spacer
spacer

SAS results for UniProt accession no. J9NU88

Sequence annotated by structure

Key:
Sec. struc: By homology
  Helix Strand  
Residue contacts:   to ligand   to DNA/RNA
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. J9NU88 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. J9NU88 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 75 unique sequences (including 23 consensus sequences) giving 256 sequence matches in all. The 215 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
J9NU88 mvaakktkkslesinsrlqlvmksgkyvlgykqtlkmirhgkaklvilanncpalrkseieyyam   Uncharacterized protein OS=Canis familiaris GN=RPL30 PE=1  ...
2zkr:6 -vaakktkkslesinsrlqlvmksgkyvlgykqtlkmirqgkaklvilanncpalrkseieyyam   Structure of a mammalian ribosomal 60s subunit within an  ...
3vi6:A --------KSLESINSRLQLVMKSGKYVLGYKQTLKMIRQGKAKLVILANNCPALRKSEIEYYAM   Crystal structure of human ribosomal protein l30e
3j3b:c ---------slesinsrlqlvmksgkyvlgykqtlkmirqgkaklvilanncpalrkseieyyam   Structure of the human 60s ribosomal proteins
1ysh:C -----kakksgeninnklqlvmksgkytlgyktvlktlrsskgkliilanncpplrkseieyyam   Localization and dynamic behavior of ribosomal protein l30e
3iz5:f*maptkkakksgeninnklqlvmksgkytlgyktvlktlrsslgkliilanncpplrkseietyam×3 Localization of the large subunit ribosomal proteins into a  ...
3j39:c ---------alestnarlalvmksgkyclgykqtlktlrqgkaklvliasntpalrkseieyyam   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:g -----------dtintkiqlvmksgkyvlgtqqslktlrqgrsklvvisancppirkaeieyyct   High-resolution cryo-electron microscopy structure of the  ...
4a18:G*-----------dniqsklalvmrsgkatlgykstikairngtaklvfisnncptvrkseieyyas×5 T.Thermophila 60s ribosomal subunit in complex with  ...
1ck2:A*-----apvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam×8 Yeast (saccharomyces cerevisiae) ribosomal protein l30
3izc:f*----mapvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam×2 Localization of the large subunit ribosomal proteins into a  ...
3u5i:c*---------sqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3jyw:2*-----------esinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam×3 Structure of the 60s proteins for eukaryotic ribosome based  ...
1t0k:B*------------sinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyam×2 Joint x-ray and nmr refinement of yeast l30e-mRNA complex
2bo1:A ----------mvdiafelrkvidsgkytlgyrktvqslkmggskliiiarntrpdrkedleyyar   Crystal structure of a hybrid ribosomal protein l30e with  ...
3j21:Z*-----------mdlafelrkametgkvvlgsnetirlaktggakliivaknapkeikddiyyyak×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
3cpq:A -----------mdvnkairtavdtgkvilgskrtikfvkhgegklvvlagnipkdleedvkyyak   Crystal structure of l30e a ribosomal protein from  ...
3n4z:A ----------mvdfafelkkaqdtgkivmgakksiqyakmggakliivarnakpdikedieyyak   Crystal structure of quintuple arg-to-lys variant of t. Cele
1w3e:X ----------mvdfafelrkaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyar   Ribosomal l30e of thermococcus celer, p59a mutant
1w40:A ----------mvdfafelraaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyar   T. Celer l30e k9a variant
3n4y:A -----------vdfafelrkaqdtgkivmgarksiqyakmggakliivarnarpdikedieyyar   Crystal structure of wild-type t. Celer l30e in low ionic  ...

                                         1         1    
           7         8         9         0         1    
       6789012345678901234567890123456789012345678901234                   Protein name
       ----+---------+---------+---------+---------+----                   ------------
J9NU88 laktgvhhysgnnielgtacgkyyrvctlaiidpgmfytse--------                   Uncharacterized protein OS=Canis familiaris GN=RPL30 PE=1  ...
2zkr:6 laktgvhhysgnnielgtacgkyyrvctlaiidpgdsdiirsmpeqtge                   Structure of a mammalian ribosomal 60s subunit within an  ...
3vi6:A LAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDII---------                   Crystal structure of human ribosomal protein l30e
3j3b:c laktgvhhysgnnielgtacgkyyrvctlaiidpgdsdiirsmp-----                   Structure of the human 60s ribosomal proteins
1ysh:C lakisvhhfhgnnvdlgtacgkyyrvcclsildpgdsdiisttt-----                   Localization and dynamic behavior of ribosomal protein l30e
3iz5:f*lakisvhhfhgnnvdlgtacgkyyrvcclsildpgdsdiistttttq--                ×3 Localization of the large subunit ribosomal proteins into a  ...
3j39:c laktevqhysgtnielgtacgkyfrvctlsitdpgdsdiirsle-----                   Structure of the d. Melanogaster 60s ribosomal proteins
3zf7:g lsktpihhysgnnldlgtacgrhfracvlsitdvgdsditsa-------                   High-resolution cryo-electron microscopy structure of the  ...
4a18:G*laqisihhfvgsnvelgtacgkyhrcstmaildagdsdilkt-------                ×5 T.Thermophila 60s ribosomal subunit in complex with  ...
1ck2:A*lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla-----                ×8 Yeast (saccharomyces cerevisiae) ribosomal protein l30
3izc:f*lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla-----                ×2 Localization of the large subunit ribosomal proteins into a  ...
3u5i:c*lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla-----                ×4 The structure of the eukaryotic ribosome at 3.0 a  ...
3jyw:2*lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla-----                ×3 Structure of the 60s proteins for eukaryotic ribosome based  ...
1t0k:B*lsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla-----                ×2 Joint x-ray and nmr refinement of yeast l30e-mRNA complex
2bo1:A lsgtpvyefegtnvelgtavgkphtvsvvsildagesrilalggke---                   Crystal structure of a hybrid ribosomal protein l30e with  ...
3j21:Z*lsdipvyefegtsvelgtllgkpfvvaslaivdpgeskilaiakr----                ×2 Promiscuous behavior of proteins in archaeal ribosomes  ...
3cpq:A lsnipvyqhkitslelgavcgkpfpvaallvldeglsnimelvek----                   Crystal structure of l30e a ribosomal protein from  ...
3n4z:A lsgipvyefegtsvelgtllgkphtvsalavvdpgesrilalg------                   Crystal structure of quintuple arg-to-lys variant of t. Cele
1w3e:X lsgiavyefegtsvelgtllgrphtvsalavvdpgesrilalgg-----                   Ribosomal l30e of thermococcus celer, p59a mutant
1w40:A lsgipvyefegtsvelgtllgrphtvsalavvdpgesrilalg------                   T. Celer l30e k9a variant
3n4y:A lsgipvyefegtsvelgtllgrphtvsalavvdpgesrilalgg-----                   Crystal structure of wild-type t. Celer l30e in low ionic  ...

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. J9NU88. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 106 - - J9NU88 Uncharacterized protein OS=Canis familiaris GN=RPL30 PE=1 SV=1
2. 628 99.0% 99 113 866.2 2.8e-41 2zkr:6 Structure of a mammalian ribosomal 60s subunit within an 80s obtained by docking homology models of the RNA and proteins 8.7 a cryo-em map
3. 590 98.9% 92 97 815.4 1.9e-38 3vi6:A Crystal structure of human ribosomal protein l30e
4. 584 98.9% 91 100 807.0 5.6e-38 3j3b:c Structure of the human 60s ribosomal proteins
5. 488 74.7% 95 104 676.1 1.1e-30 1ysh:C Localization and dynamic behavior of ribosomal protein l30e
6. 481 71.0% 100 112 666.1 4e-30 3iz5:f * Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
7. " " " " " "  = 3izr:f *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
8. " " " " " "  = 3j61:c *
Localization of the large subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
9. 478 80.2% 91 100 662.7 6.1e-30 3j39:c Structure of the d. Melanogaster 60s ribosomal proteins
10. 411 60.7% 89 96 571.7 7.2e-25 3zf7:g High-resolution cryo-electron microscopy structure of the tr brucei ribosome
11. 395 62.9% 89 96 549.9 1.2e-23 4a18:G * T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molec
12. " " " " " "  = 4a19:G *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 2.
13. " " " " " "  = 4a1b:G *
T.Thermophila 60s ribosomal subunit in complex with initiation factor 6. This file contains 26s rrna and proteins of molecule 3.
14. " " " " " "  = 4a1d:G *
T.Thermophila 60s ribosomal subunit in complex with initiati factor 6. This file contains 26s rrna and proteins of molecule 4.
15. " " " " " "  = 4adx:6 *
The cryo-em structure of the archaeal 50s ribosomal subunit complex with initiation factor 6
16. 365 60.9% 92 104 508.6 2.4e-21 1ck2:A * Yeast (saccharomyces cerevisiae) ribosomal protein l30
17. " " " " " "  = 1ck5:B *
Ribosomal protein l30-mRNA complex from yeast
18. " " " " " "  = 1ck8:B *
Rpl30-mRNA complex from yeast
19. " " " " " "  = 1ck9:A *
Solution structure of yeast ribosomal protein l30
20. " " " " " "  = 1cn7:A *
Yeast ribosomal protein l30
21. " " " " " "  = 1cn8:A *
Ribosomal protein l30-mRNA complex from yeast
22. " " " " " "  = 1cn9:A *
Rpl30-mRNA complex
23. " " " " " "  = 1nmu:B *
Mbp-l30
24. 365 60.9% 92 105 508.6 2.4e-21 3izc:f * Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
25. " " " " " "  = 3izs:f *
Localization of the large subunit ribosomal proteins into a cryo-em map of saccharomyces cerevisiae translating 80s rib
26. 359 60.4% 91 100 500.7 6.5e-21 3u5i:c * The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome b
27. " " " " " "  = 4b6a:c *
Cryo-em structure of the 60s ribosomal subunit in complex with arx1 and rei1
28. " " " " " "  = 4byn:c *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryo translation initiation complex
29. " " " " " "  = 4byu:c *
Cryo-em reconstruction of the 80s-eif5b-met-itrnamet eukaryotic translation initiation complex
30. 356 60.7% 89 98 496.7 1.1e-20 3jyw:2 * Structure of the 60s proteins for eukaryotic ribosome based map of thermomyces lanuginosus ribosome at 8.9a resolution
31. " " " " " "  = 3o58:Z *
Yeast 80s ribosome. This entry consists of the 60s subunit o first 80s in the asymmetric unit.
32. " " " " " "  = 3o5h:Z *
Yeast 80s ribosome. This entry consists of the 60s subunit o second 80s in the asymmetric unit.
33. 350 60.2% 88 97 488.6 3.1e-20 1t0k:B * Joint x-ray and nmr refinement of yeast l30e-mRNA complex
34. " " " " " "  = 3u5e:c *
The structure of the eukaryotic ribosome at 3.0 a resolution entry contains proteins of the 60s subunit, ribosome a
35. 249 44.8% 87 101 350.8 1.4e-12 2bo1:A Crystal structure of a hybrid ribosomal protein l30e with surface residues from t. Celer, and core residues from yeast
36. 240 44.6% 83 99 338.7 6.8e-12 3j21:Z * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
37. " " " " " "  = 3j44:Z *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
38. 237 36.4% 88 99 334.6 1.2e-11 3cpq:A Crystal structure of l30e a ribosomal protein from methanocaldococcus jannaschii dsm2661 (mj1044)
39. 220 41.0% 83 98 311.5 2.2e-10 3n4z:A Crystal structure of quintuple arg-to-lys variant of t. Cele
40. 213 38.6% 83 99 301.9 7.6e-10 1w3e:X Ribosomal l30e of thermococcus celer, p59a mutant
41. 212 38.6% 83 98 300.6 9e-10 1w40:A T. Celer l30e k9a variant
42. 211 38.6% 83 98 299.3 1.1e-09 3n4y:A Crystal structure of wild-type t. Celer l30e in low ionic st condition without precipitant

Number of sequences: 42

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 211 38.6% 83 98 299.3 1.1e-09 3ra5:A Crystal structure of t. Celer l30e e6a/r92a variant
2. 211 38.6% 83 99 299.2 1.1e-09 1h7m:A Ribosomal protein l30e from thermococcus celer
3. 211 38.6% 83 100 299.2 1.1e-09 1w41:A T.Celer l30e e90a variant
4. 211 38.6% 83 100 299.2 1.1e-09 1w42:A T. Celer l30e r92a variant
5. 211 38.6% 83 102 299.1 1.1e-09 1go0:A * Nmr structure of ribosomal protein l30e from thermococcus celer
6. " " " " " "  = 1go1:A *
Nmr structure of ribosomal protein l30e from thermococcus celer.
7. 211 38.6% 83 101 299.1 1.1e-09 3lfo:A Crystal structure of t. Celer l30e e90a/r92a variant
8. 202 37.3% 83 99 287.0 5.2e-09 3ra6:A Crystal structure of t. Celer l30e e62a/k46a variant
9. 115 33.3% 81 120 167.4 0.024 3id5:C Crystal structure of sulfolobus solfataricus c/d rnp assembl nop5, fibrillarin, l7ae and a split half c/d RNA
10. 115 33.3% 81 122 167.3 0.024 3pla:C Crystal structure of a catalytically active substrate-bound rnp from sulfolobus solfataricus
11. 106 27.7% 101 118 155.2 0.11 2czw:A Crystal structure analysis of protein component ph1496p of p.Horikoshii ribonuclease p
12. 106 27.7% 101 119 155.2 0.11 3lwq:C Structure of h/aca rnp bound to a substrate RNA containing 3
13. 106 27.7% 101 120 155.1 0.12 1pxw:B Crystal structure of l7ae srnp core protein from pyrococcus abyssii
14. 106 27.7% 101 121 155.1 0.12 2hvy:D * Crystal structure of an h/aca box rnp from pyrococcus furios
15. " " " " " "  = 3hax:D *
Crystal structure of a substrate-bound gar1-minus h/aca rnp pyrococcus furiosus
16. " " " " " "  = 3hay:D *
Crystal structure of a substrate-bound full h/aca rnp from pyrococcus furiosus
17. 106 27.7% 101 120 155.1 0.12 3hjw:C * Structure of a functional ribonucleoprotein pseudouridine sy bound to a substrate RNA
18. " " " " " "  = 3lwo:C *
Structure of h/aca rnp bound to a substrate RNA containing 5
19. " " " " " "  = 3lwp:C *
Structure of h/aca rnp bound to a substrate RNA containing 5
20. " " " " " "  = 3lwr:C *
Structure of h/aca rnp bound to a substrate RNA containing 4
21. " " " " " "  = 3lwv:C *
Structure of h/aca rnp bound to a substrate RNA containing 2 deoxyuridine
22. 106 27.7% 101 121 155.1 0.12 3nmu:C * Crystal structure of substrate-bound halfmer box c/d rnp
23. " " " " " "  = 3nvi:B *
Structure of n-terminal truncated nop56/58 bound with l7ae a RNA
24. " " " " " "  = 3nvk:E *
Structural basis for substrate placement by an archaeal box ribonucleoprotein particle
25. " " " " " "  = 4by9:D *
The structure of the box cd enzyme reveals regulation of rrn methylation
26. 106 27.7% 101 123 155.0 0.12 3j20:3 * Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal subunit)
27. " " " " " "  = 3j21:G *
Promiscuous behavior of proteins in archaeal ribosomes revea cryo-em: implications for evolution of eukaryotic ribosomes ribosomal proteins)
28. " " " " " "  = 3j43:3 *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (30s ribosomal subunit)
29. " " " " " "  = 3j44:G *
Structure of the methanococcus jannaschii ribosome-secyebeta complex (50s ribosomal subunit)
30. 105 29.2% 89 99 154.9 0.12 3on1:A The structure of a protein with unknown function from bacill halodurans c
31. 106 27.7% 101 128 154.8 0.12 1pxw:A Crystal structure of l7ae srnp core protein from pyrococcus abyssii
32. 99 28.4% 102 117 145.7 0.38 1ra4:A Crystal structure of the methanococcus jannaschii l7ae protein
33. 99 28.4% 102 118 145.7 0.39 1xbi:A High resolution structure of methanocaldococcus jannaschii l7ae
34. 98 29.4% 85 109 144.8 0.43 1sds:B Structure of protein l7ae bound to a k-turn derived from an box h/aca srna
35. 98 29.4% 85 115 144.5 0.45 1sds:A Structure of protein l7ae bound to a k-turn derived from an box h/aca srna
36. 96 27.3% 77 81 143.8 0.49 3v7e:A * Crystal structure of ybxf bound to the sam-i riboswitch apta
37. " " " " " "  = 4lck:A *
Co-crystal structure of a t-box riboswitch stem i domain in with its cognate tRNA
38. 94 27.5% 102 117 138.9 0.92 3paf:A M. Jannaschii l7ae mutant
39. 91 27.7% 83 97 136.0 1.3 3v7q:A Crystal structure of b. Subtilis ylxq at 1.55 a resolution
40. 92 29.6% 81 124 135.9 1.4 2fc3:A Crystal structure of the extremely thermostable aeropyrum pe multifunctional protein
41. 90 27.3% 66 77 135.9 1.3 3v7e:B Crystal structure of ybxf bound to the sam-i riboswitch apta
42. 89 30.3% 89 113 132.3 2.1 1rlg:A Molecular basis of box c/d RNA-protein interaction: co- crystal structure of the archaeal srnp intiation complex
43. 89 30.3% 89 115 132.2 2.2 4c4w:C Structure of a rare, non-standard sequence k-turn bound by l7ae protein
44. 89 30.3% 89 117 132.1 2.2 4bw0:B The molecular recognition of kink turn structure by the l7ae class of proteins
45. 90 24.8% 101 172 131.2 2.5 3sdy:B * Crystal structure of broadly neutralizing antibody cr8020 bo influenza a h3 hemagglutinin
46. " " " " " "  = 4fnk:B *
Crystal structure of the a/hong kong/1/1968 (h3n2) influenza hemagglutinin
47. " " " " " "  = 4fqr:B *
Crystal structure of broadly neutralizing antibody c05 bound influenza hemagglutinin
48. " " " " " "  = 4fqy:B *
Crystal structure of broadly neutralizing antibody cr9114 bo influenza hemagglutinin
49. " " " " " "  = 4nm8:B *
Crystal structure of broadly neutralizing antibody cr8043 bo influenza hemagglutinin
50. 83 35.6% 59 120 123.8 6.4 3o85:A Giardia lamblia 15.5kd RNA binding protein
51. 82 32.6% 43 309 116.9 16 3j2u:K Kinesin-13 klp10a hd in complex with cs-tubulin and a microt
52. 83 24.6% 57 398 116.8 16 1dt9:A The crystal structure of human eukaryotic release factor erf1-mechanism of stop codon recognition and peptidyl-tRNA hydrolysis
53. 76 32.2% 59 123 114.1 22 3j60:M Localization of the small subunit ribosomal proteins into a cryo-em map of triticum aestivum translating 80s ribosome
54. 81 30.0% 60 419 113.8 23 2i9u:A Crystal structure of guanine deaminase from c. Acetobutylicu bound guanine in the active site
55. 77 28.9% 38 164 113.8 23 2ktu:A * Human erf1 c-domain, "closed" conformer
56. " " " " " "  = 2ktv:A *
Human erf1 c-domain, "open" conformer
57. 78 28.9% 45 266 112.3 28 3fsg:A Crystal structure of alpha/beta superfamily hydrolase from o oeni psu-1
58. 75 28.1% 64 156 111.4 31 1or6:B Crystal structure of hemat sensor domain from b.Subtilis in the unliganded form
59. 75 28.1% 64 158 111.3 32 1or4:B Crystal structure of hemat sensor domain from b.Subtilis in the cyano-liganded form
60. 75 28.1% 64 169 110.9 33 1or4:A Crystal structure of hemat sensor domain from b.Subtilis in the cyano-liganded form
61. 75 28.1% 64 168 110.9 33 1or6:A Crystal structure of hemat sensor domain from b.Subtilis in the unliganded form
62. 77 28.9% 38 318 109.9 38 3e1y:C Crystal structure of human erf1/erf3 complex
63. 77 28.9% 38 380 108.9 43 3e1y:A Crystal structure of human erf1/erf3 complex
64. 69 31.9% 47 60 108.8 44 3uz8:8 * Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-tyr complex.
65. " " " " " "  = 3uz9:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-tyr complex.
66. " " " " " "  = 3uzf:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex
67. " " " " " "  = 3uzh:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex.
68. " " " " " "  = 3uzk:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-tyr complex with paromomycin
69. " " " " " "  = 3uzn:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-tyr complex with paromomycin
70. 69 31.9% 47 61 108.7 44 3tve:8 * Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the cognate tRNA-leu complex
71. " " " " " "  = 3tvh:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the cognate tRNA-leu complex
72. " " " " " "  = 3uye:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
73. " " " " " "  = 3uyg:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex
74. " " " " " "  = 3uz1:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the first 70s molecule in the unit for the near-cognate tRNA-leu complex with paromomycin
75. " " " " " "  = 3uz2:8 *
Crystal structure analysis of ribosomal decoding. This entry the 50s ribosomal subunit of the second 70s molecule in the asymmetric unit for the near-cognate tRNA-leu complex with paromomycin.
76. " " " " " "  = 4g5l:8 *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule a.
77. " " " " " "  = 4g5n:8 *
Crystal structure of the 70s ribosome with tetracycline. Thi contains the 50s subunit of molecule b.
78. " " " " " "  = 4g5u:8 *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule a.
79. " " " " " "  = 4g5w:8 *
Crystal structure of the 70s ribosome with tigecycline. This contains the 50s subunit of molecule b.
80. 77 28.3% 92 394 108.7 45 4ina:A Crystal structure of the q7mss8_wolsu protein from wolinella succinogenes. Northeast structural genomics consortium targ
81. 69 31.9% 47 62 108.6 45 3huz:8 Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule ii.
82. 69 31.9% 47 63 108.5 45 1vsa:a * Crystal structure of a 70s ribosome-tRNA complex reveals fun interactions and rearrangements. This file, 1vsa, contains ribosome subunit. 30s ribosome subunit is in the file 2ow8
83. " " " " " "  = 1vsp:a *
Interactions and dynamics of the shine-dalgarno helix in the ribosome. This file, 1vsp, contains the 50s ribosome subuni ribosome subunit is in the file 2qnh
84. " " " " " "  = 2xqe:8 *
The structure of ef-tu and aminoacyl-tRNA bound to the 70s ribosome with a gtp analog
85. " " " " " "  = 2xtg:8 *
tRNA tranlocation on the 70s ribosome: the pre- translocational translocation intermediate ti(pre)
86. " " " " " "  = 2xux:8 *
tRNA translocation on the 70s ribosome: the post- translocational translocation intermediate ti(post)
87. " " " " " "  = 2y0v:8 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
88. " " " " " "  = 2y0x:8 *
The crystal structure of ef-tu and a9c-tRNA-trp bound to a near-cognate codon on the 70s ribosome
89. " " " " " "  = 2y0z:8 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
90. " " " " " "  = 2y11:8 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
91. " " " " " "  = 2y13:8 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a near-cognate codon on the 70s ribosome
92. " " " " " "  = 2y15:8 *
The crystal structure of ef-tu and g24a-tRNA-trp bound to a cognate codon on the 70s ribosome.
93. " " " " " "  = 2y17:8 *
Ef-tu complex 3
94. " " " " " "  = 2y19:8 *
The crystal structure of ef-tu and trp-tRNA-trp bound to a cognate codon on the 70s ribosome.
95. " " " " " "  = 3d5b:8 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of one 70s ribosome. The enti structure contains two 70s ribosomes as described in remark
96. " " " " " "  = 3d5d:8 *
Structural basis for translation termination on the 70s ribo file contains the 50s subunit of the second 70s ribosome. T crystal structure contains two 70s ribosomes as described i 400.
97. " " " " " "  = 3f1f:8 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of o ribosome. The entire crystal structure contains two 70s rib described in remark 400.
98. " " " " " "  = 3f1h:8 *
Crystal structure of a translation termination complex forme release factor rf2. This file contains the 50s subunit of t 70s ribosome. The entire crystal structure contains two 70s as described in remark 400.
99. " " " " " "  = 3hux:8 *
Structure of ef-p bound to the 70s ribosome; this file conta 50s subunit for molecule i.
100. " " " " " "  = 3kir:8 *
Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 2 of 4)
101. " " " " " "  = 3kit:8 *
Structure of rele nuclease bound to the 70s ribosome (precleavage state; part 4 of 4)
102. " " " " " "  = 3kiw:8 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 2 of 4)
103. " " " " " "  = 3kiy:8 *
Structure of rele nuclease bound to the 70s ribosome (postcleavage state; part 4 of 4)
104. " " " " " "  = 3mrz:5 *
Recognition of the amber stop codon by release factor rf1. T 3mrz contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3ms0. Molecule a in the same asymmetric deposited as 3mr8 (50s) and 3ms1 (30s).
105. " " " " " "  = 3ms1:5 *
Recognition of the amber stop codon by release factor rf1. T 3ms1 contains 50s ribosomal subunit. The 30s ribosomal subu found in PDB entry 3mr8. Molecule b in the same asymmetric deposited as 3mrz (50s) and 3ms0 (30s).
106. " " " " " "  = 3pyo:5 *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the first 70s ribosome.
107. " " " " " "  = 3pyr:5 *
Crystal structure of a complex containing domain 3 from the ires RNA bound to the 70s ribosome. This file contains the subunit of the second 70s ribosome.
108. " " " " " "  = 3pyt:5 *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the first 70s ribosome.
109. " " " " " "  = 3pyv:5 *
Crystal structure of a complex containing domain 3 of crpv i RNA bound to the 70s ribosome. This file contains the 50s s the second 70s ribosome.
110. " " " " " "  = 4jux:8 *
Crystal structure of the ribosome bound to elongation factor guanosine triphosphatase state (this file contains the 50s
111. " " " " " "  = 4k0m:8 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
112. " " " " " "  = 4k0q:8 *
Crystal structure of thermus thermophilus 70s containing trn mRNA stop codon with pseudouridine
113. " " " " " "  = 4kfi:8 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the a subunit
114. " " " " " "  = 4kfl:8 *
Crystal structure of the 70s ribosome bound with the q253p m release factor rf2. 50s of the b subunit
115. " " " " " "  = 4l6j:5 *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the first 70s ribosome.
116. " " " " " "  = 4l6l:5 *
Crystal structure of blasticidin s bound to thermus thermoph ribosome. This file contains the 50s subunit and blasticidi molecule from the second 70s ribosome
117. 69 31.9% 47 64 108.4 46 1vvm:8 * Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u on the ribosome
118. " " " " " "  = 1vvo:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u on the ribosome
119. " " " " " "  = 1vvq:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-a on the ribosome
120. " " " " " "  = 1vvs:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-a on the ribosome
121. " " " " " "  = 1vvu:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccg-g on the ribosome
122. " " " " " "  = 1vvw:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccg-g on the ribosome
123. " " " " " "  = 1vvy:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u in the absence of paromomycin
124. " " " " " "  = 1vw0:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-u in the absence of paromomycin
125. " " " " " "  = 1vx9:8 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-u ribosome
126. " " " " " "  = 1vxj:8 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-u ribosome
127. " " " " " "  = 1vxl:8 *
Crystal structure of tRNA proline (cgg) bound to codon ccg-g ribosome
128. " " " " " "  = 1vxn:8 *
Crystal structure of tRNA proline (cgg) bound to codon ccg-g ribosome
129. " " " " " "  = 1vxq:8 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-g ribosome
130. " " " " " "  = 1vxt:8 *
Crystal structure of tRNA proline (cgg) bound to codon ccc-g ribosome
131. " " " " " "  = 1vy1:8 *
Crystal structure of unmodified tRNA proline (cgg) bound to on the ribosome
132. " " " " " "  = 1vy3:8 *
Crystal structure of unmodified tRNA proline (cgg) bound to on the ribosome
133. 69 31.9% 47 64 108.4 46 2hgj:7 * Crystal structure of the 70s thermus thermophilus ribosome s the 16s 3'-end mimicks mRNA e and p codons. This entry 2hgj 50s ribosomal subunit. The 30s ribosomal subunit can be fou entry 2hgi.
134. " " " " " "  = 2hgq:7 *
Crystal structure of the 70s thermus thermophilus ribosome w translocated and rotated shine-dalgarno duplex. This entry contains 50s ribosomal subunit. The 30s ribosomal subunit c found in PDB entry 2hgp.
135. " " " " " "  = 2hgu:7 *
70s t.Th. Ribosome functional complex with mRNA and e- and p trnas at 4.5a. This entry 2hgu contains 50s ribosomal subun 30s ribosomal subunit can be found in PDB entry 2hgr.
136. 69 31.9% 47 64 108.4 46 2j01:8 * Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 2 of 4). This file contains the 50s subunit from molecule i.
137. " " " " " "  = 2j03:8 *
Structure of the thermus thermophilus 70s ribosome complexed with mRNA, tRNA and paromomycin (part 4 of 4). This file contains the 50s subunit from molecule ii.
138. " " " " " "  = 2jl6:8 *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 2 of 4). This file contains the 50s subunit.
139. " " " " " "  = 2jl8:8 *
Insights into translational termination from the structure of rf2 bound to the ribosome (part 4 of 4). This file contains the 50s subunit.
140. " " " " " "  = 2v47:8 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 2 of 4). This file contains the 50s subunit for molecule 1.
141. " " " " " "  = 2v49:8 *
Structure of the ribosome recycling factor bound to the thermus thermophilus 70s ribosome with mRNA, asl-phe and tRNA-fmet (part 4 of 4). This file contains the 50s subunit of molecule 2.
142. " " " " " "  = 2wdi:8 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule i.
143. " " " " " "  = 2wdj:8 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a-site tRNA, deacylated p-site tRNA, and e-site tRNA. This file contains the 50s subunit for molecule ii.
144. " " " " " "  = 2wdl:8 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule i.
145. " " " " " "  = 2wdn:8 *
Structure of the thermus thermophilus 70s ribosome in complex with mRNA, paromomycin, acylated a- and p-site trnas, and e-site tRNA. This file contains the 50s subunit for molecule ii.
146. " " " " " "  = 2wh2:8 *
Insights into translational termination from the structure of rf2 bound to the ribosome
147. " " " " " "  = 2wh4:8 *
Insights into translational termination from the structure of rf2 bound to the ribosome
148. " " " " " "  = 2wrj:8 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state (part 2 of 4).
149. " " " " " "  = 2wrl:8 *
The structure of the ribosome with elongation factor g trapped in the post-translocational state. (Part 4 of 4).
150. " " " " " "  = 2wro:8 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 2 of 4).
151. " " " " " "  = 2wrr:8 *
The crystal structure of the 70s ribosome bound to ef-tu and tRNA (part 4 of 4).
152. " " " " " "  = 2x9s:8 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
153. " " " " " "  = 2x9u:8 *
Structure of the 70s ribosome bound to release factor 2 and a substrate analog provides insights into catalysis of peptide release
154. " " " " " "  = 2xg0:8 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 2 of 4)
155. " " " " " "  = 2xg2:8 *
Structure of cytotoxic domain of colicin e3 bound to the 70s ribosome (part 4 of 4)
156. " " " " " "  = 3fin:8 *
T. Thermophilus 70s ribosome in complex with mRNA, trnas and tu.Gdp.Kirromycin ternary complex, fitted to a 6.4 a cryo-e this file contains the 50s subunit.
157. " " " " " "  = 3i8f:8 *
Elongation complex of the 70s ribosome with three trnas and entry 3i8f contains 50s ribosomal subunit. The 30s ribosoma can be found in PDB entry 3i8g. Molecule b in the same asym unit is deposited as 3i8g (30s) and 3i8f (50s).
158. " " " " " "  = 3i8i:8 *
Elongation complex of the 70s ribosome with three trnas and entry 3i8i contains 50s ribosomal subnit. The 30s ribosomal can be found in PDB entry 3i8h. Molecule a in the same asym unit is deposited as 3i8f (50s) and 3i8g (30s).
159. " " " " " "  = 3i9c:8 *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9c contains 50s ribosomal subunit of molecule b. The 30s subunit can be found in PDB entry 3i9b. Molecule a in the s asymmetric unit is deposited as 3i9d (30s) and 3i9e (50s)
160. " " " " " "  = 3i9e:8 *
Initiation complex of 70s ribosome with two trnas and mRNA. 3i9e contains 50s ribosomal subunit of molecule a. The 30s subunit can be found in PDB entry 3i9d. Molecule b in the s asymmetric unit is deposited as 3i9b (30s) and 3i9c (50s)
161. 77 28.9% 38 411 108.4 46 3j2k:6 Cryo-em structure of the mammalian erf1-erf3-associated term complex
162. 77 28.9% 38 414 108.4 46 3j5y:A Structure of the mammalian ribosomal pre-termination complex associated with erf1-erf3-gdpnp
163. 69 31.9% 47 64 108.4 46 3kni:8 * The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule i
164. " " " " " "  = 3knk:8 *
The structures of viomycin bound to the 70s ribosome. This f contains the 50s subunit for molecule ii.
165. " " " " " "  = 3knm:8 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule i.
166. " " " " " "  = 3kno:8 *
The structures of capreomycin bound to the 70s ribosome. Thi contains the 50s subunit for molecule ii
167. " " " " " "  = 3oh5:8 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
168. " " " " " "  = 3oh7:8 *
Structure of the thermus thermophilus 70s ribosome complexed chloramphenicol. This file contains the 50s subunit of one ribosome. The entire crystal structure contains two 70s rib
169. " " " " " "  = 3ohj:8 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
170. " " " " " "  = 3ohk:8 *
Structure of the thermus thermophilus ribosome complexed wit erythromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
171. " " " " " "  = 3ohz:8 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
172. " " " " " "  = 3oi1:8 *
Structure of the thermus thermophilus 70s ribosome complexed azithromycin. This file contains the 50s subunit of one 70s the entire crystal structure contains two 70s ribosomes.
173. " " " " " "  = 3oi3:8 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
174. " " " " " "  = 3oi5:8 *
Structure of the thermus thermophilus 70s ribosome complexed telithromycin. This file contains the 50s subunit of one 70 ribosome. The entire crystal structure contains two 70s rib
175. " " " " " "  = 3uxq:8 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
176. " " " " " "  = 3uxr:8 *
The structure of thermorubin in complex with the 70s ribosom thermus thermophilus. This file contains the 50s subunit of ribosome. The entire crystal structure contains two 70s rib
177. " " " " " "  = 3v23:8 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
178. " " " " " "  = 3v25:8 *
Crystal structure of rmf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 2nd ribosom asu
179. " " " " " "  = 3v27:8 *
Crystal structure of hpf bound to the 70s ribosome. This PDB contains coordinates for the 50s subunit of the 1st ribosom asu
180. " " " " " "  = 3v29:8 *
Crystal structure of hpf bound to the 70s ribosome. This ent contains the 50s subunit of the 2nd molecule in the asu.
181. " " " " " "  = 3v2d:8 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 1st ribosom asu
182. " " " " " "  = 3v2f:8 *
Crystal structure of yfia bound to the 70s ribosome. This pd contains coordinates for the 50s subunit of the 2nd ribosom asu
183. " " " " " "  = 3v6w:8 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit
184. " " " " " "  = 3v6x:8 *
Crystal structure of the bacterial ribosome ram mutation g34 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit
185. " " " " " "  = 3zn9:8 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
186. " " " " " "  = 3zne:8 *
The crystal structure of agmatidine tRNA-ile2 bound to the 70s ribosome in the a and p site.
187. " " " " " "  = 3zvp:8 *
Crystal structure of the hybrid state of ribosome in complex the guanosine triphosphatase release factor 3
188. " " " " " "  = 4abs:8 *
Complex of smpb, a tmrna fragment and ef-tu-gdp-kirromycin w 70s ribosome
189. " " " " " "  = 4b8g:8 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
190. " " " " " "  = 4b8i:8 *
Crystal structure of 70s ribosome with both cognate trnas in and p sites representing an authentic elongation complex.
191. " " " " " "  = 4btd:8 *
Thermus thermophilus ribosome
192. " " " " " "  = 4byc:8 *
Structure of thermus thermophilus 50s ribosome
193. " " " " " "  = 4bye:8 *
Structure of thermus thermophilus 50s ribosome
194. " " " " " "  = 4dha:8 *
Crystal structure of yaej bound to the 70s ribosome
195. " " " " " "  = 4dhc:8 *
Crystal structure of yaej bound to the 70s ribosome
196. " " " " " "  = 4ejb:8 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the first 70s m the asymmetric unit.
197. " " " " " "  = 4ejc:8 *
Crystal structure of the bacterial ribosome ram mutation g29 entry contains the 50s ribosomal subunit of the second 70s in the asymmetric unit.
198. " " " " " "  = 4kbu:8 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit a. The full asymmetric unit contains PDB entries 4kbt (30s subunit a), 4kbv (30s subuni 4kbw (50s subunit b).
199. " " " " " "  = 4kbw:8 *
70s ribosome translocation intermediate gdpnp-ii containing factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains 50s ribosomal subunit b. The full asymmetric unit contains PDB entries 4kbv (30s subunit b), 4kbt (30s subuni 4kbu (50s subunit a).
200. " " " " " "  = 4kcz:8 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state.T contains the 50s ribosomal subunit a. The 30s subunit a can in 4kcy. Molecule b in the same asymmetric unit is deposite (30s) and 4kd2 (50s).G1 50s ribosomal subunit i
201. " " " " " "  = 4kd2:8 *
70s ribosome translocation intermediate gdpnp-i containing e factor efg/gdpnp, mRNA, and tRNA bound in the pe /E state. Contains the 50s ribosomal subunit b. The 30s subunit b can in 4kd0. Molecule a in the same asymmetric unit is deposite (30s) and 4kcz (50s).
202. " " " " " "  = 4kd9:8 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kd8. Molecule b in the same asymmetric uni deposited as 4kda (30s) and 4kdb (50s).
203. " " " " " "  = 4kdb:8 *
70s ribosome translocation intermediate fa-3.6a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kda. Molecule a in the same asymmetric uni deposited as 4kd8 (30s) and 4kd9 (50s).
204. " " " " " "  = 4kdh:8 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit a. The 30s su can be found in 4kdg. Molecule b in the same asymmetric uni deposited as 4kdj (30s) and 4kdk (50s).
205. " " " " " "  = 4kdk:8 *
70s ribosome translocation intermediate fa-4.2a containing e factor efg/fusidic acid/gdp, mRNA, and tRNA bound in the pe this entry contains the 50s ribosomal subunit b. The 30s su can be found in 4kdj. Molecule a in the same asymmetric uni deposited as 4kdg (30s) and 4kdh (50s).
206. " " " " " "  = 4kx0:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-g on the ribosome
207. " " " " " "  = 4kx2:8 *
Crystal structure of frameshift suppressor tRNA sufa6 bound ccc-g on the ribosome
208. " " " " " "  = 4qcn:8 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing acylated substrates in the a and p sites. This entry contains the 50 of the first 70s ribosome in the asu.
209. " " " " " "  = 4qcp:8 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing acylated substrates in the a and p sites. This entry contains the 50 of the second 70s ribosome in the asu.
210. " " " " " "  = 4qcr:8 *
Crystal structure of the thermus thermophilus 70s ribosome i post-catalysis state of peptide bond formation containing d tRNA in the a site and deacylated tRNA in the p site. This contains the 50s subunit of the first 70s ribosome in the a
211. " " " " " "  = 4qct:8 *
Crystal structure of the thermus thermophilus 70s ribosome i post-catalysis state of peptide bond formation containing d tRNA in the a site and deacylated tRNA in the p site. This contains the 50s subunit of the second 70s ribosome in the
212. " " " " " "  = 4qcv:8 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-puromycin in the a site and acylated tRNA in site. This entry contains the 50s subunit of the first 70s in the asu.
213. " " " " " "  = 4qcx:8 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-puromycin in the a site and acylated tRNA in site. This entry contains the 50s subunit of the second 70s in the asu.
214. " " " " " "  = 4qcz:8 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-cytidine-puromycin in the a site and acylate the p site. This entry contains the 50s subunit of the firs ribosome in the asu.
215. " " " " " "  = 4qd1:8 *
Crystal structure of the thermus thermophilus 70s ribosome i attack state of peptide bond formation containing short sub mimic cytidine-cytidine-puromycin in the a site and acylate the p site. This entry contains the 50s subunit of the seco ribosome in the asu.

Number of sequences: 215

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer