. " " " " " "  = 1k8a:J *
Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
4. " " " " " "  = 1k9m:J *
Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
5. " " " " " "  = 1kc8:J *
Co-crystal structure of blasticidin s bound to the 50s ribosomal subunit
6. " " " " " "  = 1kd1:J *
Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
7. " " " " " "  = 1kqs:H *
The haloarcula marismortui 50s complexed with a pretranslocational intermediate in protein synthesis
8. " " " " " "  = 1m1k:J *
Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
9. " " " " " "  = 1m90:J *
Co-crystal structure of cca-phe-caproic acid-biotin and sparsomycin bound to the 50s ribosomal subunit
10. " " " " " "  = 1n8r:J *
Structure of large ribosomal subunit in complex with virginiamycin m
11. " " " " " "  = 1nji:J *
Structure of chloramphenicol bound to the 50s ribosomal subunit
12. " " " " " "  = 1q7y:J *
Crystal structure of ccdap-puromycin bound at the peptidyl transferase center of the 50s ribosomal subunit
13. " " " " " "  = 1q81:J *
Crystal structure of minihelix with 3' puromycin bound to a- site of the 50s ribosomal subunit.
14. " " " " " "  = 1q82:J *
Crystal structure of cc-puromycin bound to the a-site of the 50s ribosomal subunit
15. " " " " " "  = 1q86:J *
Crystal structure of cca-phe-cap-biotin bound simultaneously at half occupancy to both the a-site and p- site of the the 50s ribosomal subunit.
16. " " " " " "  = 1qvf:H *
Structure of a deacylated tRNA minihelix bound to the e site of the large ribosomal subunit of haloarcula marismortui
17. " " " " " "  = 1qvg:H *
Structure of cca oligonucleotide bound to the tRNA binding sites of the large ribosomal subunit of haloarcula marismortui
18. " " " " " "  = 1w2b:H *
Trigger factor ribosome binding domain in complex with 50s
19. " " " " " "  = 3cxc:H *
The structure of an enhanced oxazolidinone inhibitor bound to the 50s ribosomal subunit of h. Marismortui
20. " " " " " "  = 3ow2:H *
Crystal structure of enhanced macrolide bound to 50s ribosom
21. 310 32.7% 162 156 257.2 2.4e-07 4adx:H The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
22. 199 31.5% 127 157 206.3 0.00016 1ffk:F Crystal structure of the large ribosomal subunit from haloarcula marismortui at 2.4 angstrom resolution
23. 98 28.9% 90 481 122.2 7.8 2die:A Alkaline alpha-amylase amyk from bacillus sp. Ksm-1378
24. 89 26.9% 52 179 116.3 17 1bpl:A Glycosyltransferase
25. 83 37.2% 43 103 111.7 30 2cqg:A Solution structure of the RNA binding domain of tar DNA- binding protein-43
26. 89 26.9% 52 469 111.2 32 1vjs:A Structure of alpha-amylase precursor
27. 89 26.9% 52 481 111.0 33 1bli:A Bacillus licheniformis alpha-amylase
28. 89 36.4% 44 481 111.0 33 1wp6:A * Crystal structure of maltohexaose-producing amylase from alk bacillus sp.707.
29. " " " " " "  = 1wpc:A *
Crystal structure of maltohexaose-producing amylase complexe pseudo-maltononaose
30. " " " " " "  = 2d3l:A *
Crystal structure of maltohexaose-producing amylase from bac sp.707 complexed with maltopentaose.
31. " " " " " "  = 2d3n:A *
Crystal structure of maltohexaose-producing amylase from bac sp.707 complexed with maltohexaose
32. 88 23.7% 198 403 110.7 34 2q14:A Crystal structure of phosphohydrolase (bt4208) from bacteroi thetaiotaomicron vpi-5482 at 2.20 a resolution
33. 83 21.6% 134 154 109.6 40 1xsq:A Crystal structure of ureidoglycolate hydrolase from e.Coli. Northeast structural genomics consortium target et81.
34. 81 29.5% 78 105 109.1 42 4c3h:M * Structure of 14-subunit RNA polymerase i at 3.27 a resolutio crystal form c2-93
35. " " " " " "  = 4c3i:M *
Structure of 14-subunit RNA polymerase i at 3.0 a resolution crystal form c2-100
36. " " " " " "  = 4c3j:M *
Structure of 14-subunit RNA polymerase i at 3.35 a resolutio crystal form c2-90

Number of sequences: 36

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer