spacer
spacer

SAS results for UniProt accession no. P01375

Sequence annotated by structure

Key:
Sec. struc: By homology Predicted
  Helix Strand   Helix Strand
Residue contacts:   to ligand   to metal
Active sites:   (from PDB SITE records)
PROSITE patterns: Low   High conservation

Predicted secondary structure (green) comes from the DSC program. The lighter the green the less certain the prediction. Secondary structure shown in red comes from a homologous protein structure which is at least 30% sequence identical to the target protein and has an alignment overlap of at least 80 residues or at least three-quarters of the length of the target sequence (whichever overlap is the larger).

Click on annotated residues to get source(s) of each annotation.

 

FASTA alignment for UniProt accession no. P01375 - coloured by no. of contacts to ligand

Below are the FASTA results from a search of the sequence of UniProt accession no. P01375 against all protein sequences in the PDB. Identical sequences are grouped together and represented by a single 'consensus' sequence (asterisked) onto which all relevant annotations are mapped. The number of sequences represented by each consensus sequence is shown by the '×n' on the right of the alignment. Use the box below to modify the annotations shown on the alignment. At the bottom of the page are given the FASTA stats for all the sequences. There you can exclude any sequences from the alignment.

Struct

FASTA

The search returned 90 unique sequences (including 15 consensus sequences) giving 108 sequence matches in all. The 83 sequences excluded from the alignment are listed at the end.

Modify alignment: Annotate by:
  Number:  
  Show secondary structure: Yes No  


                1         2         3         4         5         6     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P01375 mstesmirdvelaeealpkktggpqgsrrclflslfsflivagattlfcllhfgvigpqreefpr   Tumor necrosis factor OS=Homo sapiens GN=TNF PE=1 SV=1
1a8m:A*-----------------------------------------------------------------×2 Tumor necrosis factor alpha, r31d mutant
1tnf:A*-----------------------------------------------------------------×2 The structure of tumor necrosis factor-alpha at 2.6  ...
3l9j:T -----------------------------------------------------------------   Selection of a novel highly specific tnfalpha antagonist:  ...
2tun:A -----------------------------------------------------------------   Conformational changes in the (ala-84-val) mutant of tumor  ...
4g3y:C -----------------------------------------------------------------   Crystal structure of tnf-alpha in complex with infliximab fa
4tsw:A*-----------------------------------------------------------------×2 High resolution crystal structure of a human tnf-alpha  ...
4tsv:A -----------------------------------------------------------------   High resolution crystal structure of a human tnf-alpha mutan
2e7a:A -----------------------------------------------------------------   Tnf receptor subtype one-selective tnf mutant with  ...
2zjc:B -----------------------------------------------------------------   Tnfr1 selectve tnf mutant; r1-6
2az5:B -----------------------------------------------------------------   Crystal structure of tnf-alpha with a small molecule  ...
3alq:A -----------------------------------------------------------------   Crystal structure of tnf-tnfr2 complex
2e7a:B -----------------------------------------------------------------   Tnf receptor subtype one-selective tnf mutant with  ...
2zjc:A -----------------------------------------------------------------   Tnfr1 selectve tnf mutant; r1-6
2zpx:A -----------------------------------------------------------------   Tnf receptor subtype one-selective tnf mutant with  ...
2tnf:A -----------------------------------------------------------------   1.4 a resolution structure of mouse tumor necrosis factor,  ...
2az5:A -----------------------------------------------------------------   Crystal structure of tnf-alpha with a small molecule  ...
1tnr:A -----------------------------------------------------------------   Crystal structure of the soluble human 55 kd tnf receptor-  ...
2o0o:A -----------------------------------------------------------------   Crystal structure of tl1a
3ugn:B*-----------------------------------------------------------------×2 Crystal structure of light
  " :C*-----------------------------------------------------------------×2 Crystal structure of light

                                         1         1         1         1
           7         8         9         0         1         2         3
       67890123456789012345678901234567890123456789012345678901234567890   Protein name
       ----+---------+---------+---------+---------+---------+---------+   ------------
P01375 dlslisplaqavrsssrtpsdkpvahvv-anpqaegq--------lqwlnrranallangvelrd   Tumor necrosis factor OS=Homo sapiens GN=TNF PE=1 SV=1
1a8m:A*----------------rtpsdkpvahvv-anpqaegq--------lqwlndranallangvelrd×2 Tumor necrosis factor alpha, r31d mutant
1tnf:A*----------------rtpsdkpvahvv-anpqaegq--------lqwlnrranallangvelrd×2 The structure of tumor necrosis factor-alpha at 2.6  ...
3l9j:T -------------------sdkpvahvv-anpqaegq--------lqwlnrranallangvelrd   Selection of a novel highly specific tnfalpha antagonist:  ...
2tun:A -----------------tpsdkpvahvv-anpqaegq--------lqwlnrranallangvelrd   Conformational changes in the (ala-84-val) mutant of tumor  ...
4g3y:C --------------------dkpvahvv-anpqaegq--------lqwlnrranallangvelrd   Crystal structure of tnf-alpha in complex with infliximab fa
4tsw:A*-------------------sdkpvahvv-anpqaegq--------lqwsnrranallangvelrd×2 High resolution crystal structure of a human tnf-alpha  ...
4tsv:A --------------------dkpvahvv-anpqaegq--------lqwsnrranallangvelrd   High resolution crystal structure of a human tnf-alpha mutan
2e7a:A ------------------psdmpvahvv-anpqaegq--------lqwlnrranallangvelrd   Tnf receptor subtype one-selective tnf mutant with  ...
2zjc:B -----------------TPSDMPVAHVV-ANPQAEGQ--------LQWKNAGANALLANGVELRD   Tnfr1 selectve tnf mutant; r1-6
2az5:B --------------------DKPVAHVV-ANPQAEGQ--------LQWLNRRANALLANGVELRD   Crystal structure of tnf-alpha with a small molecule  ...
3alq:A -------------------sdmpvahvv-anpqaegq--------lqwlnrranallangvelrd   Crystal structure of tnf-tnfr2 complex
2e7a:B ------------------psdmpvahvv-anpqaegq--------lqwlnrranallangvelrd   Tnf receptor subtype one-selective tnf mutant with  ...
2zjc:A ------------------PSDMPVAHVV-ANPQAEGQ--------LQWKNAGANALLANGVELRD   Tnfr1 selectve tnf mutant; r1-6
2zpx:A ------------------psdmpvahvv-anpqaegq--------lqwlnrranallangvelrd   Tnf receptor subtype one-selective tnf mutant with  ...
2tnf:A -------------------SDKPVAHVV-ANHQVEEQ--------LEWLSQRANALLANGMDLKD   1.4 a resolution structure of mouse tumor necrosis factor,  ...
2az5:A --------------------DKPVAHVV-ANPQAEGQ--------LQWLN-----LLANGVELRD   Crystal structure of tnf-alpha with a small molecule  ...
1tnr:A ---------------------kpaahli-gdpskqns--------llwrantdraflqdgfslsn   Crystal structure of the soluble human 55 kd tnf receptor-  ...
2o0o:A -------------------gdkprahlt-vvrqtptqhfknqfpalhwehelglaftknrmnytn   Crystal structure of tl1a
3ugn:B*--------------------VNPAAHLTGANSSSGGP--------LLWETQLGLAFL-RGLSYHD×2 Crystal structure of light
  " :C*--------------------VNPAAHLT-GA-NSSGP--------LLWETQLGLAFL-RGLSYHD×2 Crystal structure of light

                1         1         1         1         1         1     
                4         5         6         7         8         9     
       12345678901234567890123456789012345678901234567890123456789012345   Protein name
       ---------+---------+---------+---------+---------+---------+-----   ------------
P01375 nqlvvpseglyliysqvlfkgqg--c-p---sthvllthtisriavsyqtkvnllsaikspcqre   Tumor necrosis factor OS=Homo sapiens GN=TNF PE=1 SV=1
1a8m:A*nqlvvpseglyliysqvlfkgqg--c-p---sthvllthtisriavsyqtkvnllsaikspcqre×2 Tumor necrosis factor alpha, r31d mutant
1tnf:A*nqlvvpseglyliysqvlfkgqg--c-p---sthvllthtisriavsyqtkvnllsaikspcqre×2 The structure of tumor necrosis factor-alpha at 2.6  ...
3l9j:T nqlvvpseglyliysqvlfkgqg--c-p---sthvllthtisriavsyqtkvnllsaikspcqre   Selection of a novel highly specific tnfalpha antagonist:  ...
2tun:A nqlvvpseglyliysqvlfkgqg--c-p---sthvllthtisrivvsyqtkvnllsaikspcqre   Conformational changes in the (ala-84-val) mutant of tumor  ...
4g3y:C nqlvvpseglyliysqvlfkgqg--c-p---sthvllthtisriavsyqtkvnllsaikspcqre   Crystal structure of tnf-alpha in complex with infliximab fa
4tsw:A*nqlvvpieglfliysqvlfkgqg--c-p---sthvllthtisriavsyqtkvnllsaikspcqre×2 High resolution crystal structure of a human tnf-alpha  ...
4tsv:A nqlvvpieglfliysqvlfkgqg--c-p---sthvllthtisriavsyqtkvnllsaikspcqre   High resolution crystal structure of a human tnf-alpha mutan
2e7a:A nqlvvpseglyliysqvlfsgqg--c-p---sthvllthtisristthnqpvnllsairspcqre   Tnf receptor subtype one-selective tnf mutant with  ...
2zjc:B NQLVVPSEGLYLIYSQVLFSGQG--C-P---STHVLLTHTISRIAVSYQTPVNLLSAIRSPCQRE   Tnfr1 selectve tnf mutant; r1-6
2az5:B NQLVVPSEGLYLIYSQVLFKGQG--C-P---STHVLLTHTISRIAVSYQTKVNLLSAIKSPCQR-   Crystal structure of tnf-alpha with a small molecule  ...
3alq:A nqlvvpseglyliysqvlfsgqg--c-p---sthvllthtisriavsyqtpvnllsairspcq--   Crystal structure of tnf-tnfr2 complex
2e7a:B nqlvvpseglyliysqvlfsgqg--c-p---sthvllthtisristthnqpvnllsairspcq--   Tnf receptor subtype one-selective tnf mutant with  ...
2zjc:A NQLVVPSEGLYLIYSQVLFSGQG--C-P---STHVLLTHTISRIAVSYQTPVNLLSAIRSPCQ--   Tnfr1 selectve tnf mutant; r1-6
2zpx:A nqlvvpseglyliysqvlfsgqg--c-p---sthvllthtisritpainrpvnllsairspcq--   Tnf receptor subtype one-selective tnf mutant with  ...
2tnf:A NQLVVPADGLYLVYSQVLFKGQG--C-P---D-YVLLTHTVSRFAISYQEKVNLLSAVKSPCPKD   1.4 a resolution structure of mouse tumor necrosis factor,  ...
2az5:A NQLVVPSEGLYLIYSQVLFKGQG--C-P---STHVLLTHTISRIAVSYQTKVNLLSAIKSPC---   Crystal structure of tnf-alpha with a small molecule  ...
1tnr:A nsllvptsgiyfvysqvvfsgkay-s-pkatssplylahevqlfssqypfhvpllss-----qkm   Crystal structure of the soluble human 55 kd tnf receptor-  ...
2o0o:A kfllipesgdyfiysqvtfrgmtsecrp---nkpdsitvvitkvtdsypeptqllmgtksvcev-   Crystal structure of tl1a
3ugn:B*GALVVTKAGYYYIYSKVQLGGVG--C-P---LSTI--THGLYKRTPRYPEELELLVSQQSPCGRA×2 Crystal structure of light
  " :C*GALVVTKAGYYYIYSKVQLGGVG--C-PL--GLASTITHGLYKRTPRYPEELELLVSQQSPCGRA×2 Crystal structure of light

           2         2         2         2         2        
           0         1         2         3         4        
       67890123456789012345678901234567890123456789012345678               Protein name
       ----+---------+---------+---------+---------+--------               ------------
P01375 tpegaeakpwyepiylggvfqlekgdrlsaeinrpdyldfaesgqvyfgiial               Tumor necrosis factor OS=Homo sapiens GN=TNF PE=1 SV=1
1a8m:A*tpegaeakpwyepiylggvfqlekgdrlsaeinrpdyldfaesgqvyfgiial            ×2 Tumor necrosis factor alpha, r31d mutant
1tnf:A*tpegaeakpwyepiylggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial            ×2 The structure of tumor necrosis factor-alpha at 2.6  ...
3l9j:T tpegaeakpwyepiylggvfqlekgdrlsaeinrpdyldfaesgqvyfgiial               Selection of a novel highly specific tnfalpha antagonist:  ...
2tun:A tpegaeakpwyepiylggvfqlekgdrlsaeinrpdyllfaesgqvyfgiial               Conformational changes in the (ala-84-val) mutant of tumor  ...
4g3y:C tpegaeakpwyepiylggvfqlekgdrlsaeinrpdyldfaesgqvyfgiial               Crystal structure of tnf-alpha in complex with infliximab fa
4tsw:A*tpegaeakpwyepiylggvfqlekgdrlsaeinrpdyldfaesgqvyfgiial            ×2 High resolution crystal structure of a human tnf-alpha  ...
4tsv:A tpegaeakpwyepiylggvfqlekgdrlsaeinrpdyldfaesgqvyfgiial               High resolution crystal structure of a human tnf-alpha mutan
2e7a:A tpegaeanpwyepiylggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial               Tnf receptor subtype one-selective tnf mutant with  ...
2zjc:B TPEGAEANPWYEPIYLGGVFQLEPGDRLSAEINRPDYLDFASTGQVYFGIIAL               Tnfr1 selectve tnf mutant; r1-6
2az5:B -------KPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL               Crystal structure of tnf-alpha with a small molecule  ...
3alq:A ------anpwyepiylggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial               Crystal structure of tnf-tnfr2 complex
2e7a:B ------anpwyepiylggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial               Tnf receptor subtype one-selective tnf mutant with  ...
2zjc:A ------ANPWYEPIYLGGVFQLEPGDRLSAEINRPDYLDFASTGQVYFGIIAL               Tnfr1 selectve tnf mutant; r1-6
2zpx:A ------anpwyepiylggvfqlepgdrlsaeinrpdyldfaesgqvyfgiial               Tnf receptor subtype one-selective tnf mutant with  ...
2tnf:A TPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL               1.4 a resolution structure of mouse tumor necrosis factor,  ...
2az5:A --------PWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL               Crystal structure of tnf-alpha with a small molecule  ...
1tnr:A vypglq-epwlhsmyhgaafqltqgdqlsthtdgiphlvlsps-tvffgafal               Crystal structure of the soluble human 55 kd tnf receptor-  ...
2o0o:A ---gsn---wfqpiylgamfslqegdklmvnvsdislvdytkedktffgafll               Crystal structure of tl1a
3ugn:B*T---SSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV            ×2 Crystal structure of light
  " :C*T---SSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV            ×2 Crystal structure of light

Residue colours: black = 0, purple = 1, blue = 2, green = 3, orange = 4, red = 5 or more contacts.

Sequence listing

The listing below shows the FASTA statistics for the PDB entries that matched UniProt accession no. P01375. Ditto marks indicate identical sequences represented by a single representative sequence in the alignment above. The representative is asterisked and the names of all its duplicate sequences are indented to the right.

Structures whose names are given in purple are those that are annotated above. The parameters defining which sequences can transfer their annotations are shown at the bottom of the page where they can be altered and the alignment regenerated.

Use the checkboxes to the left of the PDB codes to exclude any sequences from the alignment (or to add back any sequences in the Excluded list). Then click the SELECT button at the bottom of the page to redisplay the alignment.

Aligned sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. - - - 233 - - P01375 Tumor necrosis factor OS=Homo sapiens GN=TNF PE=1 SV=1
2. 999 99.3% 152 152 1357.2 1.3e-68 1a8m:A * Tumor necrosis factor alpha, r31d mutant
3. " " " " " "  = 3wd5:A *
Crystal structure of tnfalpha in complex with adalimumab fab
4. 996 99.3% 152 152 1353.1 2.2e-68 1tnf:A * The structure of tumor necrosis factor-alpha at 2.6 angstroms resolution. Implications for receptor binding
5. " " " " " "  = 3it8:A *
Crystal structure of tnf alpha complexed with a poxvirus mhc tnf binding protein
6. 986 100.0% 149 149 1339.7 1.2e-67 3l9j:T Selection of a novel highly specific tnfalpha antagonist: in the crystal structure of the antagonist-tnfalpha complex
7. 984 98.7% 151 151 1336.9 1.7e-67 2tun:A Conformational changes in the (ala-84-val) mutant of tumor n factor
8. 981 100.0% 148 148 1333.0 2.8e-67 4g3y:C Crystal structure of tnf-alpha in complex with infliximab fa
9. 966 98.0% 149 149 1312.6 3.9e-66 4tsw:A * High resolution crystal structure of a human tnf-alpha mutant
10. " " " " " "  = 5tsw:A *
High resolution crystal structure of a human tnf-alpha mutant
11. 961 98.0% 148 148 1305.9 9.2e-66 4tsv:A High resolution crystal structure of a human tnf-alpha mutan
12. 928 92.0% 150 150 1261.1 2.9e-63 2e7a:A Tnf receptor subtype one-selective tnf mutant with antagonistic activity
13. 927 92.7% 151 151 1259.7 3.4e-63 2zjc:B Tnfr1 selectve tnf mutant; r1-6
14. 904 94.6% 148 140 1229.1 1.7e-61 2az5:B Crystal structure of tnf-alpha with a small molecule inhibitor
15. 870 90.6% 149 141 1183.0 6.4e-59 3alq:A Crystal structure of tnf-tnfr2 complex
16. 849 86.7% 150 142 1154.6 2.5e-57 2e7a:B Tnf receptor subtype one-selective tnf mutant with antagonistic activity
17. 843 87.3% 150 142 1146.4 7e-57 2zjc:A Tnfr1 selectve tnf mutant; r1-6
18. 841 86.7% 150 142 1143.7 9.9e-57 2zpx:A Tnf receptor subtype one-selective tnf mutant with antagonistic activity; r1anttnf-t8
19. 826 80.5% 149 148 1123.1 1.4e-55 2tnf:A 1.4 a resolution structure of mouse tumor necrosis factor, towards modulation of its selctivity and trimerisation
20. 827 89.2% 148 132 752.9 5.8e-35 2az5:A Crystal structure of tnf-alpha with a small molecule inhibitor
21. 293 34.4% 151 144 401.5 2.2e-15 1tnr:A Crystal structure of the soluble human 55 kd tnf receptor- human tnf-beta complex: implications for tnf receptor activation
22. 254 30.8% 159 153 348.3 2e-12 2o0o:A Crystal structure of tl1a
23. 248 32.2% 143 143 340.7 5.3e-12 3ugn:B * Crystal structure of light
24. " " " " " "  = 4en0:B *
Crystal structure of light
25. 235 30.8% 143 144 323.0 5.1e-11 3ugn:C * Crystal structure of light
26. " " " " " "  = 4en0:C *
Crystal structure of light

Number of sequences: 26

Excluded sequences

  Smith-
Waterman
score
%-tage
identity
a.a.
overlap
Seq
len
z-score E-
value
  PDB
code
Protein name
1. 249 29.4% 170 164 311.2 2.3e-10 2re9:A Crystal structure of tl1a at 2.1 a
2. 222 31.3% 147 145 305.4 4.9e-10 3ugn:A * Crystal structure of light
3. " " " " " "  = 4en0:A *
Crystal structure of light
4. 300 34.7% 147 137 292.2 2.7e-09 4mxv:A Structure of lymphotoxin alpha bound to anti-lta fab
5. 215 29.5% 149 139 269.1 5.2e-08 4msv:A Crystal structure of fasl and dcr3 complex
6. 273 34.0% 147 134 255.8 2.8e-07 4mxw:X Structure of heterotrimeric lymphotoxin lta1b2 bound to lymp beta receptor ltbr and anti-lta fab
7. 167 25.5% 157 156 230.3 7.5e-06 3urf:A Human rankl/opg complex
8. 166 24.5% 147 149 229.3 8.5e-06 1dg6:A Crystal structure of apo2l/trail
9. 210 31.5% 146 139 224.4 1.6e-05 4j6g:A Crystal structure of light and dcr3 complex
10. 224 32.2% 146 139 224.4 1.6e-05 4kgq:A Crystal structure of a human light loop mutant in complex wi
11. 260 31.8% 151 141 221.6 2.3e-05 2rjk:A Crystal structure of human tl1a extracellular domain c95s mutant
12. 210 30.8% 146 141 218.9 3.2e-05 4kgg:A Crystal structure of light mutant2 and dcr3 complex
13. 258 31.5% 149 140 216.2 4.5e-05 2qe3:A Crystal structure of human tl1a extracellular domain
14. 154 24.5% 159 154 211.5 8.4e-05 4e4d:X Crystal structure of mouse rankl-opg complex
15. 154 24.5% 159 156 211.4 8.5e-05 1iqa:A Crystal structure of the extracellular domain of mouse rank ligand
16. 154 24.5% 159 155 211.4 8.4e-05 1jtz:X Crystal structure of trance/rankl cytokine.
17. 154 24.5% 159 156 211.4 8.5e-05 1s55:A * Mouse rankl structure at 1.9a resolution
18. " " " " " "  = 3me2:A *
Crystal structure of mouse rankl-rank complex
19. 154 24.5% 159 155 211.4 8.4e-05 3nzy:A * Crystal structure of extracellular domains of mouse rank-ran
20. " " " " " "  = 3qbq:A *
Crystal structure of extracellular domains of mouse rank-ran
21. 154 24.5% 159 155 211.4 8.4e-05 4giq:A Crystal structure of mouse rank bound to rankl
22. 153 24.1% 141 163 211.0 8.8e-05 1d4v:B Crystal structure of trail-dr5 complex
23. 151 23.8% 130 151 208.9 0.00012 1d0g:A Crystal structure of death receptor 5 (dr5) bound to apo2l/trail
24. 151 23.8% 130 152 208.9 0.00012 1du3:D Crystal structure of trail-sdr5
25. 230 32.0% 150 134 208.4 0.00012 4mxw:Z Structure of heterotrimeric lymphotoxin lta1b2 bound to lymp beta receptor ltbr and anti-lta fab
26. 153 28.6% 147 146 203.7 0.00023 1cda:A Cytokine
27. 246 31.1% 151 141 202.6 0.00026 2rjl:A Crystal structure of human tl1a extracellular domain c95s/c135s mutant
28. 215 31.1% 148 131 201.8 0.00029 4mxw:Y Structure of heterotrimeric lymphotoxin lta1b2 bound to lymp beta receptor ltbr and anti-lta fab
29. 236 30.1% 156 144 197.1 0.00053 3mi8:A The structure of tl1a-dcr3 complex
30. 154 27.2% 147 143 193.1 0.00089 1i9r:A Structure of cd40l in complex with the fab fragment of humanized 5c8 antibody
31. 154 27.2% 147 146 192.9 0.00091 1aly:A Crystal structure of human cd40 ligand
32. 235 29.5% 156 143 182.2 0.0036 3k51:A Crystal structure of dcr3-tl1a complex
33. 168 27.2% 147 133 171.9 0.013 3lkj:A Small molecule inhibition of the tnf family cyokine cd40 lig through a subunit fracture mechanism
34. 158 29.5% 146 129 161.3 0.052 4kg8:A Crystal structure of light mutant
35. 159 29.1% 148 135 159.6 0.065 3qd6:A Crystal structure of the cd40 and cd154 (cd40l) complex
36. 147 29.6% 125 115 159.5 0.066 4kg8:C Crystal structure of light mutant
37. 157 28.3% 145 132 157.1 0.089 3lkj:B Small molecule inhibition of the tnf family cyokine cd40 lig through a subunit fracture mechanism
38. 141 31.2% 144 120 130.7 2.6 4kg8:B Crystal structure of light mutant
39. 97 24.5% 155 334 129.9 2.9 2w0u:A Crystal structure of human glycolate oxidase in complex with the inhibitor 5-[(4-chlorophenyl)sulfanyl]- 1,2,3-thiadiazole-4-carboxylate.
40. 118 29.7% 118 106 124.9 5.6 1bzi:B Theoretical model of the cd95-ligand complex
41. 93 25.4% 142 335 124.4 5.9 2rdt:A Crystal structure of human glycolate oxidase (go) in complex
42. 93 25.4% 142 360 123.9 6.3 2rdu:A Crystal structure of human glycolate oxidase in complex with glyoxylate
43. 93 25.4% 142 359 123.9 6.3 2rdw:A Crystal structure of human glycolate oxidase in complex with
44. 124 24.8% 137 134 123.1 7 1d2q:A Crystal structure of human trail
45. 92 25.5% 141 339 123.0 7.1 2nzl:A Crystal structure of human hydroxyacid oxidase 1
46. 91 25.6% 160 435 119.8 11 4hgg:A Crystal structure of p450 bm3 5f5r heme domain variant compl styrene
47. 91 24.7% 158 457 119.4 11 4dua:A Cytochrome p450 bm3h-9d7 mri sensor, no ligand
48. 91 24.7% 158 456 119.4 11 4dub:A Cytochrome p450 bm3h-9d7 mri sensor bound to dopamine
49. 85 29.3% 116 155 119.3 11 1x51:A Solution structure of the nudix domain from human a/g- specific adenine DNA glycosylase alpha-3 splice isoform
50. 88 27.6% 76 345 117.4 14 3qea:Z * Crystal structure of human exonuclease 1 exo1 (wt) in comple (complex ii)
51. " " " " " "  = 3qeb:Z *
Crystal structure of human exonuclease 1 exo1 (wt) in comple and mn2+ (complex iii)
52. 89 23.7% 156 451 116.8 16 2ij4:A Structure of the a264k mutant of cytochrome p450 bm3
53. 87 31.0% 58 345 116.1 17 3qe9:Y Crystal structure of human exonuclease 1 exo1 (d173a) in com DNA (complex i)
54. 87 27.2% 81 351 116.0 17 1nzd:A * T4 phage bgt-d100a mutant in complex with udp-glucose: form
55. " " " " " "  = 1nzf:A *
T4 phage bgt-d100a mutant in complex with udp-glucose: form
56. 88 28.3% 92 427 115.9 18 3b13:A Crystal structure of the dhr-2 domain of dock2 in complex wi (t17n mutant)
57. 88 23.7% 156 450 115.5 19 4kew:A Structure of the a82f bm3 heme domain in complex with omepra
58. 88 23.7% 156 450 115.5 19 4key:A * Structure of p450 bm3 a82f f87v in complex with omeprazole
59. " " " " " "  = 4o4p:A *
Structure of p450 bm3 a82f f87v in complex with s-omeprazol
60. 86 22.7% 150 314 115.4 19 3een:A * Crystal structure of malonyl-coa:acyl carrier protein transa (fabd), xoo0880, from xanthomonas oryzae pv. Oryzae kacc103
61. " " " " " "  = 3k89:A *
Structure of x. Oryzae pv. Oryzae kacc10331, xoo0880(fabd) c with glycerol
62. " " " " " "  = 3r97:A *
Crystal structure of malonyl-coa:acyl carrier protein transa (fabd), xoo0880, from xanthomonas oryzae pv. Oryzae kacc103
63. 88 23.7% 156 461 115.3 19 4kpa:A Crystal structure of cytochrome p450 bm-3 in complex with n- palmitoylglycine (npg)
64. 82 24.6% 114 166 114.8 20 3g9k:S Crystal structure of bacillus anthracis transpeptidase enzym
65. 87 25.2% 159 442 114.3 22 4hgf:A Crystal structure of p450 bm3 5f5k heme domain variant compl styrene
66. 85 24.8% 113 125 114.2 22 2q8o:A Crystal structure of mouse gitr ligand dimer
67. 87 25.2% 159 448 114.2 22 4hgj:A Crystal structure of p450 bm3 5f5 heme domain variant
68. 87 23.7% 156 454 114.1 22 3ekd:A Crystal structure of the a264m heme domain of cytochrome p450 bm3
69. 87 25.2% 159 455 114.0 22 4hgh:A * Crystal structure of p450 bm3 5f5 heme domain variant comple styrene (dataset i)
70. " " " " " "  = 4hgi:A *
Crystal structure of p450 bm3 5f5 heme domain variant comple styrene (dataset ii)
71. 86 24.7% 158 442 112.9 26 3ekb:A Crystal structure of the a264c mutant heme domain of cytochrome p450 bm3
72. 83 24.8% 113 123 111.6 31 2qdn:A * Crystal structure of mouse gitrl
73. " " " " " "  = 3b9i:A *
Crystal structure of mouse gitrl at 2.5 a.
74. " " " " " "  = 3fc0:A *
1.8 a crystal structure of murine gitr ligand dimer expressed in drosophila melanogaster s2 cells
75. 79 21.1% 90 159 111.0 33 1q42:A Crystal structure analysis of the candida albicans mtr2
76. 80 36.6% 41 203 110.6 35 1z7n:E Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis with bound prpp substrate
77. 84 25.2% 159 444 110.2 37 4du2:B Cytochrome p450 bm3h-b7 mri sensor bound to dopamine
78. 84 24.5% 159 453 110.0 38 2ij3:A Structure of the a264h mutant of cytochrome p450 bm3
79. 78 20.4% 98 165 109.4 41 1q40:A Crystal structure of thE C. Albicans mtr2-mex67 m domain com
80. 83 25.2% 159 453 108.7 45 4dtw:B * Cytochrome p450 bm3h-8c8 mri sensor bound to serotonin
81. " " " " " "  = 4dty:B *
Cytochrome p450 bm3h-8c8 mri sensor, no ligand
82. " " " " " "  = 4dtz:A *
Cytochrome p450 bm3h-8c8 mri sensor bound to dopamine
83. 83 24.5% 159 455 108.6 45 1smj:A Structure of the a264e mutant of cytochrome p450 bm3 complexed with palmitoleate

Number of sequences: 83

Select or deselect any sequence by clicking its checkbox.
Selection shortcuts : select all/none invert selection

Then click to effect selection changes.

Annotation parameters

The parameters below were used in determining which structural annotations could be transferred on to the target sequence. You can change the parameters and regenerate the SAS alignments and annotation by pressing the Rerun button.

Min. seq. identity:   Min. seq. overlap   Max. E-value

  spacer

spacer